--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Wed Nov 02 15:47:08 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/138/CG4038-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1492.24 -1504.61
2 -1492.58 -1505.07
--------------------------------------
TOTAL -1492.39 -1504.87
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.309377 0.002926 0.215577 0.421155 0.303538 1210.11 1212.61 1.000
r(A<->C){all} 0.101518 0.001723 0.022318 0.183122 0.099089 587.56 638.47 1.000
r(A<->G){all} 0.052691 0.000316 0.022435 0.088833 0.050588 645.09 870.30 1.000
r(A<->T){all} 0.315167 0.004607 0.185090 0.448524 0.313794 452.39 494.16 1.001
r(C<->G){all} 0.013782 0.000067 0.000057 0.028812 0.012535 921.03 1066.81 1.000
r(C<->T){all} 0.508875 0.004850 0.380184 0.650879 0.507765 409.32 480.27 1.000
r(G<->T){all} 0.007968 0.000058 0.000004 0.023265 0.005723 543.13 823.11 1.000
pi(A){all} 0.210209 0.000194 0.183599 0.238704 0.210064 1324.15 1329.31 1.000
pi(C){all} 0.218220 0.000207 0.190257 0.246401 0.218073 1274.97 1319.89 1.000
pi(G){all} 0.396147 0.000310 0.361699 0.430659 0.396214 1201.06 1230.26 1.000
pi(T){all} 0.175424 0.000172 0.151527 0.202016 0.175200 1136.46 1238.19 1.000
alpha{1,2} 0.042421 0.000907 0.000116 0.096570 0.038097 1327.69 1364.39 1.000
alpha{3} 2.132023 0.685901 0.726705 3.719047 2.015897 1176.01 1338.51 1.000
pinvar{all} 0.465818 0.006771 0.286759 0.606787 0.473849 1025.03 1201.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1308.362881
Model 2: PositiveSelection -1307.912638
Model 0: one-ratio -1314.188851
Model 3: discrete -1307.912638
Model 7: beta -1308.365262
Model 8: beta&w>1 -1307.913159
Model 0 vs 1 11.651940000000195
Model 2 vs 1 0.9004860000000008
Model 8 vs 7 0.9042060000001584
>C1
MGFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLFIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
GGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGGRGRWooo
>C2
MGFGKPRGGGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGG
GRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIFLE
NKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLPIA
RFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRGGG
GFRGGAGRGGGGGGGGGGFNRGRGGGGGGRGRWooooooo
>C3
MGFGKPRGGGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGG
GRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIFLE
NKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLPIA
RFLPKPPQPKGAKKAFTNNRGGGGGGGFGGRGGGRGGGGRGGGGGRGGGG
FRGGAGRGGGGGGGGGGGFNRGRGGGGGGGGGGGGGRGRW
>C4
MGFGKPRGGGGGGGRFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFNRGG
GGRGGGRGAFDSGPPERVIPLGNYVYACQNDLVCKVDIQDVPYFNAPIFL
ENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPDQKLYIDPGKLLPI
ARFLPKPPQPKGAKKAFTNNRGGGGGGFGGRGGGRGGGGRGGGGGRGGGG
GGFRGGAGRNGGGGGGGGGFNRGRGGSGGGGGRGRWoooo
>C5
MGFGKPRGGGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFNRGGG
GRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIFLE
NKEQVGKIDEIFGTVRDYSVSIKLSENVYANSFKPNQKLFIDPGKLLPIA
RFLPKPPQPKGAKKAFTNNRGGGGGGFGGRGGGRGGGGRGGGGGRGGGGF
RGGAGRNGGGGGGGGGGGFNRGRGGGGGGRGRWooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=253
C1 MGFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRG
C2 MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG
C3 MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG
C4 MGFGKPRGGGGGGGR-FGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFNRG
C5 MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFNRG
*************** ****** ***********************.**
C1 GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
C2 GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
C3 GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
C4 GGGRGGGRGAFDSGPPERVIPLGNYVYACQNDLVCKVDIQDVPYFNAPIF
C5 GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
************:**********::**:**********************
C1 LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLFIDPGKLLP
C2 LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
C3 LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
C4 LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPDQKLYIDPGKLLP
C5 LENKEQVGKIDEIFGTVRDYSVSIKLSENVYANSFKPNQKLFIDPGKLLP
***************************:*********:***:********
C1 IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
C2 IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
C3 IARFLPKPPQPKGAKKAFTNNRGGGGGGG-FGGRGGGRGGGGRGGGGGRG
C4 IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG
C5 IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG
**************************** ********************
C1 GGG--FRGGAGRNGGGGGGGG---FNRGRGGGGGGGG----GRGRWooo-
C2 GGG--FRGGAGR-GGGGGGGGGG-FNRGRGGGGGG-------RGRWoooo
C3 GGG--FRGGAGR-GGGGGGGGGGGFNRGRGGGGGGGGGGGGGRGRW----
C4 GGGGGFRGGAGRNGGGGGGGGG--FNRGRGGSGGGG-----GRGRWoooo
C5 GGG--FRGGAGRNGGGGGGGGGGGFNRGRGGGGG-------GRGRWoooo
*** ******* ******** *******.** ****
C1 ---
C2 ooo
C3 ---
C4 ---
C5 ooo
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 240 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 240 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6004]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [6004]--->[5898]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.282 Mb, Max= 30.572 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MGFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLFIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGRNGGGGGGGG---FNRGRGGGGGGGG----GRGRWooo-
---
>C2
MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGR-GGGGGGGGGG-FNRGRGGGGGG-------RGRWoooo
ooo
>C3
MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGG-FGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGR-GGGGGGGGGGGFNRGRGGGGGGGGGGGGGRGRW----
---
>C4
MGFGKPRGGGGGGGR-FGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFNRG
GGGRGGGRGAFDSGPPERVIPLGNYVYACQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPDQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG
GGGGGFRGGAGRNGGGGGGGGG--FNRGRGGSGGGG-----GRGRWoooo
---
>C5
MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFNRG
GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSENVYANSFKPNQKLFIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGRNGGGGGGGGGGGFNRGRGGGGG-------GRGRWoooo
ooo
FORMAT of file /tmp/tmp2632559164231475388aln Not Supported[FATAL:T-COFFEE]
>C1
MGFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLFIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGRNGGGGGGGG---FNRGRGGGGGGGG----GRGRWooo-
---
>C2
MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGR-GGGGGGGGGG-FNRGRGGGGGG-------RGRWoooo
ooo
>C3
MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGG-FGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGR-GGGGGGGGGGGFNRGRGGGGGGGGGGGGGRGRW----
---
>C4
MGFGKPRGGGGGGGR-FGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFNRG
GGGRGGGRGAFDSGPPERVIPLGNYVYACQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPDQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG
GGGGGFRGGAGRNGGGGGGGGG--FNRGRGGSGGGG-----GRGRWoooo
---
>C5
MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFNRG
GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSENVYANSFKPNQKLFIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGRNGGGGGGGGGGGFNRGRGGGGG-------GRGRWoooo
ooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:253 S:92 BS:253
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 98.29 C1 C2 98.29
TOP 1 0 98.29 C2 C1 98.29
BOT 0 2 98.28 C1 C3 98.28
TOP 2 0 98.28 C3 C1 98.28
BOT 0 3 97.46 C1 C4 97.46
TOP 3 0 97.46 C4 C1 97.46
BOT 0 4 99.14 C1 C5 99.14
TOP 4 0 99.14 C5 C1 99.14
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 97.42 C2 C4 97.42
TOP 3 1 97.42 C4 C2 97.42
BOT 1 4 97.47 C2 C5 97.47
TOP 4 1 97.47 C5 C2 97.47
BOT 2 3 97.40 C3 C4 97.40
TOP 3 2 97.40 C4 C3 97.40
BOT 2 4 97.41 C3 C5 97.41
TOP 4 2 97.41 C5 C3 97.41
BOT 3 4 97.44 C4 C5 97.44
TOP 4 3 97.44 C5 C4 97.44
AVG 0 C1 * 98.29
AVG 1 C2 * 98.30
AVG 2 C3 * 98.27
AVG 3 C4 * 97.43
AVG 4 C5 * 97.86
TOT TOT * 98.03
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGAGGCTT
C2 ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGAGGCTT
C3 ATGGGATTTGGTAAACCTCGTGGCGGCGGAGGCGGCGGCGGAAGAGGCTT
C4 ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGA---TT
C5 ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGTAGAGGATT
*****************************:***********:*** **
C1 CGGTGGAGGCGGAGGCGGAGGAGGACGAGGATTTGGTGGAGGTGGAGGTG
C2 CGGAGGAGGCGGCGGC------GGACGAGGATTTGGAGGAGGTGGCGGCG
C3 CGGAGGAGGCGGCGGC------GGACGAGGATTTGGAGGAGGTGGCGGTG
C4 CGGAGGAGGTGGCGGCGGCGGCGGACGTGGATTTGGAGGAGGTGGTGGTG
C5 TGGAGGAGGCGGTGGC------GGACGAGGATTTGGAGGAGGTGGTGGTG
**:***** ** *** *****:********:******** ** *
C1 GACGAGGAGGTGGCGGAGGACGCGGAGGTGGCGGCGGATTCGGTCGAGGT
C2 GACGCGGTGGTGGCGGCGGACGCGGAGGTGGTGGCGGATTCGGCCGTGGA
C3 GACGCGGTGGTGGTGGCGGACGCGGAGGTGGCGGCGGATTCGGCCGTGGA
C4 GACGCGGTGGTGGCGGCGGACGTGGAGGTGGCGGCGGATTCAACCGAGGA
C5 GACGCGGTGGCGGCGGCGGACGCGGAGGTGGCGGCGGATTCAACCGAGGA
****.**:** ** **.***** ******** *********.. **:**:
C1 GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACACTGGTCCACCAGA
C2 GGCGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACTCTGGTCCACCGGA
C3 GGCGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACTCTGGTCCACCGGA
C4 GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGATTCTGGTCCACCGGA
C5 GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGATACTGGACCACCGGA
**.******************************** :****:*****.**
C1 GAGAGTCATCCCCTTGGGCAACTATGTTTACTCCTGCCAAAACGACCTTG
C2 GAGAGTCATCCCCTTGGGCGACTTCGTTTACTCCTGCCAAAACGACCTTG
C3 GAGAGTCATCCCATTGGGCGACTTCGTTTACTCCTGCCAAAACGACCTCG
C4 GAGAGTAATCCCCTTGGGCAACTACGTTTACGCCTGCCAAAATGACCTTG
C5 GAGAGTAATCCCCTTGGGCAACTATGTATACTCCTGCCAAAATGACCTTG
******.*****.******.***: **:*** ********** ***** *
C1 TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC
C2 TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC
C3 TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC
C4 TGTGCAAAGTTGACATTCAGGATGTTCCGTATTTCAACGCGCCCATTTTC
C5 TGTGCAAAGTTGATATTCAGGATGTTCCGTATTTCAACGCGCCCATTTTC
************* ************** ** ******************
C1 CTTGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGAACAGT
C2 CTTGAAAACAAGGAGCAAGTAGGCAAAATTGACGAGATCTTTGGAACAGT
C3 CTTGAAAACAAGGAGCAAGTAGGCAAAATCGACGAGATCTTTGGAACAGT
C4 CTCGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGTACAGT
C5 CTCGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGTACAGT
** ************************** *****.********:*****
C1 TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA
C2 TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA
C3 TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA
C4 TAGGGACTACAGCGTGTCCATTAAGCTGTCGGACAACGTCTACGCCAACA
C5 TCGGGACTACAGCGTGTCCATCAAGCTGTCGGAGAACGTCTACGCCAACA
*.******************* *********** ****************
C1 GCTTCAAGCCAAATCAGAAACTGTTTATCGACCCTGGAAAGCTGTTACCC
C2 GCTTCAAACCAAATCAGAAACTGTATATCGACCCTGGAAAACTGTTACCC
C3 GCTTCAAGCCAAATCAGAAACTGTATATCGACCCTGGAAAGCTGTTACCC
C4 GCTTCAAACCAGATCAGAAACTCTATATCGACCCTGGAAAGCTGTTACCG
C5 GCTTCAAGCCAAATCAGAAACTTTTTATCGACCCTGGAAAGCTGTTACCG
*******.***.********** *:***************.********
C1 ATCGCCAGATTTCTGCCGAAACCTCCACAACCAAAAGGCGCCAAGAAAGC
C2 ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCCAAGAAAGC
C3 ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCCAAGAAAGC
C4 ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCAAAGAAAGC
C5 ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCGAAGAAGGC
********.** *********** ***************** *****.**
C1 CTTCACAAATAACCGAGGTGGAGGCGGCGGTGGCGGTGGATTTGGAGGCC
C2 CTTCACAAATAACCGAGGCGGAGGCGGCGGTGGCGGTGGATTTGGAGGCC
C3 CTTCACAAATAACCGAGGCGGAGGCGGCGGTGGCGGA---TTTGGAGGCC
C4 CTTCACAAATAACCGCGGCGGTGGCGGCGGTGGA------TTTGGAGGCC
C5 CTTCACAAATAACCGTGGTGGAGGCGGCGGTGGA------TTTGGAGGTC
*************** ** **:***********. ******** *
C1 GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT
C2 GAGGTGGTGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGC
C3 GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGC
C4 GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT
C5 GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT
******* *****************************************
C1 GGAGGCGGA------TTCCGAGGAGGTGCTGGTCGCAATGGAGGAGGTGG
C2 GGAGGCGGA------TTCCGAGGAGGAGCTGGTCGA---GGAGGAGGTGG
C3 GGAGGCGGA------TTCCGAGGAGGAGCTGGTCGA---GGAGGAGGTGG
C4 GGAGGCGGAGGCGGTTTCCGAGGAGGAGCTGGTCGCAATGGAGGAGGTGG
C5 GGAGGCGGT------TTCCGAGGAGGAGCTGGTCGCAATGGTGGAGGAGG
********: ***********:********. **:*****:**
C1 CGGCGGCGGCGGT---------TTTAACAGAGGACGAGGAGGCGGTGGCG
C2 CGGCGGCGGCGGCGGCGGT---TTCAACAGAGGACGAGGAGGCGGCGGCG
C3 CGGCGGCGGCGGCGGCGGCGGTTTTAACAGAGGACGAGGAGGCGGCGGCG
C4 CGGCGGCGGAGGCGGT------TTTAACAGAGGAAGAGGAGGCAGCGGTG
C5 AGGTGGCGGCGGCGGAGGCGGTTTTAACAGAGGAAGAGGAGGCGGCGGTG
.** *****.** ** *********.********.* ** *
C1 GCGGCGGCGGT------------GGTCGGGGTCGGTGG------------
C2 GTGGT---------------------CGGGGTCGGTGG------------
C3 GCGGCGGCGGCGGCGGCGGTGGTGGTCGGGGTCGGTGG------------
C4 GTGGTGGT---------------GGTCGGGGTCGGTGG------------
C5 GT---------------------GGTCGGGGTCGGTGG------------
* ************
C1 ---------
C2 ---------
C3 ---------
C4 ---------
C5 ---------
>C1
ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGAGGCTT
CGGTGGAGGCGGAGGCGGAGGAGGACGAGGATTTGGTGGAGGTGGAGGTG
GACGAGGAGGTGGCGGAGGACGCGGAGGTGGCGGCGGATTCGGTCGAGGT
GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACACTGGTCCACCAGA
GAGAGTCATCCCCTTGGGCAACTATGTTTACTCCTGCCAAAACGACCTTG
TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC
CTTGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGAACAGT
TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA
GCTTCAAGCCAAATCAGAAACTGTTTATCGACCCTGGAAAGCTGTTACCC
ATCGCCAGATTTCTGCCGAAACCTCCACAACCAAAAGGCGCCAAGAAAGC
CTTCACAAATAACCGAGGTGGAGGCGGCGGTGGCGGTGGATTTGGAGGCC
GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT
GGAGGCGGA------TTCCGAGGAGGTGCTGGTCGCAATGGAGGAGGTGG
CGGCGGCGGCGGT---------TTTAACAGAGGACGAGGAGGCGGTGGCG
GCGGCGGCGGT------------GGTCGGGGTCGGTGG------------
---------
>C2
ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGAGGCTT
CGGAGGAGGCGGCGGC------GGACGAGGATTTGGAGGAGGTGGCGGCG
GACGCGGTGGTGGCGGCGGACGCGGAGGTGGTGGCGGATTCGGCCGTGGA
GGCGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACTCTGGTCCACCGGA
GAGAGTCATCCCCTTGGGCGACTTCGTTTACTCCTGCCAAAACGACCTTG
TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC
CTTGAAAACAAGGAGCAAGTAGGCAAAATTGACGAGATCTTTGGAACAGT
TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA
GCTTCAAACCAAATCAGAAACTGTATATCGACCCTGGAAAACTGTTACCC
ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCCAAGAAAGC
CTTCACAAATAACCGAGGCGGAGGCGGCGGTGGCGGTGGATTTGGAGGCC
GAGGTGGTGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGC
GGAGGCGGA------TTCCGAGGAGGAGCTGGTCGA---GGAGGAGGTGG
CGGCGGCGGCGGCGGCGGT---TTCAACAGAGGACGAGGAGGCGGCGGCG
GTGGT---------------------CGGGGTCGGTGG------------
---------
>C3
ATGGGATTTGGTAAACCTCGTGGCGGCGGAGGCGGCGGCGGAAGAGGCTT
CGGAGGAGGCGGCGGC------GGACGAGGATTTGGAGGAGGTGGCGGTG
GACGCGGTGGTGGTGGCGGACGCGGAGGTGGCGGCGGATTCGGCCGTGGA
GGCGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACTCTGGTCCACCGGA
GAGAGTCATCCCATTGGGCGACTTCGTTTACTCCTGCCAAAACGACCTCG
TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC
CTTGAAAACAAGGAGCAAGTAGGCAAAATCGACGAGATCTTTGGAACAGT
TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA
GCTTCAAGCCAAATCAGAAACTGTATATCGACCCTGGAAAGCTGTTACCC
ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCCAAGAAAGC
CTTCACAAATAACCGAGGCGGAGGCGGCGGTGGCGGA---TTTGGAGGCC
GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGC
GGAGGCGGA------TTCCGAGGAGGAGCTGGTCGA---GGAGGAGGTGG
CGGCGGCGGCGGCGGCGGCGGTTTTAACAGAGGACGAGGAGGCGGCGGCG
GCGGCGGCGGCGGCGGCGGTGGTGGTCGGGGTCGGTGG------------
---------
>C4
ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGA---TT
CGGAGGAGGTGGCGGCGGCGGCGGACGTGGATTTGGAGGAGGTGGTGGTG
GACGCGGTGGTGGCGGCGGACGTGGAGGTGGCGGCGGATTCAACCGAGGA
GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGATTCTGGTCCACCGGA
GAGAGTAATCCCCTTGGGCAACTACGTTTACGCCTGCCAAAATGACCTTG
TGTGCAAAGTTGACATTCAGGATGTTCCGTATTTCAACGCGCCCATTTTC
CTCGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGTACAGT
TAGGGACTACAGCGTGTCCATTAAGCTGTCGGACAACGTCTACGCCAACA
GCTTCAAACCAGATCAGAAACTCTATATCGACCCTGGAAAGCTGTTACCG
ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCAAAGAAAGC
CTTCACAAATAACCGCGGCGGTGGCGGCGGTGGA------TTTGGAGGCC
GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT
GGAGGCGGAGGCGGTTTCCGAGGAGGAGCTGGTCGCAATGGAGGAGGTGG
CGGCGGCGGAGGCGGT------TTTAACAGAGGAAGAGGAGGCAGCGGTG
GTGGTGGT---------------GGTCGGGGTCGGTGG------------
---------
>C5
ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGTAGAGGATT
TGGAGGAGGCGGTGGC------GGACGAGGATTTGGAGGAGGTGGTGGTG
GACGCGGTGGCGGCGGCGGACGCGGAGGTGGCGGCGGATTCAACCGAGGA
GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGATACTGGACCACCGGA
GAGAGTAATCCCCTTGGGCAACTATGTATACTCCTGCCAAAATGACCTTG
TGTGCAAAGTTGATATTCAGGATGTTCCGTATTTCAACGCGCCCATTTTC
CTCGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGTACAGT
TCGGGACTACAGCGTGTCCATCAAGCTGTCGGAGAACGTCTACGCCAACA
GCTTCAAGCCAAATCAGAAACTTTTTATCGACCCTGGAAAGCTGTTACCG
ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCGAAGAAGGC
CTTCACAAATAACCGTGGTGGAGGCGGCGGTGGA------TTTGGAGGTC
GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT
GGAGGCGGT------TTCCGAGGAGGAGCTGGTCGCAATGGTGGAGGAGG
AGGTGGCGGCGGCGGAGGCGGTTTTAACAGAGGAAGAGGAGGCGGCGGTG
GT---------------------GGTCGGGGTCGGTGG------------
---------
>C1
MGFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLFIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
GGGooFRGGAGRNGGGGGGGGoooFNRGRGGGGGGGGooooGRGRW
>C2
MGFGKPRGGGGGGGRGFGGGGGooGRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
GGGooFRGGAGRoGGGGGGGGGGoFNRGRGGGGGGoooooooRGRW
>C3
MGFGKPRGGGGGGGRGFGGGGGooGRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGoFGGRGGGRGGGGRGGGGGRG
GGGooFRGGAGRoGGGGGGGGGGGFNRGRGGGGGGGGGGGGGRGRW
>C4
MGFGKPRGGGGGGGRoFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFNRG
GGGRGGGRGAFDSGPPERVIPLGNYVYACQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPDQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGooFGGRGGGRGGGGRGGGGGRG
GGGGGFRGGAGRNGGGGGGGGGooFNRGRGGSGGGGoooooGRGRW
>C5
MGFGKPRGGGGGGGRGFGGGGGooGRGFGGGGGGRGGGGGRGGGGGFNRG
GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSENVYANSFKPNQKLFIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGooFGGRGGGRGGGGRGGGGGRG
GGGooFRGGAGRNGGGGGGGGGGGFNRGRGGGGGoooooooGRGRW
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 759 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478101325
Setting output file names to "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1334575096
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1997545459
Seed = 108233389
Swapseed = 1478101325
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 27 unique site patterns
Division 2 has 22 unique site patterns
Division 3 has 62 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1874.550158 -- -25.624409
Chain 2 -- -1847.028388 -- -25.624409
Chain 3 -- -1883.701606 -- -25.624409
Chain 4 -- -1818.625875 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1839.630018 -- -25.624409
Chain 2 -- -1859.466733 -- -25.624409
Chain 3 -- -1884.738168 -- -25.624409
Chain 4 -- -1893.392025 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1874.550] (-1847.028) (-1883.702) (-1818.626) * [-1839.630] (-1859.467) (-1884.738) (-1893.392)
500 -- [-1571.860] (-1575.611) (-1564.902) (-1585.945) * (-1568.883) (-1589.780) [-1557.585] (-1579.284) -- 0:00:00
1000 -- (-1559.618) (-1562.177) (-1554.698) [-1549.579] * (-1560.854) (-1554.665) [-1546.453] (-1566.698) -- 0:00:00
1500 -- (-1562.353) (-1553.442) (-1546.958) [-1535.525] * [-1538.492] (-1540.062) (-1540.372) (-1558.371) -- 0:00:00
2000 -- (-1556.247) (-1549.317) (-1538.477) [-1533.102] * (-1524.510) [-1535.298] (-1536.285) (-1552.257) -- 0:00:00
2500 -- (-1535.335) (-1542.234) [-1523.162] (-1523.187) * (-1517.344) [-1517.231] (-1530.016) (-1532.167) -- 0:00:00
3000 -- (-1521.009) [-1510.955] (-1515.714) (-1517.114) * (-1503.662) [-1510.672] (-1515.364) (-1531.871) -- 0:00:00
3500 -- (-1513.238) [-1501.862] (-1515.776) (-1512.478) * (-1510.824) [-1500.477] (-1512.287) (-1516.920) -- 0:00:00
4000 -- (-1507.979) [-1506.742] (-1512.293) (-1511.370) * (-1503.934) [-1499.249] (-1503.328) (-1505.310) -- 0:00:00
4500 -- (-1508.538) (-1501.097) (-1506.777) [-1506.737] * (-1502.901) (-1499.210) (-1501.608) [-1501.279] -- 0:03:41
5000 -- (-1506.524) (-1500.243) (-1509.828) [-1502.353] * (-1504.536) [-1491.828] (-1499.243) (-1499.859) -- 0:03:19
Average standard deviation of split frequencies: 0.052378
5500 -- (-1504.003) [-1500.613] (-1499.732) (-1512.496) * [-1502.801] (-1498.451) (-1496.908) (-1497.439) -- 0:03:00
6000 -- (-1506.271) [-1494.648] (-1511.143) (-1501.034) * [-1496.049] (-1498.058) (-1507.451) (-1493.376) -- 0:02:45
6500 -- [-1497.292] (-1492.920) (-1499.287) (-1504.537) * (-1497.344) (-1498.096) (-1504.065) [-1491.649] -- 0:02:32
7000 -- (-1500.850) [-1489.556] (-1496.297) (-1498.000) * (-1498.448) (-1496.348) [-1496.209] (-1498.708) -- 0:02:21
7500 -- (-1500.067) [-1494.671] (-1497.969) (-1497.910) * (-1500.262) (-1496.487) (-1502.077) [-1492.860] -- 0:02:12
8000 -- (-1496.355) [-1490.580] (-1496.163) (-1492.465) * (-1497.537) [-1506.751] (-1494.707) (-1491.793) -- 0:02:04
8500 -- [-1494.764] (-1498.421) (-1501.433) (-1501.492) * (-1503.165) (-1499.133) [-1495.126] (-1495.140) -- 0:01:56
9000 -- (-1494.980) (-1491.354) (-1495.039) [-1496.786] * (-1495.869) (-1502.101) [-1497.926] (-1497.829) -- 0:01:50
9500 -- (-1496.462) [-1490.451] (-1499.175) (-1500.021) * (-1498.462) (-1496.160) [-1504.065] (-1504.458) -- 0:03:28
10000 -- (-1496.523) [-1498.296] (-1497.255) (-1495.053) * (-1503.236) (-1501.981) [-1500.386] (-1503.803) -- 0:03:18
Average standard deviation of split frequencies: 0.022097
10500 -- (-1492.917) (-1496.141) (-1491.434) [-1496.797] * (-1504.827) (-1503.318) [-1499.020] (-1493.575) -- 0:03:08
11000 -- (-1494.215) [-1497.000] (-1495.701) (-1503.564) * (-1494.302) (-1501.188) [-1494.360] (-1499.287) -- 0:02:59
11500 -- (-1503.575) (-1497.270) [-1493.001] (-1503.173) * (-1497.059) (-1492.245) [-1497.084] (-1494.423) -- 0:02:51
12000 -- (-1502.871) (-1502.897) [-1492.937] (-1496.089) * (-1499.772) (-1495.828) (-1491.432) [-1496.163] -- 0:02:44
12500 -- (-1498.825) [-1502.714] (-1493.946) (-1492.556) * (-1504.970) (-1494.985) (-1497.996) [-1496.468] -- 0:02:38
13000 -- (-1497.590) [-1491.328] (-1496.911) (-1494.228) * (-1500.581) (-1496.635) [-1497.312] (-1503.083) -- 0:02:31
13500 -- [-1496.963] (-1498.624) (-1500.652) (-1498.270) * (-1495.887) [-1499.851] (-1498.925) (-1506.909) -- 0:02:26
14000 -- (-1498.674) (-1501.478) (-1499.290) [-1498.547] * (-1498.294) [-1498.642] (-1495.213) (-1504.307) -- 0:03:31
14500 -- (-1494.608) [-1498.792] (-1497.772) (-1498.071) * (-1496.090) (-1499.029) [-1496.154] (-1492.843) -- 0:03:23
15000 -- (-1500.409) (-1494.359) (-1498.754) [-1503.311] * (-1494.191) (-1497.429) [-1496.344] (-1491.894) -- 0:03:17
Average standard deviation of split frequencies: 0.029463
15500 -- (-1505.244) (-1495.506) (-1499.812) [-1495.389] * (-1498.285) (-1496.081) [-1495.876] (-1496.423) -- 0:03:10
16000 -- [-1498.917] (-1493.708) (-1507.888) (-1496.840) * [-1495.594] (-1493.682) (-1492.784) (-1497.406) -- 0:03:04
16500 -- (-1494.748) (-1501.752) [-1503.822] (-1499.055) * (-1495.531) (-1496.508) [-1489.695] (-1495.354) -- 0:02:58
17000 -- (-1504.040) (-1496.366) [-1503.889] (-1497.400) * (-1499.230) (-1498.610) (-1499.201) [-1493.807] -- 0:02:53
17500 -- (-1498.647) (-1499.340) (-1510.933) [-1504.355] * (-1496.672) (-1500.376) (-1499.949) [-1499.309] -- 0:02:48
18000 -- (-1504.381) (-1498.606) (-1507.058) [-1494.253] * (-1489.097) [-1497.219] (-1495.691) (-1494.728) -- 0:02:43
18500 -- [-1492.741] (-1502.640) (-1496.137) (-1497.393) * (-1493.836) (-1495.854) (-1494.629) [-1499.703] -- 0:02:39
19000 -- [-1495.665] (-1497.320) (-1500.552) (-1491.749) * [-1494.457] (-1500.282) (-1494.434) (-1499.019) -- 0:03:26
19500 -- (-1504.814) [-1498.884] (-1499.475) (-1496.818) * (-1494.090) (-1512.134) (-1493.869) [-1494.753] -- 0:03:21
20000 -- [-1492.084] (-1497.986) (-1497.024) (-1495.940) * [-1492.457] (-1500.297) (-1495.631) (-1493.891) -- 0:03:16
Average standard deviation of split frequencies: 0.011405
20500 -- (-1497.094) (-1501.203) [-1502.658] (-1496.958) * (-1494.076) (-1492.950) (-1501.550) [-1496.358] -- 0:03:11
21000 -- [-1494.569] (-1503.583) (-1491.947) (-1490.546) * (-1495.988) (-1496.111) (-1495.572) [-1492.869] -- 0:03:06
21500 -- (-1498.320) (-1501.717) (-1497.665) [-1496.428] * (-1497.335) [-1496.778] (-1502.830) (-1499.988) -- 0:03:02
22000 -- [-1495.586] (-1495.696) (-1498.515) (-1497.832) * (-1494.543) (-1500.734) [-1498.443] (-1495.949) -- 0:02:57
22500 -- [-1498.338] (-1495.212) (-1494.298) (-1497.328) * (-1494.769) (-1498.852) [-1496.262] (-1501.848) -- 0:02:53
23000 -- (-1494.449) [-1502.029] (-1496.916) (-1496.728) * [-1493.454] (-1495.087) (-1496.483) (-1493.460) -- 0:02:49
23500 -- (-1496.818) [-1492.874] (-1499.444) (-1500.656) * (-1498.279) [-1495.416] (-1496.393) (-1492.858) -- 0:02:46
24000 -- (-1494.205) (-1497.270) [-1499.939] (-1495.004) * (-1502.999) (-1500.036) (-1501.622) [-1491.646] -- 0:03:23
24500 -- [-1496.846] (-1495.131) (-1493.343) (-1496.667) * (-1497.441) (-1505.129) [-1495.864] (-1497.706) -- 0:03:19
25000 -- (-1497.967) (-1490.131) (-1498.856) [-1496.438] * (-1490.849) [-1496.868] (-1496.397) (-1495.521) -- 0:03:15
Average standard deviation of split frequencies: 0.009065
25500 -- (-1506.939) (-1494.037) [-1495.524] (-1501.017) * [-1495.016] (-1500.510) (-1497.186) (-1494.505) -- 0:03:11
26000 -- [-1498.220] (-1494.047) (-1495.434) (-1500.445) * (-1501.896) (-1494.405) (-1500.365) [-1502.700] -- 0:03:07
26500 -- (-1497.357) (-1499.865) (-1498.987) [-1495.821] * (-1505.880) [-1494.237] (-1498.955) (-1499.511) -- 0:03:03
27000 -- (-1499.935) (-1496.712) (-1496.962) [-1496.316] * (-1501.415) [-1491.905] (-1494.054) (-1493.213) -- 0:03:00
27500 -- (-1498.176) [-1494.140] (-1496.621) (-1497.450) * (-1491.304) (-1492.102) [-1492.478] (-1495.724) -- 0:02:56
28000 -- (-1496.346) (-1496.528) (-1494.916) [-1493.845] * [-1493.168] (-1496.468) (-1498.770) (-1501.245) -- 0:02:53
28500 -- [-1501.485] (-1495.185) (-1497.523) (-1497.902) * (-1493.981) (-1499.274) [-1490.036] (-1501.327) -- 0:02:50
29000 -- (-1500.629) (-1493.078) [-1496.720] (-1494.336) * (-1502.353) [-1499.916] (-1494.068) (-1499.868) -- 0:03:20
29500 -- (-1500.472) [-1497.126] (-1491.681) (-1493.699) * (-1500.162) (-1497.090) [-1493.805] (-1492.746) -- 0:03:17
30000 -- (-1497.905) (-1503.401) [-1502.279] (-1504.324) * (-1497.367) (-1498.299) [-1491.018] (-1490.291) -- 0:03:14
Average standard deviation of split frequencies: 0.007686
30500 -- [-1500.488] (-1493.486) (-1499.328) (-1499.145) * (-1497.933) (-1499.619) [-1490.854] (-1497.070) -- 0:03:10
31000 -- (-1492.953) (-1499.688) (-1495.109) [-1493.014] * (-1494.407) (-1498.346) (-1496.184) [-1497.538] -- 0:03:07
31500 -- (-1496.781) (-1491.595) (-1500.841) [-1499.160] * (-1496.353) (-1494.590) (-1495.456) [-1492.389] -- 0:03:04
32000 -- (-1498.994) [-1494.129] (-1500.099) (-1495.585) * (-1500.430) [-1495.781] (-1497.061) (-1498.668) -- 0:03:01
32500 -- (-1489.770) (-1502.593) [-1498.024] (-1491.596) * [-1495.891] (-1491.531) (-1502.106) (-1496.049) -- 0:02:58
33000 -- [-1504.234] (-1498.474) (-1494.656) (-1494.571) * (-1496.354) (-1490.590) (-1505.412) [-1495.524] -- 0:02:55
33500 -- (-1500.378) (-1495.201) [-1492.944] (-1495.373) * [-1497.144] (-1497.427) (-1497.011) (-1495.471) -- 0:03:21
34000 -- (-1501.982) (-1497.403) (-1496.997) [-1496.208] * (-1498.088) (-1491.088) (-1491.585) [-1499.769] -- 0:03:18
34500 -- [-1494.141] (-1493.008) (-1497.072) (-1491.086) * [-1497.558] (-1499.397) (-1492.947) (-1497.061) -- 0:03:15
35000 -- (-1496.091) (-1494.767) [-1492.707] (-1494.262) * (-1505.242) (-1499.177) (-1493.345) [-1494.838] -- 0:03:13
Average standard deviation of split frequencies: 0.013095
35500 -- (-1497.518) [-1496.346] (-1504.234) (-1496.890) * (-1503.776) [-1493.064] (-1499.730) (-1493.495) -- 0:03:10
36000 -- [-1493.012] (-1494.975) (-1497.132) (-1496.935) * (-1506.233) (-1496.626) (-1496.553) [-1492.156] -- 0:03:07
36500 -- [-1495.748] (-1499.112) (-1492.888) (-1494.099) * (-1500.349) (-1494.770) (-1498.501) [-1493.129] -- 0:03:04
37000 -- (-1502.017) [-1493.695] (-1496.788) (-1502.482) * (-1503.765) (-1495.568) [-1498.649] (-1494.286) -- 0:03:02
37500 -- (-1498.841) (-1488.265) [-1497.589] (-1494.201) * [-1501.443] (-1501.232) (-1502.110) (-1493.425) -- 0:02:59
38000 -- (-1498.685) [-1495.995] (-1502.273) (-1498.691) * [-1499.894] (-1496.952) (-1495.940) (-1494.665) -- 0:02:57
38500 -- (-1497.029) (-1491.071) (-1496.129) [-1496.560] * (-1508.657) (-1502.557) [-1495.187] (-1498.862) -- 0:03:19
39000 -- (-1492.061) [-1489.396] (-1495.811) (-1495.393) * (-1502.521) (-1499.353) (-1491.407) [-1498.301] -- 0:03:17
39500 -- (-1494.647) [-1494.548] (-1507.364) (-1501.589) * (-1503.116) (-1497.605) (-1500.297) [-1496.513] -- 0:03:14
40000 -- (-1495.886) [-1494.573] (-1493.584) (-1499.891) * (-1502.051) (-1506.751) (-1496.752) [-1493.979] -- 0:03:12
Average standard deviation of split frequencies: 0.011592
40500 -- (-1500.165) (-1494.661) (-1494.047) [-1497.441] * (-1497.366) (-1500.791) (-1493.818) [-1502.839] -- 0:03:09
41000 -- [-1495.878] (-1497.732) (-1494.630) (-1498.237) * (-1491.645) (-1494.775) (-1493.038) [-1499.973] -- 0:03:07
41500 -- (-1493.575) [-1491.722] (-1492.133) (-1497.591) * [-1491.689] (-1499.778) (-1497.516) (-1495.310) -- 0:03:04
42000 -- [-1497.107] (-1500.717) (-1494.018) (-1499.048) * (-1493.215) (-1501.970) (-1499.561) [-1496.517] -- 0:03:02
42500 -- [-1496.620] (-1497.872) (-1497.035) (-1502.126) * (-1497.032) (-1498.548) (-1497.990) [-1492.642] -- 0:03:00
43000 -- (-1494.311) [-1494.103] (-1493.552) (-1503.744) * [-1495.713] (-1494.391) (-1509.444) (-1501.285) -- 0:03:20
43500 -- (-1492.329) (-1499.813) [-1496.587] (-1503.553) * (-1503.388) (-1495.680) [-1497.043] (-1496.905) -- 0:03:17
44000 -- (-1498.659) (-1498.391) (-1493.447) [-1495.386] * (-1498.472) (-1493.570) (-1506.261) [-1496.277] -- 0:03:15
44500 -- (-1494.803) (-1498.030) [-1494.622] (-1498.468) * (-1496.564) [-1493.282] (-1499.197) (-1499.105) -- 0:03:13
45000 -- (-1499.098) [-1493.781] (-1506.417) (-1496.542) * (-1493.522) (-1491.583) [-1496.572] (-1498.888) -- 0:03:11
Average standard deviation of split frequencies: 0.010248
45500 -- (-1498.954) (-1500.785) (-1490.772) [-1496.594] * [-1493.782] (-1492.817) (-1502.713) (-1493.320) -- 0:03:08
46000 -- (-1499.220) (-1493.795) [-1494.242] (-1495.156) * (-1499.747) (-1494.640) (-1494.182) [-1499.397] -- 0:03:06
46500 -- (-1498.167) (-1503.456) [-1496.326] (-1493.042) * [-1505.570] (-1495.545) (-1498.298) (-1499.172) -- 0:03:04
47000 -- [-1494.864] (-1497.783) (-1493.896) (-1493.454) * (-1502.864) (-1502.697) (-1494.743) [-1496.742] -- 0:03:02
47500 -- (-1494.899) (-1501.858) [-1491.230] (-1500.846) * (-1491.479) [-1496.536] (-1497.159) (-1500.771) -- 0:03:00
48000 -- (-1501.695) (-1496.380) (-1496.051) [-1495.108] * (-1490.823) (-1499.411) [-1497.818] (-1496.569) -- 0:03:18
48500 -- (-1496.687) (-1498.994) (-1494.425) [-1499.077] * (-1489.965) (-1501.298) [-1499.457] (-1494.736) -- 0:03:16
49000 -- [-1494.581] (-1497.265) (-1494.309) (-1493.823) * [-1496.509] (-1498.216) (-1501.971) (-1497.657) -- 0:03:14
49500 -- (-1496.696) (-1496.334) [-1495.971] (-1499.995) * [-1497.535] (-1490.472) (-1494.332) (-1499.945) -- 0:03:12
50000 -- (-1492.966) (-1495.621) [-1500.408] (-1501.517) * (-1493.056) (-1500.910) (-1496.702) [-1493.428] -- 0:03:10
Average standard deviation of split frequencies: 0.009304
50500 -- (-1498.251) [-1493.320] (-1498.489) (-1501.108) * (-1493.750) (-1497.484) [-1498.964] (-1495.784) -- 0:03:08
51000 -- (-1494.315) (-1495.916) [-1497.424] (-1505.301) * (-1494.186) [-1494.329] (-1499.661) (-1498.012) -- 0:03:06
51500 -- (-1497.810) [-1496.326] (-1497.368) (-1498.767) * [-1500.274] (-1496.079) (-1495.533) (-1497.508) -- 0:03:04
52000 -- (-1498.737) (-1496.287) [-1496.536] (-1497.868) * (-1504.039) (-1500.291) (-1492.846) [-1494.864] -- 0:03:02
52500 -- (-1496.323) (-1495.861) (-1497.013) [-1495.956] * [-1499.145] (-1493.826) (-1498.223) (-1494.312) -- 0:03:00
53000 -- (-1499.051) [-1493.764] (-1509.062) (-1494.062) * (-1494.423) [-1491.117] (-1494.318) (-1502.085) -- 0:03:16
53500 -- [-1498.800] (-1493.276) (-1506.201) (-1501.103) * [-1500.949] (-1500.244) (-1500.151) (-1498.370) -- 0:03:14
54000 -- (-1498.757) [-1490.596] (-1501.516) (-1491.542) * (-1496.382) [-1495.858] (-1498.349) (-1495.545) -- 0:03:12
54500 -- (-1493.073) (-1502.063) (-1499.060) [-1496.045] * (-1499.344) (-1491.505) [-1490.617] (-1492.158) -- 0:03:10
55000 -- (-1499.330) (-1496.794) (-1495.078) [-1492.513] * (-1493.166) (-1499.532) (-1495.454) [-1495.647] -- 0:03:09
Average standard deviation of split frequencies: 0.008418
55500 -- (-1495.760) [-1495.822] (-1496.030) (-1490.841) * (-1492.711) [-1493.147] (-1496.945) (-1496.078) -- 0:03:07
56000 -- (-1503.280) (-1499.811) (-1494.639) [-1491.502] * [-1498.770] (-1494.685) (-1493.941) (-1496.451) -- 0:03:05
56500 -- (-1502.718) (-1496.274) [-1495.568] (-1494.514) * (-1499.598) (-1493.867) (-1489.427) [-1499.251] -- 0:03:03
57000 -- (-1496.453) (-1495.505) (-1498.689) [-1492.330] * (-1503.537) (-1496.885) [-1492.490] (-1501.271) -- 0:03:01
57500 -- (-1498.625) (-1500.307) (-1499.166) [-1494.944] * (-1494.864) [-1493.032] (-1495.238) (-1505.187) -- 0:03:00
58000 -- (-1495.548) (-1498.853) [-1492.041] (-1496.621) * [-1498.015] (-1490.193) (-1495.790) (-1504.953) -- 0:03:14
58500 -- (-1504.003) (-1493.832) [-1498.084] (-1490.119) * [-1499.641] (-1496.165) (-1499.306) (-1496.539) -- 0:03:13
59000 -- (-1496.607) (-1500.206) [-1502.631] (-1497.557) * [-1494.373] (-1497.946) (-1495.483) (-1501.909) -- 0:03:11
59500 -- (-1499.020) (-1498.566) [-1493.004] (-1499.173) * (-1498.729) (-1499.292) [-1497.187] (-1498.573) -- 0:03:09
60000 -- (-1508.880) [-1495.265] (-1496.379) (-1506.383) * (-1497.589) (-1492.871) (-1496.660) [-1499.306] -- 0:03:08
Average standard deviation of split frequencies: 0.007770
60500 -- (-1507.413) (-1492.402) (-1490.926) [-1499.237] * (-1501.431) [-1494.727] (-1497.697) (-1506.803) -- 0:03:06
61000 -- (-1501.602) [-1495.308] (-1494.533) (-1494.928) * (-1496.743) [-1497.666] (-1498.587) (-1501.830) -- 0:03:04
61500 -- (-1497.333) [-1492.914] (-1498.119) (-1506.152) * [-1498.324] (-1502.392) (-1496.212) (-1504.162) -- 0:03:03
62000 -- [-1498.904] (-1494.421) (-1499.535) (-1494.118) * (-1500.422) (-1505.063) [-1495.740] (-1501.980) -- 0:03:01
62500 -- (-1495.887) [-1495.321] (-1494.329) (-1496.979) * (-1500.925) (-1500.887) (-1490.757) [-1492.255] -- 0:03:15
63000 -- (-1509.264) [-1491.948] (-1500.840) (-1496.397) * (-1493.407) (-1509.687) [-1490.842] (-1496.618) -- 0:03:13
63500 -- (-1496.546) [-1494.697] (-1492.926) (-1503.898) * (-1502.843) (-1500.196) [-1499.693] (-1498.355) -- 0:03:11
64000 -- (-1497.749) (-1496.390) (-1499.386) [-1493.885] * (-1492.745) (-1496.494) (-1497.378) [-1495.931] -- 0:03:10
64500 -- (-1493.693) (-1494.777) [-1495.375] (-1498.269) * (-1497.679) (-1494.571) (-1499.877) [-1495.458] -- 0:03:08
65000 -- (-1495.958) (-1499.119) [-1494.057] (-1499.954) * (-1497.515) (-1501.564) (-1507.560) [-1492.655] -- 0:03:07
Average standard deviation of split frequencies: 0.007142
65500 -- (-1495.279) (-1499.737) (-1498.546) [-1495.983] * [-1493.274] (-1501.911) (-1496.598) (-1491.993) -- 0:03:05
66000 -- [-1493.159] (-1499.931) (-1497.303) (-1494.691) * (-1496.885) [-1491.484] (-1495.930) (-1495.894) -- 0:03:03
66500 -- (-1497.616) (-1501.799) (-1502.906) [-1496.529] * (-1496.173) [-1492.046] (-1494.095) (-1495.741) -- 0:03:02
67000 -- [-1504.331] (-1495.749) (-1498.519) (-1493.016) * (-1498.575) [-1499.828] (-1496.608) (-1498.522) -- 0:03:01
67500 -- (-1495.686) (-1495.338) [-1504.284] (-1495.535) * (-1497.343) [-1496.682] (-1509.588) (-1502.769) -- 0:03:13
68000 -- (-1504.022) (-1497.831) (-1507.505) [-1494.901] * (-1497.525) (-1494.984) (-1496.783) [-1496.443] -- 0:03:11
68500 -- (-1495.023) (-1500.826) [-1500.535] (-1498.607) * (-1505.104) (-1495.601) [-1491.472] (-1498.378) -- 0:03:10
69000 -- [-1503.985] (-1502.707) (-1500.538) (-1500.103) * (-1504.854) (-1503.362) [-1495.541] (-1497.615) -- 0:03:08
69500 -- (-1494.404) (-1496.378) (-1508.645) [-1491.214] * (-1503.885) (-1499.290) [-1496.969] (-1501.994) -- 0:03:07
70000 -- [-1494.569] (-1496.988) (-1512.243) (-1495.819) * (-1505.823) (-1499.200) [-1490.645] (-1503.771) -- 0:03:06
Average standard deviation of split frequencies: 0.010006
70500 -- [-1494.738] (-1498.379) (-1500.435) (-1493.165) * (-1495.700) (-1500.779) (-1496.210) [-1494.654] -- 0:03:04
71000 -- (-1492.724) [-1496.221] (-1495.429) (-1497.521) * (-1491.562) (-1501.985) [-1498.627] (-1491.343) -- 0:03:03
71500 -- [-1503.018] (-1502.822) (-1496.901) (-1490.977) * (-1496.324) (-1504.346) (-1502.483) [-1493.158] -- 0:03:01
72000 -- [-1494.774] (-1500.501) (-1497.054) (-1500.694) * [-1493.016] (-1500.976) (-1505.560) (-1496.829) -- 0:03:00
72500 -- [-1495.056] (-1499.301) (-1500.104) (-1493.321) * [-1491.098] (-1496.501) (-1501.368) (-1498.945) -- 0:03:11
73000 -- [-1497.259] (-1497.700) (-1502.070) (-1493.068) * (-1493.994) [-1495.728] (-1502.062) (-1490.955) -- 0:03:10
73500 -- (-1511.390) [-1499.770] (-1498.504) (-1496.717) * [-1495.656] (-1492.469) (-1500.114) (-1492.508) -- 0:03:09
74000 -- [-1497.293] (-1502.279) (-1498.395) (-1498.058) * (-1490.455) [-1496.353] (-1496.537) (-1493.401) -- 0:03:07
74500 -- (-1502.077) [-1496.749] (-1500.688) (-1495.486) * (-1501.729) (-1497.539) (-1496.896) [-1497.303] -- 0:03:06
75000 -- (-1500.940) (-1505.016) (-1500.317) [-1494.680] * (-1498.511) [-1494.027] (-1497.297) (-1490.238) -- 0:03:05
Average standard deviation of split frequencies: 0.009304
75500 -- (-1496.904) (-1505.394) [-1497.026] (-1501.761) * (-1506.578) [-1492.140] (-1498.855) (-1500.490) -- 0:03:03
76000 -- [-1493.502] (-1497.087) (-1498.544) (-1498.186) * [-1498.778] (-1495.162) (-1495.805) (-1501.371) -- 0:03:02
76500 -- [-1496.775] (-1495.105) (-1495.568) (-1498.836) * [-1491.037] (-1500.717) (-1500.444) (-1492.634) -- 0:03:01
77000 -- [-1493.325] (-1499.021) (-1494.911) (-1502.555) * [-1495.255] (-1502.263) (-1497.999) (-1494.740) -- 0:03:11
77500 -- [-1493.925] (-1510.503) (-1494.752) (-1502.727) * (-1491.202) [-1493.107] (-1494.785) (-1500.780) -- 0:03:10
78000 -- (-1492.414) [-1500.460] (-1493.670) (-1496.153) * (-1489.759) [-1492.428] (-1494.136) (-1497.161) -- 0:03:09
78500 -- (-1496.784) (-1494.046) [-1492.509] (-1497.220) * (-1496.183) (-1491.200) (-1502.608) [-1494.389] -- 0:03:07
79000 -- (-1502.989) (-1500.011) (-1497.801) [-1495.183] * [-1493.841] (-1495.298) (-1498.236) (-1495.918) -- 0:03:06
79500 -- [-1495.314] (-1495.614) (-1499.691) (-1494.157) * (-1495.421) (-1496.212) [-1500.262] (-1497.154) -- 0:03:05
80000 -- (-1496.129) [-1489.436] (-1499.760) (-1501.000) * (-1497.168) (-1494.575) [-1496.295] (-1496.316) -- 0:03:04
Average standard deviation of split frequencies: 0.008766
80500 -- (-1496.006) (-1494.896) (-1492.738) [-1492.509] * (-1496.985) (-1493.710) [-1497.486] (-1501.266) -- 0:03:02
81000 -- (-1504.726) (-1497.369) (-1498.562) [-1494.139] * (-1504.808) (-1494.748) (-1492.988) [-1492.152] -- 0:03:01
81500 -- [-1494.967] (-1501.311) (-1493.621) (-1496.961) * (-1498.863) [-1493.510] (-1502.465) (-1498.243) -- 0:03:00
82000 -- (-1492.835) (-1495.507) (-1495.994) [-1496.862] * (-1501.079) (-1493.205) (-1493.535) [-1492.571] -- 0:03:10
82500 -- [-1494.112] (-1498.497) (-1501.096) (-1493.926) * (-1499.876) [-1501.932] (-1492.657) (-1493.671) -- 0:03:09
83000 -- (-1500.259) (-1500.704) (-1504.235) [-1494.991] * (-1495.685) (-1498.128) [-1494.818] (-1496.767) -- 0:03:07
83500 -- (-1492.123) [-1502.665] (-1504.513) (-1494.721) * [-1499.108] (-1500.005) (-1499.963) (-1493.683) -- 0:03:06
84000 -- (-1503.871) (-1493.886) [-1495.284] (-1497.334) * (-1503.143) [-1497.748] (-1496.377) (-1494.892) -- 0:03:05
84500 -- (-1496.474) (-1492.045) (-1496.222) [-1492.564] * (-1507.387) (-1503.153) (-1503.104) [-1495.865] -- 0:03:04
85000 -- (-1501.371) [-1490.884] (-1499.153) (-1501.540) * (-1496.942) (-1497.228) [-1492.376] (-1495.569) -- 0:03:03
Average standard deviation of split frequencies: 0.008222
85500 -- (-1497.020) (-1498.068) [-1497.435] (-1494.380) * [-1496.457] (-1499.189) (-1497.109) (-1494.080) -- 0:03:01
86000 -- (-1492.355) [-1502.792] (-1501.978) (-1499.169) * [-1497.000] (-1501.765) (-1498.055) (-1504.528) -- 0:03:00
86500 -- [-1489.587] (-1499.819) (-1501.245) (-1498.825) * (-1495.953) (-1495.657) (-1504.840) [-1496.745] -- 0:03:10
87000 -- [-1498.042] (-1495.820) (-1498.416) (-1494.830) * (-1496.093) (-1500.492) (-1502.446) [-1501.131] -- 0:03:08
87500 -- (-1497.409) [-1494.714] (-1498.935) (-1500.534) * [-1495.344] (-1498.479) (-1500.064) (-1499.444) -- 0:03:07
88000 -- [-1490.660] (-1500.645) (-1497.848) (-1497.034) * [-1501.991] (-1495.982) (-1495.321) (-1507.099) -- 0:03:06
88500 -- (-1494.541) [-1495.652] (-1504.671) (-1503.041) * (-1505.545) (-1495.739) [-1497.917] (-1495.462) -- 0:03:05
89000 -- (-1492.880) (-1494.795) [-1495.170] (-1498.960) * (-1494.608) (-1498.177) (-1495.094) [-1492.977] -- 0:03:04
89500 -- (-1500.591) (-1497.470) (-1502.375) [-1494.390] * [-1493.688] (-1501.461) (-1493.857) (-1495.754) -- 0:03:03
90000 -- [-1492.643] (-1491.372) (-1509.056) (-1498.465) * (-1490.366) (-1501.171) [-1497.784] (-1496.145) -- 0:03:02
Average standard deviation of split frequencies: 0.007799
90500 -- (-1501.266) (-1493.886) (-1503.249) [-1494.011] * (-1496.252) (-1500.071) (-1504.712) [-1499.734] -- 0:03:00
91000 -- (-1494.652) (-1496.357) [-1498.386] (-1497.022) * (-1498.063) (-1502.125) [-1495.177] (-1498.814) -- 0:02:59
91500 -- (-1503.619) (-1500.483) [-1497.825] (-1499.304) * (-1501.139) [-1493.478] (-1494.522) (-1501.974) -- 0:03:08
92000 -- [-1496.000] (-1497.870) (-1503.915) (-1498.642) * [-1497.829] (-1498.215) (-1496.311) (-1495.814) -- 0:03:07
92500 -- (-1499.270) (-1498.758) (-1501.911) [-1496.538] * (-1494.306) [-1494.872] (-1492.331) (-1498.796) -- 0:03:06
93000 -- (-1501.383) [-1498.039] (-1498.192) (-1506.635) * (-1493.575) (-1495.981) [-1491.886] (-1501.817) -- 0:03:05
93500 -- (-1494.916) (-1495.165) [-1496.336] (-1498.987) * (-1496.249) [-1498.129] (-1495.454) (-1502.870) -- 0:03:04
94000 -- (-1496.663) (-1498.698) [-1495.302] (-1498.484) * (-1501.231) (-1496.379) [-1492.439] (-1502.710) -- 0:03:03
94500 -- (-1496.424) (-1493.160) (-1495.355) [-1494.182] * (-1496.478) [-1493.151] (-1492.715) (-1499.570) -- 0:03:02
95000 -- (-1494.061) (-1501.132) (-1502.826) [-1496.927] * [-1497.503] (-1506.148) (-1497.468) (-1504.650) -- 0:03:01
Average standard deviation of split frequencies: 0.007366
95500 -- (-1498.506) (-1499.902) (-1500.870) [-1491.345] * (-1495.862) (-1505.260) [-1495.678] (-1502.074) -- 0:02:59
96000 -- (-1496.539) (-1497.916) (-1497.872) [-1492.369] * (-1500.986) (-1502.779) [-1493.126] (-1494.258) -- 0:02:58
96500 -- (-1495.202) (-1493.681) (-1501.413) [-1493.382] * (-1499.504) (-1502.989) (-1499.934) [-1495.784] -- 0:03:07
97000 -- (-1496.342) [-1498.239] (-1494.502) (-1498.882) * (-1496.889) (-1501.353) (-1492.631) [-1494.371] -- 0:03:06
97500 -- [-1495.538] (-1490.548) (-1495.822) (-1490.760) * (-1498.044) (-1509.020) (-1499.952) [-1502.750] -- 0:03:05
98000 -- (-1497.419) [-1494.490] (-1495.959) (-1493.287) * (-1497.526) (-1508.730) (-1494.721) [-1494.864] -- 0:03:04
98500 -- (-1499.091) (-1490.476) [-1490.350] (-1498.744) * [-1496.914] (-1498.083) (-1491.524) (-1499.362) -- 0:03:03
99000 -- [-1496.548] (-1491.140) (-1491.341) (-1496.332) * (-1502.168) (-1496.331) (-1491.688) [-1493.676] -- 0:03:02
99500 -- [-1501.803] (-1492.672) (-1492.668) (-1495.141) * [-1492.282] (-1499.714) (-1496.415) (-1493.646) -- 0:03:01
100000 -- [-1494.049] (-1492.719) (-1496.315) (-1494.391) * (-1499.584) [-1498.691] (-1498.977) (-1495.941) -- 0:03:00
Average standard deviation of split frequencies: 0.007024
100500 -- (-1496.812) (-1498.025) [-1498.202] (-1502.917) * (-1495.986) (-1493.979) (-1499.666) [-1498.160] -- 0:02:59
101000 -- (-1501.636) (-1494.887) [-1496.529] (-1498.535) * [-1497.235] (-1510.437) (-1499.437) (-1497.667) -- 0:03:06
101500 -- [-1494.256] (-1502.075) (-1513.289) (-1507.754) * (-1493.118) (-1503.110) [-1495.959] (-1494.232) -- 0:03:05
102000 -- [-1492.130] (-1508.430) (-1496.565) (-1496.078) * (-1493.244) (-1511.936) [-1492.010] (-1497.120) -- 0:03:04
102500 -- [-1490.155] (-1497.317) (-1493.953) (-1504.568) * (-1495.773) [-1504.686] (-1495.630) (-1499.706) -- 0:03:03
103000 -- (-1493.103) (-1498.129) (-1498.671) [-1497.990] * (-1495.500) (-1495.021) [-1494.100] (-1500.816) -- 0:03:02
103500 -- (-1494.205) [-1494.783] (-1496.942) (-1490.998) * (-1495.929) (-1498.903) [-1500.522] (-1504.515) -- 0:03:01
104000 -- (-1501.856) (-1491.848) (-1495.853) [-1500.155] * [-1494.113] (-1505.829) (-1498.399) (-1498.985) -- 0:03:00
104500 -- (-1495.761) [-1491.886] (-1499.120) (-1500.489) * (-1497.015) (-1496.039) [-1492.363] (-1495.538) -- 0:02:59
105000 -- (-1497.726) [-1496.611] (-1501.399) (-1502.935) * (-1497.172) (-1495.819) [-1493.144] (-1499.606) -- 0:02:59
Average standard deviation of split frequencies: 0.008894
105500 -- (-1497.154) [-1499.204] (-1499.002) (-1506.011) * (-1497.838) (-1510.717) [-1495.844] (-1496.489) -- 0:02:58
106000 -- [-1494.991] (-1505.531) (-1496.820) (-1505.642) * (-1497.762) (-1498.061) (-1498.439) [-1495.858] -- 0:03:05
106500 -- [-1496.857] (-1496.506) (-1501.147) (-1500.521) * (-1494.782) (-1498.061) (-1496.973) [-1495.615] -- 0:03:04
107000 -- (-1502.939) (-1497.489) (-1497.562) [-1498.684] * (-1503.843) (-1497.534) (-1500.123) [-1501.757] -- 0:03:03
107500 -- [-1501.363] (-1504.842) (-1505.584) (-1497.193) * [-1494.488] (-1493.370) (-1490.608) (-1503.839) -- 0:03:02
108000 -- (-1491.595) (-1500.647) (-1498.311) [-1494.509] * [-1497.030] (-1493.800) (-1493.591) (-1496.779) -- 0:03:01
108500 -- [-1494.216] (-1499.282) (-1504.791) (-1492.818) * (-1497.914) [-1498.753] (-1491.626) (-1498.312) -- 0:03:00
109000 -- [-1497.150] (-1500.527) (-1497.789) (-1494.545) * (-1492.789) (-1498.543) [-1497.122] (-1493.317) -- 0:02:59
109500 -- (-1498.201) (-1501.276) [-1495.463] (-1490.858) * (-1501.080) (-1499.835) [-1495.100] (-1494.694) -- 0:02:58
110000 -- (-1503.686) (-1500.125) (-1499.484) [-1493.284] * (-1500.842) (-1503.449) (-1496.674) [-1492.322] -- 0:02:58
Average standard deviation of split frequencies: 0.012779
110500 -- (-1507.548) (-1493.958) (-1501.700) [-1496.604] * (-1497.433) (-1492.995) (-1499.116) [-1492.728] -- 0:02:57
111000 -- (-1506.030) [-1495.112] (-1498.790) (-1493.629) * [-1495.697] (-1492.906) (-1501.645) (-1495.512) -- 0:03:04
111500 -- [-1497.917] (-1497.119) (-1501.647) (-1493.662) * (-1500.265) (-1500.034) (-1491.583) [-1490.272] -- 0:03:03
112000 -- (-1498.413) (-1496.350) (-1497.894) [-1493.907] * (-1496.288) (-1492.028) [-1495.455] (-1499.558) -- 0:03:02
112500 -- (-1496.260) (-1494.590) [-1496.903] (-1497.357) * [-1492.675] (-1502.932) (-1490.698) (-1500.670) -- 0:03:01
113000 -- (-1501.856) (-1495.898) (-1496.016) [-1491.701] * (-1497.028) (-1495.590) (-1497.692) [-1497.971] -- 0:03:00
113500 -- (-1496.086) (-1494.808) (-1494.887) [-1492.920] * (-1498.370) (-1493.226) [-1491.944] (-1502.104) -- 0:02:59
114000 -- (-1492.530) (-1493.186) (-1492.448) [-1497.477] * (-1494.923) (-1491.079) [-1492.060] (-1503.802) -- 0:02:58
114500 -- [-1495.562] (-1497.350) (-1493.149) (-1503.109) * (-1500.415) (-1495.324) (-1494.514) [-1494.969] -- 0:02:57
115000 -- (-1504.206) [-1491.606] (-1492.170) (-1503.061) * (-1506.177) (-1496.762) [-1490.833] (-1493.638) -- 0:02:57
Average standard deviation of split frequencies: 0.012191
115500 -- (-1501.010) (-1496.727) [-1496.262] (-1511.198) * (-1501.323) (-1498.358) [-1495.140] (-1496.793) -- 0:03:03
116000 -- (-1500.162) (-1497.347) [-1492.897] (-1501.113) * (-1501.418) [-1491.325] (-1491.715) (-1497.199) -- 0:03:02
116500 -- (-1495.146) (-1496.016) [-1496.943] (-1505.208) * (-1500.448) (-1498.390) [-1496.147] (-1493.010) -- 0:03:02
117000 -- [-1501.337] (-1493.002) (-1506.964) (-1499.426) * (-1496.987) [-1489.352] (-1492.413) (-1494.704) -- 0:03:01
117500 -- (-1497.908) (-1496.675) [-1500.664] (-1495.459) * (-1492.579) (-1492.565) [-1501.828] (-1493.869) -- 0:03:00
118000 -- [-1499.985] (-1506.060) (-1502.028) (-1492.653) * (-1499.986) [-1496.231] (-1493.855) (-1493.212) -- 0:02:59
118500 -- (-1495.183) (-1496.138) [-1497.613] (-1500.639) * [-1499.583] (-1493.402) (-1494.765) (-1498.020) -- 0:02:58
119000 -- (-1497.445) (-1498.069) [-1496.566] (-1497.308) * [-1494.188] (-1502.033) (-1491.000) (-1494.480) -- 0:02:57
119500 -- (-1494.994) [-1491.609] (-1492.525) (-1497.148) * [-1493.534] (-1496.351) (-1493.395) (-1502.574) -- 0:02:56
120000 -- (-1499.867) (-1497.452) (-1496.256) [-1495.789] * [-1500.197] (-1493.555) (-1494.634) (-1499.254) -- 0:02:56
Average standard deviation of split frequencies: 0.011720
120500 -- (-1506.981) [-1492.446] (-1502.111) (-1495.054) * (-1491.992) [-1491.731] (-1497.219) (-1498.316) -- 0:03:02
121000 -- (-1497.644) (-1497.651) (-1496.254) [-1495.311] * [-1495.298] (-1493.759) (-1502.189) (-1495.301) -- 0:03:01
121500 -- (-1496.648) [-1496.046] (-1497.635) (-1498.702) * (-1494.995) (-1492.811) (-1490.628) [-1494.801] -- 0:03:00
122000 -- [-1494.518] (-1495.173) (-1497.963) (-1500.055) * (-1495.187) (-1492.971) (-1510.467) [-1497.542] -- 0:02:59
122500 -- (-1490.673) [-1492.632] (-1499.126) (-1502.698) * (-1506.510) (-1496.359) [-1497.149] (-1499.332) -- 0:02:59
123000 -- (-1493.459) [-1498.428] (-1496.926) (-1495.646) * [-1503.415] (-1496.824) (-1502.411) (-1504.654) -- 0:02:58
123500 -- (-1495.825) (-1503.226) (-1500.758) [-1498.684] * (-1496.220) [-1492.464] (-1497.362) (-1500.305) -- 0:02:57
124000 -- (-1502.941) (-1503.530) (-1499.498) [-1493.999] * [-1497.291] (-1494.347) (-1499.483) (-1501.654) -- 0:02:56
124500 -- (-1491.359) (-1497.693) (-1494.198) [-1505.567] * (-1497.071) (-1496.461) (-1503.116) [-1493.997] -- 0:02:55
125000 -- (-1498.078) (-1493.322) [-1493.253] (-1509.895) * [-1494.099] (-1493.893) (-1501.331) (-1495.725) -- 0:02:55
Average standard deviation of split frequencies: 0.011224
125500 -- (-1505.102) [-1497.698] (-1494.656) (-1502.488) * (-1490.475) (-1498.147) (-1493.189) [-1494.206] -- 0:03:01
126000 -- (-1495.011) (-1497.213) [-1489.327] (-1492.661) * (-1490.542) (-1500.907) (-1499.878) [-1499.975] -- 0:03:00
126500 -- (-1506.065) (-1492.505) [-1492.516] (-1494.357) * (-1495.565) (-1501.500) [-1494.288] (-1495.637) -- 0:02:59
127000 -- [-1496.753] (-1492.774) (-1502.057) (-1494.989) * (-1501.734) (-1496.805) (-1499.003) [-1494.721] -- 0:02:58
127500 -- (-1493.201) (-1497.165) (-1503.670) [-1491.282] * (-1498.456) [-1493.914] (-1499.802) (-1499.465) -- 0:02:57
128000 -- (-1498.722) (-1500.413) [-1498.518] (-1495.991) * (-1498.314) (-1494.324) [-1496.629] (-1495.296) -- 0:02:57
128500 -- [-1496.358] (-1499.483) (-1498.343) (-1492.431) * [-1495.091] (-1498.387) (-1498.006) (-1498.473) -- 0:02:56
129000 -- (-1498.057) (-1500.818) [-1492.925] (-1492.773) * (-1502.475) [-1496.797] (-1495.787) (-1497.861) -- 0:02:55
129500 -- [-1495.261] (-1498.689) (-1492.628) (-1499.382) * (-1501.499) (-1495.080) (-1496.267) [-1503.848] -- 0:02:54
130000 -- [-1490.793] (-1502.138) (-1494.708) (-1501.544) * [-1499.348] (-1501.725) (-1491.700) (-1495.861) -- 0:02:54
Average standard deviation of split frequencies: 0.010823
130500 -- [-1493.368] (-1494.059) (-1492.064) (-1498.187) * (-1502.000) (-1494.653) [-1493.921] (-1494.298) -- 0:02:59
131000 -- (-1493.627) (-1497.717) [-1489.905] (-1493.252) * [-1496.367] (-1496.811) (-1501.478) (-1502.485) -- 0:02:59
131500 -- [-1497.265] (-1496.436) (-1496.218) (-1497.917) * [-1491.783] (-1496.927) (-1492.752) (-1502.045) -- 0:02:58
132000 -- [-1493.485] (-1505.749) (-1494.929) (-1497.109) * (-1495.619) (-1494.830) [-1496.366] (-1496.385) -- 0:02:57
132500 -- [-1491.872] (-1502.174) (-1493.588) (-1495.287) * (-1496.172) (-1494.445) [-1499.006] (-1495.958) -- 0:02:56
133000 -- (-1495.095) (-1498.840) [-1491.317] (-1495.476) * (-1498.691) [-1495.355] (-1495.988) (-1492.464) -- 0:02:56
133500 -- (-1498.286) [-1496.502] (-1508.362) (-1492.573) * (-1499.456) (-1499.781) (-1500.129) [-1502.468] -- 0:02:55
134000 -- (-1500.617) (-1493.914) [-1496.216] (-1496.783) * (-1493.550) (-1504.996) (-1498.467) [-1495.365] -- 0:02:54
134500 -- (-1497.107) (-1505.407) (-1496.859) [-1494.920] * (-1502.802) (-1511.103) [-1492.967] (-1490.320) -- 0:02:53
135000 -- (-1490.399) (-1501.616) [-1495.568] (-1496.169) * (-1499.301) (-1498.493) (-1492.628) [-1493.324] -- 0:02:59
Average standard deviation of split frequencies: 0.008666
135500 -- [-1494.295] (-1501.340) (-1498.032) (-1496.117) * (-1500.942) (-1498.029) [-1494.644] (-1500.617) -- 0:02:58
136000 -- (-1496.476) (-1504.129) (-1500.298) [-1492.166] * (-1498.841) [-1496.857] (-1499.368) (-1500.264) -- 0:02:57
136500 -- [-1501.454] (-1496.805) (-1495.827) (-1496.522) * [-1497.518] (-1494.638) (-1494.396) (-1505.153) -- 0:02:57
137000 -- (-1498.357) (-1493.116) (-1493.995) [-1499.139] * (-1496.628) [-1498.256] (-1495.662) (-1504.032) -- 0:02:56
137500 -- [-1490.579] (-1502.014) (-1496.079) (-1495.714) * (-1503.539) (-1499.443) (-1496.245) [-1505.083] -- 0:02:55
138000 -- (-1491.377) (-1502.172) [-1500.133] (-1493.645) * (-1503.294) (-1497.138) (-1495.629) [-1500.232] -- 0:02:54
138500 -- (-1496.725) (-1500.151) [-1494.071] (-1492.362) * (-1498.846) [-1490.135] (-1492.318) (-1498.380) -- 0:02:54
139000 -- (-1497.468) (-1498.171) (-1495.692) [-1492.000] * (-1498.478) (-1506.730) [-1490.990] (-1497.412) -- 0:02:53
139500 -- (-1498.712) (-1497.899) (-1496.780) [-1494.933] * (-1495.293) [-1494.460] (-1495.225) (-1509.002) -- 0:02:52
140000 -- (-1500.380) (-1502.309) (-1494.288) [-1499.657] * [-1491.528] (-1494.143) (-1495.589) (-1500.981) -- 0:02:58
Average standard deviation of split frequencies: 0.006702
140500 -- [-1496.107] (-1495.454) (-1493.908) (-1496.229) * (-1495.813) (-1491.562) [-1495.985] (-1507.943) -- 0:02:57
141000 -- (-1500.158) (-1493.465) [-1495.247] (-1492.159) * (-1496.902) (-1499.029) [-1492.923] (-1496.611) -- 0:02:56
141500 -- (-1497.064) (-1493.538) (-1492.420) [-1492.982] * (-1494.989) (-1495.839) (-1494.312) [-1495.532] -- 0:02:55
142000 -- (-1498.555) (-1498.477) [-1496.796] (-1493.441) * (-1494.543) [-1498.504] (-1497.420) (-1495.972) -- 0:02:55
142500 -- (-1494.497) (-1492.388) [-1494.631] (-1493.082) * [-1489.294] (-1501.574) (-1500.700) (-1493.596) -- 0:02:54
143000 -- [-1495.760] (-1491.351) (-1494.549) (-1492.943) * (-1492.353) (-1495.645) [-1504.672] (-1495.398) -- 0:02:53
143500 -- (-1495.105) [-1492.498] (-1492.708) (-1498.259) * (-1495.199) (-1495.835) [-1496.776] (-1496.110) -- 0:02:53
144000 -- (-1498.706) (-1497.396) [-1491.699] (-1489.663) * (-1495.545) [-1494.742] (-1497.418) (-1499.041) -- 0:02:52
144500 -- (-1496.101) [-1500.347] (-1502.273) (-1491.904) * (-1493.929) [-1493.603] (-1499.861) (-1496.733) -- 0:02:51
145000 -- (-1499.184) (-1505.613) (-1502.854) [-1494.087] * (-1491.903) (-1500.360) [-1500.810] (-1500.219) -- 0:02:56
Average standard deviation of split frequencies: 0.006458
145500 -- (-1504.389) [-1493.816] (-1493.728) (-1496.107) * (-1500.525) (-1497.759) (-1497.832) [-1500.369] -- 0:02:56
146000 -- (-1502.862) (-1492.291) [-1492.154] (-1509.720) * (-1496.461) [-1493.932] (-1496.790) (-1499.902) -- 0:02:55
146500 -- (-1504.683) (-1499.774) [-1495.492] (-1501.553) * [-1495.039] (-1502.286) (-1502.673) (-1501.481) -- 0:02:54
147000 -- (-1497.538) (-1497.059) [-1494.200] (-1496.447) * (-1495.266) (-1500.555) [-1493.732] (-1497.943) -- 0:02:54
147500 -- [-1498.062] (-1498.813) (-1501.995) (-1496.904) * (-1497.323) [-1500.604] (-1495.159) (-1494.312) -- 0:02:53
148000 -- (-1496.452) (-1495.630) (-1495.611) [-1494.279] * (-1492.960) (-1498.669) [-1493.517] (-1502.171) -- 0:02:52
148500 -- (-1495.229) (-1500.492) (-1493.322) [-1493.039] * (-1496.854) (-1496.930) (-1498.103) [-1492.499] -- 0:02:52
149000 -- (-1502.860) (-1500.406) (-1503.286) [-1491.318] * (-1497.552) (-1496.305) [-1495.751] (-1496.868) -- 0:02:51
149500 -- (-1499.612) (-1499.160) [-1503.472] (-1493.060) * (-1493.727) (-1494.262) [-1489.558] (-1496.400) -- 0:02:56
150000 -- (-1500.701) (-1505.982) (-1496.322) [-1496.527] * (-1496.606) (-1494.497) [-1492.640] (-1492.289) -- 0:02:55
Average standard deviation of split frequencies: 0.006258
150500 -- [-1500.857] (-1501.731) (-1499.959) (-1495.776) * (-1499.423) [-1494.607] (-1490.096) (-1491.642) -- 0:02:54
151000 -- (-1497.650) (-1502.438) (-1497.447) [-1497.594] * [-1499.627] (-1495.565) (-1500.832) (-1499.328) -- 0:02:54
151500 -- (-1500.252) (-1493.186) [-1498.437] (-1495.110) * (-1496.309) (-1494.153) (-1498.250) [-1490.984] -- 0:02:53
152000 -- (-1498.211) [-1494.910] (-1504.938) (-1493.808) * [-1499.104] (-1495.012) (-1496.256) (-1495.614) -- 0:02:52
152500 -- [-1492.924] (-1503.142) (-1490.695) (-1495.195) * (-1498.186) (-1498.300) [-1496.894] (-1490.270) -- 0:02:52
153000 -- (-1499.427) [-1497.629] (-1493.833) (-1499.430) * (-1495.515) (-1490.948) [-1501.194] (-1494.192) -- 0:02:51
153500 -- (-1499.023) [-1494.365] (-1500.589) (-1495.226) * (-1494.394) (-1503.214) (-1491.897) [-1497.548] -- 0:02:50
154000 -- (-1497.251) [-1490.787] (-1498.178) (-1500.613) * (-1498.924) (-1502.033) [-1497.580] (-1492.200) -- 0:02:50
154500 -- [-1495.939] (-1494.092) (-1498.482) (-1501.137) * (-1496.554) (-1493.359) [-1500.937] (-1499.580) -- 0:02:55
155000 -- (-1497.264) [-1498.710] (-1492.601) (-1496.099) * (-1500.098) [-1496.463] (-1498.616) (-1497.706) -- 0:02:54
Average standard deviation of split frequencies: 0.006044
155500 -- (-1499.127) [-1493.843] (-1494.682) (-1491.247) * (-1499.830) [-1500.683] (-1493.586) (-1495.685) -- 0:02:53
156000 -- [-1500.400] (-1495.361) (-1503.658) (-1501.121) * (-1502.439) [-1491.202] (-1489.529) (-1494.201) -- 0:02:53
156500 -- (-1497.336) (-1499.186) (-1495.892) [-1493.484] * [-1494.928] (-1499.655) (-1494.028) (-1501.661) -- 0:02:52
157000 -- (-1506.331) [-1495.456] (-1499.093) (-1492.526) * (-1495.088) (-1504.630) [-1497.025] (-1498.086) -- 0:02:51
157500 -- (-1496.465) (-1494.356) (-1499.978) [-1492.271] * (-1500.928) (-1498.309) [-1496.180] (-1500.617) -- 0:02:51
158000 -- (-1492.017) (-1505.776) [-1496.784] (-1490.001) * (-1496.349) [-1495.061] (-1500.447) (-1494.009) -- 0:02:50
158500 -- (-1502.230) [-1496.177] (-1496.064) (-1494.597) * (-1499.820) (-1496.881) (-1499.645) [-1492.368] -- 0:02:49
159000 -- [-1503.392] (-1509.183) (-1497.492) (-1493.763) * (-1503.766) [-1497.406] (-1500.223) (-1497.329) -- 0:02:49
159500 -- (-1503.257) [-1493.030] (-1498.925) (-1496.293) * (-1498.913) (-1500.431) (-1500.245) [-1501.221] -- 0:02:53
160000 -- (-1494.588) (-1492.599) [-1495.872] (-1496.892) * (-1495.160) [-1493.965] (-1490.450) (-1498.192) -- 0:02:53
Average standard deviation of split frequencies: 0.005868
160500 -- (-1497.695) (-1493.393) (-1492.696) [-1493.011] * (-1492.798) (-1502.338) [-1496.555] (-1493.579) -- 0:02:52
161000 -- (-1501.561) [-1492.355] (-1494.660) (-1499.028) * (-1491.564) (-1501.731) [-1497.650] (-1499.326) -- 0:02:51
161500 -- [-1495.464] (-1497.431) (-1497.791) (-1500.707) * (-1494.319) [-1499.638] (-1494.176) (-1495.728) -- 0:02:51
162000 -- [-1491.931] (-1497.640) (-1496.358) (-1503.335) * [-1495.239] (-1501.931) (-1497.189) (-1502.912) -- 0:02:50
162500 -- (-1491.546) (-1495.415) [-1495.898] (-1500.087) * [-1493.774] (-1500.399) (-1498.123) (-1494.810) -- 0:02:50
163000 -- [-1491.462] (-1494.357) (-1507.429) (-1496.987) * [-1498.978] (-1496.083) (-1500.543) (-1497.994) -- 0:02:49
163500 -- (-1494.120) [-1499.037] (-1506.751) (-1506.278) * (-1503.025) (-1499.543) [-1498.469] (-1495.890) -- 0:02:48
164000 -- (-1497.217) (-1500.670) [-1498.440] (-1497.623) * (-1499.601) (-1497.350) [-1495.856] (-1495.343) -- 0:02:53
164500 -- (-1497.526) (-1490.416) [-1493.426] (-1500.950) * (-1500.715) [-1495.901] (-1498.854) (-1493.555) -- 0:02:52
165000 -- [-1496.672] (-1493.752) (-1502.047) (-1503.677) * (-1495.352) (-1492.163) (-1495.953) [-1492.793] -- 0:02:52
Average standard deviation of split frequencies: 0.007099
165500 -- (-1492.947) (-1491.791) [-1499.201] (-1502.672) * (-1493.344) (-1495.363) (-1499.292) [-1499.083] -- 0:02:51
166000 -- (-1501.370) (-1503.233) (-1498.313) [-1497.406] * (-1494.460) [-1492.383] (-1497.276) (-1496.520) -- 0:02:50
166500 -- [-1499.198] (-1501.815) (-1496.855) (-1502.584) * (-1495.018) (-1492.646) [-1494.291] (-1498.360) -- 0:02:50
167000 -- (-1501.967) [-1497.502] (-1493.674) (-1505.700) * [-1495.434] (-1496.519) (-1501.801) (-1496.993) -- 0:02:49
167500 -- (-1499.604) (-1502.499) [-1494.954] (-1502.086) * [-1494.231] (-1498.991) (-1498.461) (-1501.058) -- 0:02:48
168000 -- (-1502.416) (-1497.793) [-1492.622] (-1500.090) * (-1495.243) (-1493.360) (-1498.610) [-1493.799] -- 0:02:48
168500 -- [-1493.827] (-1493.063) (-1495.339) (-1503.408) * (-1496.788) (-1499.990) (-1499.396) [-1499.624] -- 0:02:47
169000 -- [-1496.011] (-1497.563) (-1492.783) (-1501.064) * (-1500.778) [-1494.594] (-1496.412) (-1494.773) -- 0:02:52
169500 -- (-1496.777) (-1492.320) [-1490.945] (-1501.947) * (-1496.182) (-1501.201) [-1500.027] (-1493.313) -- 0:02:51
170000 -- (-1496.913) [-1505.097] (-1490.170) (-1500.197) * (-1494.987) (-1498.449) [-1497.627] (-1502.751) -- 0:02:50
Average standard deviation of split frequencies: 0.006905
170500 -- (-1496.835) (-1497.524) (-1497.768) [-1499.176] * (-1494.660) (-1493.656) (-1501.737) [-1492.561] -- 0:02:50
171000 -- [-1497.487] (-1501.214) (-1504.479) (-1504.217) * (-1496.374) (-1502.064) (-1501.359) [-1491.571] -- 0:02:49
171500 -- (-1495.358) (-1490.969) (-1499.571) [-1499.037] * (-1502.474) [-1499.799] (-1497.462) (-1492.233) -- 0:02:49
172000 -- (-1494.948) (-1492.506) [-1497.690] (-1493.562) * (-1499.731) (-1502.956) [-1497.842] (-1495.697) -- 0:02:48
172500 -- (-1493.759) (-1499.853) [-1494.471] (-1495.674) * (-1504.749) (-1502.135) (-1496.910) [-1495.435] -- 0:02:47
173000 -- (-1494.873) [-1500.988] (-1495.945) (-1494.753) * (-1502.601) (-1496.254) (-1496.873) [-1491.773] -- 0:02:47
173500 -- (-1495.471) (-1505.381) (-1501.191) [-1501.451] * (-1496.572) (-1493.317) (-1497.488) [-1494.893] -- 0:02:51
174000 -- [-1488.629] (-1507.681) (-1493.342) (-1494.556) * (-1503.079) [-1493.327] (-1496.483) (-1494.285) -- 0:02:50
174500 -- (-1499.862) [-1492.075] (-1495.227) (-1496.739) * (-1496.261) (-1498.691) (-1494.709) [-1494.724] -- 0:02:50
175000 -- (-1498.629) (-1491.344) [-1495.495] (-1501.483) * (-1497.159) [-1491.586] (-1498.454) (-1497.284) -- 0:02:49
Average standard deviation of split frequencies: 0.006696
175500 -- (-1497.333) (-1490.644) (-1500.086) [-1500.687] * (-1492.540) (-1498.787) [-1498.269] (-1500.570) -- 0:02:49
176000 -- (-1496.270) (-1497.806) [-1494.451] (-1496.106) * (-1491.938) [-1494.325] (-1497.669) (-1498.480) -- 0:02:48
176500 -- (-1489.944) (-1501.302) [-1494.288] (-1504.967) * (-1496.048) [-1493.918] (-1499.631) (-1490.556) -- 0:02:47
177000 -- (-1501.143) (-1498.068) [-1493.913] (-1508.947) * [-1490.323] (-1493.282) (-1498.817) (-1496.559) -- 0:02:47
177500 -- (-1496.507) (-1496.679) [-1495.348] (-1501.521) * (-1494.578) [-1494.872] (-1500.236) (-1496.708) -- 0:02:46
178000 -- (-1494.469) (-1494.717) [-1494.609] (-1497.059) * (-1491.286) [-1491.176] (-1498.017) (-1492.893) -- 0:02:46
178500 -- (-1496.694) (-1492.728) [-1494.149] (-1505.748) * (-1511.475) (-1493.843) (-1492.444) [-1496.615] -- 0:02:50
179000 -- (-1497.970) (-1497.205) [-1489.378] (-1493.727) * (-1496.738) (-1497.818) (-1500.064) [-1498.297] -- 0:02:49
179500 -- (-1497.629) (-1496.618) (-1490.096) [-1495.615] * (-1497.167) [-1493.423] (-1496.456) (-1505.312) -- 0:02:49
180000 -- (-1495.508) (-1496.530) (-1493.148) [-1489.509] * [-1495.119] (-1494.498) (-1492.035) (-1499.969) -- 0:02:48
Average standard deviation of split frequencies: 0.006523
180500 -- [-1496.346] (-1495.066) (-1493.744) (-1497.684) * (-1490.732) [-1497.601] (-1497.526) (-1505.021) -- 0:02:47
181000 -- (-1506.152) [-1495.135] (-1501.048) (-1498.874) * (-1495.679) (-1499.937) (-1493.082) [-1495.905] -- 0:02:47
181500 -- (-1504.851) [-1491.796] (-1501.950) (-1504.955) * (-1499.352) (-1497.569) [-1494.921] (-1502.611) -- 0:02:46
182000 -- (-1503.403) [-1497.438] (-1499.428) (-1496.286) * (-1496.844) [-1495.895] (-1500.352) (-1507.974) -- 0:02:46
182500 -- [-1502.697] (-1492.061) (-1496.645) (-1498.065) * (-1495.183) (-1501.137) [-1496.126] (-1499.821) -- 0:02:45
183000 -- (-1496.774) (-1494.453) [-1500.074] (-1498.230) * (-1494.508) (-1497.370) [-1489.790] (-1502.312) -- 0:02:45
183500 -- (-1506.145) [-1499.307] (-1498.826) (-1495.898) * [-1495.351] (-1499.391) (-1501.647) (-1504.551) -- 0:02:49
184000 -- (-1506.734) (-1496.886) (-1498.990) [-1493.443] * (-1497.794) (-1493.768) [-1495.515] (-1500.107) -- 0:02:48
184500 -- [-1492.187] (-1504.590) (-1494.161) (-1497.614) * (-1495.016) [-1494.395] (-1495.410) (-1495.437) -- 0:02:47
185000 -- (-1495.368) [-1499.025] (-1494.461) (-1498.447) * [-1499.810] (-1499.176) (-1495.045) (-1497.621) -- 0:02:47
Average standard deviation of split frequencies: 0.006336
185500 -- (-1493.915) (-1500.402) [-1496.078] (-1495.427) * (-1492.417) (-1497.646) (-1494.749) [-1491.610] -- 0:02:46
186000 -- [-1490.923] (-1496.242) (-1496.442) (-1499.849) * (-1493.086) [-1493.259] (-1496.497) (-1494.739) -- 0:02:46
186500 -- (-1495.795) (-1497.216) (-1493.146) [-1502.164] * (-1494.449) [-1493.674] (-1501.480) (-1491.833) -- 0:02:45
187000 -- (-1498.166) (-1492.697) (-1496.984) [-1494.698] * (-1497.416) (-1498.440) (-1494.479) [-1493.756] -- 0:02:45
187500 -- (-1498.848) (-1493.549) [-1492.766] (-1500.835) * (-1492.264) (-1491.587) [-1497.850] (-1493.829) -- 0:02:44
188000 -- (-1499.223) [-1498.041] (-1503.172) (-1497.164) * [-1496.724] (-1500.353) (-1504.819) (-1499.068) -- 0:02:48
188500 -- (-1499.391) [-1492.340] (-1499.385) (-1499.193) * (-1495.005) (-1496.589) [-1499.387] (-1499.980) -- 0:02:47
189000 -- (-1494.100) (-1497.909) (-1500.543) [-1493.643] * (-1497.188) (-1499.191) [-1500.438] (-1497.801) -- 0:02:47
189500 -- (-1493.587) [-1498.753] (-1497.613) (-1500.256) * (-1495.173) (-1500.200) (-1504.313) [-1496.065] -- 0:02:46
190000 -- [-1491.749] (-1495.510) (-1493.203) (-1491.449) * (-1498.362) (-1504.246) [-1496.529] (-1494.385) -- 0:02:46
Average standard deviation of split frequencies: 0.006181
190500 -- (-1497.958) (-1505.604) (-1498.549) [-1502.640] * (-1500.096) (-1499.516) (-1497.583) [-1497.984] -- 0:02:45
191000 -- (-1491.772) (-1502.439) (-1501.311) [-1490.964] * [-1494.453] (-1496.250) (-1495.363) (-1493.058) -- 0:02:45
191500 -- (-1499.315) (-1497.073) [-1492.947] (-1490.743) * (-1493.589) (-1495.695) [-1493.726] (-1497.507) -- 0:02:44
192000 -- (-1500.357) [-1495.524] (-1497.803) (-1496.771) * (-1500.200) (-1498.836) [-1495.373] (-1494.239) -- 0:02:44
192500 -- [-1491.681] (-1498.368) (-1498.563) (-1497.433) * (-1495.615) [-1494.555] (-1507.618) (-1494.777) -- 0:02:43
193000 -- (-1495.418) (-1497.818) (-1496.741) [-1494.713] * (-1492.836) (-1494.485) [-1498.283] (-1491.531) -- 0:02:47
193500 -- [-1498.335] (-1496.608) (-1498.853) (-1497.858) * (-1495.586) [-1491.194] (-1495.536) (-1495.187) -- 0:02:46
194000 -- [-1496.612] (-1504.216) (-1500.331) (-1495.122) * (-1497.818) [-1494.607] (-1500.855) (-1494.782) -- 0:02:46
194500 -- (-1501.184) [-1497.848] (-1497.843) (-1498.655) * (-1496.168) [-1499.875] (-1500.865) (-1502.591) -- 0:02:45
195000 -- (-1498.839) (-1501.459) [-1494.786] (-1503.181) * (-1500.839) (-1497.870) [-1494.170] (-1503.352) -- 0:02:45
Average standard deviation of split frequencies: 0.008418
195500 -- (-1507.569) (-1499.052) [-1500.533] (-1498.465) * (-1512.561) [-1493.509] (-1500.937) (-1495.883) -- 0:02:44
196000 -- (-1497.133) (-1497.503) [-1499.434] (-1498.540) * [-1499.587] (-1495.702) (-1499.707) (-1499.587) -- 0:02:44
196500 -- (-1501.843) [-1500.511] (-1502.037) (-1497.020) * (-1496.686) [-1498.281] (-1503.628) (-1499.481) -- 0:02:43
197000 -- (-1496.564) (-1500.966) [-1491.512] (-1496.846) * (-1495.532) [-1494.871] (-1504.006) (-1500.918) -- 0:02:43
197500 -- (-1499.449) (-1497.299) (-1497.542) [-1495.405] * (-1493.911) [-1496.651] (-1504.608) (-1500.002) -- 0:02:42
198000 -- (-1493.887) [-1491.792] (-1499.641) (-1496.013) * (-1501.268) [-1488.888] (-1500.735) (-1506.632) -- 0:02:46
198500 -- [-1495.365] (-1495.183) (-1495.506) (-1494.065) * (-1494.640) (-1497.124) (-1499.575) [-1493.581] -- 0:02:45
199000 -- (-1490.820) (-1498.680) [-1494.667] (-1492.855) * (-1502.877) (-1492.959) [-1493.080] (-1493.396) -- 0:02:45
199500 -- [-1497.198] (-1499.405) (-1498.418) (-1498.734) * [-1500.960] (-1492.974) (-1496.008) (-1493.494) -- 0:02:44
200000 -- (-1507.637) [-1493.263] (-1501.386) (-1497.535) * [-1490.842] (-1493.178) (-1495.746) (-1500.614) -- 0:02:44
Average standard deviation of split frequencies: 0.009397
200500 -- (-1498.061) (-1493.753) [-1499.309] (-1498.608) * (-1495.556) [-1494.870] (-1498.585) (-1496.395) -- 0:02:43
201000 -- (-1495.028) [-1498.618] (-1490.062) (-1497.588) * (-1499.411) (-1496.091) (-1501.675) [-1492.645] -- 0:02:42
201500 -- (-1503.372) [-1500.970] (-1494.773) (-1496.938) * [-1497.597] (-1502.366) (-1498.578) (-1495.370) -- 0:02:42
202000 -- (-1503.944) (-1504.933) [-1493.420] (-1495.218) * (-1494.243) (-1494.159) (-1499.408) [-1491.843] -- 0:02:41
202500 -- [-1502.365] (-1498.961) (-1492.775) (-1494.051) * (-1501.085) (-1493.655) (-1494.554) [-1491.460] -- 0:02:45
203000 -- [-1498.138] (-1499.628) (-1502.712) (-1493.409) * (-1498.678) (-1501.243) (-1494.704) [-1493.612] -- 0:02:44
203500 -- [-1498.098] (-1496.365) (-1506.489) (-1495.844) * [-1498.450] (-1500.786) (-1497.517) (-1490.877) -- 0:02:44
204000 -- [-1498.945] (-1501.922) (-1497.225) (-1500.244) * (-1491.548) [-1493.036] (-1492.061) (-1492.028) -- 0:02:43
204500 -- (-1497.117) [-1498.189] (-1491.698) (-1499.592) * [-1499.239] (-1496.440) (-1497.391) (-1503.676) -- 0:02:43
205000 -- [-1495.821] (-1504.185) (-1495.553) (-1504.681) * (-1494.203) [-1494.576] (-1493.000) (-1496.242) -- 0:02:42
Average standard deviation of split frequencies: 0.008009
205500 -- (-1491.981) (-1497.672) (-1492.930) [-1502.140] * [-1496.774] (-1494.730) (-1497.629) (-1495.878) -- 0:02:42
206000 -- [-1492.876] (-1498.710) (-1497.988) (-1498.585) * (-1503.657) [-1494.116] (-1496.421) (-1494.712) -- 0:02:41
206500 -- (-1495.403) [-1497.216] (-1496.979) (-1497.835) * (-1497.408) (-1496.661) [-1502.408] (-1496.584) -- 0:02:41
207000 -- (-1496.349) (-1495.853) (-1503.123) [-1490.292] * (-1497.902) (-1492.645) [-1495.634] (-1500.448) -- 0:02:40
207500 -- (-1498.436) [-1504.472] (-1497.475) (-1492.795) * (-1496.455) (-1494.655) [-1499.034] (-1494.993) -- 0:02:44
208000 -- (-1500.101) [-1495.316] (-1491.714) (-1493.579) * (-1497.357) [-1493.277] (-1504.809) (-1497.294) -- 0:02:43
208500 -- (-1494.428) [-1493.656] (-1496.237) (-1494.121) * (-1496.413) (-1511.849) (-1500.684) [-1498.151] -- 0:02:43
209000 -- (-1495.686) (-1494.415) [-1494.911] (-1494.250) * (-1500.687) (-1492.847) (-1499.281) [-1498.432] -- 0:02:42
209500 -- [-1494.650] (-1504.524) (-1500.687) (-1497.663) * (-1493.772) [-1499.294] (-1496.737) (-1499.540) -- 0:02:42
210000 -- [-1497.306] (-1497.509) (-1503.217) (-1500.958) * (-1493.382) (-1498.134) (-1500.194) [-1495.975] -- 0:02:41
Average standard deviation of split frequencies: 0.007832
210500 -- (-1493.836) (-1498.981) [-1498.872] (-1499.364) * (-1498.582) (-1502.170) [-1503.577] (-1497.287) -- 0:02:41
211000 -- (-1498.338) [-1503.186] (-1494.712) (-1494.568) * (-1500.666) (-1494.307) [-1499.786] (-1493.276) -- 0:02:40
211500 -- (-1504.855) (-1502.987) [-1492.561] (-1497.474) * (-1494.485) [-1498.110] (-1493.644) (-1495.690) -- 0:02:40
212000 -- (-1495.477) (-1501.333) (-1494.362) [-1501.264] * (-1495.001) (-1504.286) (-1493.365) [-1494.133] -- 0:02:43
212500 -- [-1494.123] (-1498.943) (-1495.851) (-1498.223) * (-1492.229) (-1498.571) (-1492.583) [-1495.273] -- 0:02:43
213000 -- (-1502.192) (-1497.045) [-1490.013] (-1501.862) * [-1495.605] (-1495.751) (-1499.859) (-1496.527) -- 0:02:42
213500 -- (-1498.330) (-1499.010) [-1498.723] (-1501.071) * (-1497.895) [-1496.777] (-1494.700) (-1504.911) -- 0:02:42
214000 -- [-1499.150] (-1500.128) (-1498.354) (-1496.547) * [-1501.270] (-1502.746) (-1492.868) (-1497.907) -- 0:02:41
214500 -- (-1493.060) (-1495.432) [-1491.274] (-1495.596) * (-1499.976) [-1493.559] (-1492.338) (-1498.841) -- 0:02:41
215000 -- [-1496.048] (-1496.034) (-1503.248) (-1492.788) * (-1498.780) (-1494.829) [-1493.758] (-1491.322) -- 0:02:40
Average standard deviation of split frequencies: 0.007638
215500 -- (-1501.545) [-1497.555] (-1495.119) (-1495.284) * (-1497.445) [-1501.170] (-1497.038) (-1495.256) -- 0:02:40
216000 -- (-1494.280) (-1500.829) [-1499.416] (-1501.044) * (-1511.629) [-1495.036] (-1503.152) (-1499.503) -- 0:02:39
216500 -- [-1499.063] (-1500.008) (-1499.420) (-1495.758) * (-1497.404) [-1493.884] (-1495.842) (-1496.179) -- 0:02:39
217000 -- (-1499.058) [-1499.119] (-1494.338) (-1501.710) * (-1503.697) (-1497.424) (-1497.687) [-1499.422] -- 0:02:42
217500 -- (-1504.087) (-1497.155) (-1494.368) [-1495.593] * (-1500.637) (-1498.103) (-1502.784) [-1496.992] -- 0:02:41
218000 -- [-1498.025] (-1500.325) (-1495.591) (-1502.385) * (-1500.233) (-1493.215) [-1500.087] (-1496.397) -- 0:02:41
218500 -- [-1494.799] (-1496.547) (-1500.073) (-1500.133) * (-1503.898) (-1492.393) [-1493.347] (-1499.337) -- 0:02:40
219000 -- (-1492.479) [-1498.377] (-1497.601) (-1506.380) * (-1498.808) (-1495.295) [-1498.460] (-1501.510) -- 0:02:40
219500 -- [-1494.109] (-1497.127) (-1497.081) (-1498.948) * [-1498.921] (-1494.788) (-1506.388) (-1493.896) -- 0:02:40
220000 -- [-1496.988] (-1493.965) (-1497.108) (-1503.318) * (-1498.329) (-1498.692) (-1499.892) [-1497.507] -- 0:02:39
Average standard deviation of split frequencies: 0.007477
220500 -- (-1496.597) (-1491.931) (-1498.674) [-1494.718] * [-1493.528] (-1505.648) (-1501.655) (-1496.725) -- 0:02:39
221000 -- (-1500.381) (-1496.334) [-1495.526] (-1497.531) * [-1494.021] (-1498.993) (-1497.057) (-1498.562) -- 0:02:38
221500 -- [-1493.782] (-1494.298) (-1497.613) (-1493.762) * (-1495.880) (-1496.739) (-1500.023) [-1492.218] -- 0:02:38
222000 -- [-1492.899] (-1493.206) (-1496.972) (-1496.393) * [-1497.463] (-1502.764) (-1493.186) (-1492.676) -- 0:02:41
222500 -- [-1494.266] (-1503.958) (-1495.123) (-1495.921) * (-1495.958) (-1495.723) (-1492.811) [-1494.900] -- 0:02:40
223000 -- (-1496.964) (-1505.349) (-1493.286) [-1495.639] * [-1498.454] (-1497.200) (-1494.870) (-1499.237) -- 0:02:40
223500 -- (-1491.899) (-1495.328) [-1491.924] (-1495.815) * (-1490.030) (-1495.411) (-1494.584) [-1496.888] -- 0:02:39
224000 -- (-1498.218) [-1494.797] (-1494.075) (-1495.378) * [-1499.294] (-1494.282) (-1497.423) (-1496.381) -- 0:02:39
224500 -- (-1499.273) (-1494.383) [-1496.791] (-1496.741) * (-1493.127) (-1496.585) [-1495.202] (-1495.728) -- 0:02:38
225000 -- [-1493.189] (-1500.838) (-1499.290) (-1494.400) * [-1502.895] (-1501.561) (-1492.522) (-1505.724) -- 0:02:38
Average standard deviation of split frequencies: 0.007301
225500 -- (-1500.296) [-1493.860] (-1498.851) (-1496.234) * [-1493.243] (-1494.521) (-1495.672) (-1503.140) -- 0:02:37
226000 -- [-1504.811] (-1496.659) (-1495.363) (-1497.942) * (-1500.592) (-1496.230) (-1494.689) [-1498.676] -- 0:02:37
226500 -- (-1498.738) (-1498.522) (-1493.647) [-1498.768] * (-1500.178) (-1491.604) [-1493.778] (-1501.484) -- 0:02:40
227000 -- (-1497.822) [-1494.803] (-1497.029) (-1501.685) * (-1493.234) (-1494.871) [-1493.809] (-1499.292) -- 0:02:40
227500 -- (-1499.888) (-1493.188) (-1499.290) [-1498.105] * (-1494.362) [-1492.725] (-1500.234) (-1502.707) -- 0:02:39
228000 -- [-1492.843] (-1495.243) (-1498.714) (-1493.455) * (-1493.583) [-1495.747] (-1502.927) (-1491.300) -- 0:02:39
228500 -- (-1492.994) (-1498.773) [-1496.637] (-1494.315) * (-1494.784) (-1499.701) [-1499.664] (-1492.965) -- 0:02:38
229000 -- (-1494.431) (-1500.617) (-1491.384) [-1493.123] * [-1494.040] (-1493.570) (-1495.881) (-1500.914) -- 0:02:38
229500 -- [-1493.954] (-1498.897) (-1496.367) (-1496.090) * (-1498.786) (-1500.392) (-1502.141) [-1496.887] -- 0:02:37
230000 -- (-1491.865) (-1499.200) (-1492.792) [-1496.848] * (-1498.342) (-1503.913) [-1498.351] (-1493.553) -- 0:02:37
Average standard deviation of split frequencies: 0.007153
230500 -- (-1494.325) [-1498.234] (-1497.573) (-1500.218) * (-1492.799) (-1496.761) (-1500.198) [-1492.738] -- 0:02:36
231000 -- [-1495.415] (-1500.296) (-1493.120) (-1501.857) * (-1496.320) [-1499.037] (-1492.830) (-1494.754) -- 0:02:36
231500 -- (-1501.359) (-1492.766) (-1490.582) [-1498.678] * (-1492.043) (-1502.101) [-1494.396] (-1497.124) -- 0:02:39
232000 -- (-1499.462) (-1498.049) [-1494.704] (-1498.001) * (-1491.604) [-1493.336] (-1501.703) (-1497.712) -- 0:02:38
232500 -- (-1498.665) [-1495.289] (-1496.400) (-1500.909) * [-1494.254] (-1493.508) (-1500.070) (-1494.717) -- 0:02:38
233000 -- (-1499.468) (-1497.551) (-1496.493) [-1494.233] * (-1502.414) [-1492.385] (-1500.607) (-1497.105) -- 0:02:38
233500 -- [-1502.199] (-1501.624) (-1497.655) (-1499.533) * (-1493.581) [-1493.558] (-1498.420) (-1494.938) -- 0:02:37
234000 -- (-1500.497) [-1490.978] (-1495.744) (-1497.194) * [-1499.285] (-1503.750) (-1495.487) (-1497.480) -- 0:02:37
234500 -- (-1497.134) (-1499.443) [-1496.755] (-1498.368) * [-1501.155] (-1501.745) (-1497.803) (-1494.725) -- 0:02:36
235000 -- [-1493.755] (-1502.879) (-1497.894) (-1498.237) * [-1497.422] (-1505.203) (-1493.459) (-1495.028) -- 0:02:36
Average standard deviation of split frequencies: 0.005992
235500 -- (-1494.642) (-1498.540) (-1508.163) [-1501.036] * [-1499.309] (-1498.730) (-1495.398) (-1500.217) -- 0:02:35
236000 -- (-1504.476) [-1497.284] (-1501.039) (-1492.844) * (-1497.490) (-1496.958) (-1507.418) [-1502.581] -- 0:02:35
236500 -- (-1495.277) (-1499.272) [-1496.918] (-1496.039) * (-1498.535) [-1492.928] (-1498.574) (-1496.200) -- 0:02:38
237000 -- (-1489.741) [-1494.818] (-1508.731) (-1498.287) * (-1511.986) [-1493.264] (-1497.913) (-1491.299) -- 0:02:37
237500 -- (-1504.702) [-1494.914] (-1501.699) (-1494.553) * (-1499.997) [-1493.310] (-1502.904) (-1499.425) -- 0:02:37
238000 -- [-1493.346] (-1495.526) (-1497.676) (-1495.909) * [-1499.675] (-1498.305) (-1505.387) (-1493.837) -- 0:02:36
238500 -- (-1497.505) [-1495.752] (-1499.267) (-1501.030) * [-1495.592] (-1502.491) (-1498.690) (-1493.313) -- 0:02:36
239000 -- (-1500.678) [-1496.694] (-1495.779) (-1498.029) * (-1496.064) [-1496.604] (-1497.002) (-1495.410) -- 0:02:36
239500 -- (-1492.189) [-1496.570] (-1500.022) (-1496.927) * [-1489.579] (-1496.974) (-1500.962) (-1499.624) -- 0:02:35
240000 -- (-1493.911) [-1498.588] (-1497.601) (-1496.857) * [-1491.495] (-1500.491) (-1500.665) (-1495.735) -- 0:02:35
Average standard deviation of split frequencies: 0.005876
240500 -- [-1496.290] (-1497.200) (-1498.251) (-1493.851) * (-1492.938) (-1495.870) (-1506.348) [-1493.208] -- 0:02:34
241000 -- (-1497.711) (-1501.695) (-1499.646) [-1493.603] * [-1497.504] (-1494.376) (-1498.266) (-1494.480) -- 0:02:37
241500 -- (-1503.750) [-1493.954] (-1496.401) (-1495.998) * [-1496.368] (-1490.983) (-1496.739) (-1501.648) -- 0:02:37
242000 -- [-1497.343] (-1493.873) (-1502.182) (-1493.664) * [-1492.156] (-1495.936) (-1496.762) (-1498.869) -- 0:02:36
242500 -- (-1500.654) (-1491.936) [-1500.631] (-1496.827) * (-1498.872) (-1495.734) [-1502.257] (-1513.429) -- 0:02:36
243000 -- [-1499.091] (-1494.832) (-1497.683) (-1491.260) * [-1501.287] (-1491.279) (-1493.916) (-1500.674) -- 0:02:35
243500 -- (-1495.481) (-1500.804) [-1496.118] (-1489.570) * [-1491.978] (-1495.879) (-1497.009) (-1501.608) -- 0:02:35
244000 -- (-1495.999) (-1492.551) [-1496.716] (-1500.613) * (-1497.298) (-1493.368) (-1496.451) [-1501.842] -- 0:02:34
244500 -- (-1500.624) (-1490.898) (-1493.326) [-1491.055] * [-1499.356] (-1493.839) (-1499.503) (-1498.207) -- 0:02:34
245000 -- (-1494.866) (-1488.616) (-1496.537) [-1492.741] * (-1492.406) [-1494.254] (-1495.636) (-1499.696) -- 0:02:34
Average standard deviation of split frequencies: 0.005749
245500 -- [-1501.727] (-1496.950) (-1494.444) (-1493.448) * (-1497.861) (-1493.938) (-1492.424) [-1499.029] -- 0:02:33
246000 -- (-1496.488) (-1500.657) (-1492.688) [-1494.490] * (-1497.259) (-1495.980) [-1493.284] (-1494.144) -- 0:02:36
246500 -- (-1496.094) (-1493.918) [-1494.470] (-1496.730) * (-1494.278) (-1497.015) [-1498.382] (-1492.237) -- 0:02:35
247000 -- (-1498.686) (-1497.830) (-1494.997) [-1497.377] * (-1498.596) [-1492.180] (-1498.519) (-1498.056) -- 0:02:35
247500 -- (-1498.427) (-1500.121) (-1493.076) [-1494.238] * (-1498.359) (-1496.650) [-1496.868] (-1491.871) -- 0:02:35
248000 -- [-1496.884] (-1502.016) (-1497.364) (-1495.569) * (-1502.268) [-1496.336] (-1494.237) (-1493.247) -- 0:02:34
248500 -- (-1492.099) (-1503.983) [-1496.805] (-1495.659) * (-1505.927) [-1491.333] (-1492.710) (-1504.118) -- 0:02:34
249000 -- [-1494.003] (-1499.621) (-1493.686) (-1496.329) * (-1499.478) [-1495.613] (-1494.231) (-1496.306) -- 0:02:33
249500 -- (-1491.973) (-1510.466) [-1501.395] (-1498.609) * (-1495.598) (-1495.511) (-1496.528) [-1497.901] -- 0:02:33
250000 -- [-1496.507] (-1501.387) (-1500.049) (-1504.447) * (-1494.196) [-1494.944] (-1498.378) (-1504.699) -- 0:02:33
Average standard deviation of split frequencies: 0.005642
250500 -- (-1501.072) [-1497.947] (-1504.107) (-1500.484) * (-1494.213) (-1495.172) [-1500.771] (-1492.480) -- 0:02:32
251000 -- (-1495.654) (-1500.017) (-1495.656) [-1497.349] * (-1496.418) (-1492.260) [-1500.117] (-1498.993) -- 0:02:35
251500 -- [-1501.576] (-1494.894) (-1494.189) (-1500.362) * (-1496.089) (-1496.706) (-1499.745) [-1494.833] -- 0:02:34
252000 -- [-1493.562] (-1494.414) (-1496.717) (-1494.803) * (-1494.187) (-1497.177) [-1499.084] (-1498.096) -- 0:02:34
252500 -- (-1490.839) (-1505.151) [-1497.991] (-1498.139) * (-1503.229) [-1494.646] (-1497.890) (-1501.847) -- 0:02:33
253000 -- (-1495.204) (-1494.644) [-1501.050] (-1495.493) * [-1494.229] (-1500.395) (-1490.529) (-1496.336) -- 0:02:33
253500 -- (-1498.975) (-1493.680) (-1496.660) [-1501.879] * (-1498.536) (-1497.935) [-1501.325] (-1497.908) -- 0:02:33
254000 -- (-1491.306) [-1495.792] (-1507.733) (-1499.568) * (-1501.008) (-1500.209) [-1498.035] (-1495.235) -- 0:02:32
254500 -- (-1492.621) (-1498.475) [-1494.668] (-1501.441) * (-1496.394) (-1492.949) (-1501.197) [-1496.760] -- 0:02:32
255000 -- (-1500.337) (-1495.345) [-1498.286] (-1496.102) * (-1492.693) (-1494.239) (-1493.269) [-1499.550] -- 0:02:31
Average standard deviation of split frequencies: 0.005524
255500 -- (-1490.934) (-1500.032) [-1495.258] (-1498.879) * (-1494.565) (-1499.319) [-1495.154] (-1493.718) -- 0:02:34
256000 -- [-1494.981] (-1494.582) (-1494.566) (-1493.972) * (-1492.038) [-1498.113] (-1493.092) (-1501.285) -- 0:02:34
256500 -- (-1499.119) (-1495.250) [-1493.558] (-1496.388) * (-1500.269) (-1499.554) [-1494.732] (-1491.896) -- 0:02:33
257000 -- (-1499.279) (-1496.206) [-1493.315] (-1495.995) * (-1500.486) (-1500.661) [-1500.243] (-1495.739) -- 0:02:33
257500 -- (-1504.124) [-1495.933] (-1493.065) (-1499.765) * [-1498.675] (-1497.122) (-1499.076) (-1494.987) -- 0:02:32
258000 -- [-1490.020] (-1502.206) (-1495.972) (-1498.215) * [-1496.305] (-1503.616) (-1499.353) (-1501.741) -- 0:02:32
258500 -- [-1495.961] (-1497.938) (-1498.063) (-1499.537) * (-1504.604) (-1494.624) [-1492.286] (-1493.777) -- 0:02:32
259000 -- (-1498.896) (-1492.993) [-1494.337] (-1496.855) * (-1498.082) (-1497.894) [-1495.800] (-1495.086) -- 0:02:31
259500 -- (-1499.103) [-1494.800] (-1494.816) (-1501.080) * [-1493.562] (-1507.883) (-1497.862) (-1498.325) -- 0:02:31
260000 -- (-1496.126) (-1500.435) (-1496.970) [-1492.802] * (-1498.527) (-1498.254) (-1497.860) [-1495.552] -- 0:02:30
Average standard deviation of split frequencies: 0.005425
260500 -- [-1488.823] (-1496.501) (-1497.181) (-1498.787) * (-1499.526) (-1503.369) [-1492.813] (-1499.082) -- 0:02:33
261000 -- (-1495.691) (-1497.431) [-1496.246] (-1495.261) * (-1501.112) (-1500.078) [-1496.778] (-1495.692) -- 0:02:32
261500 -- (-1501.167) (-1499.104) [-1495.437] (-1503.229) * (-1502.341) (-1508.503) [-1495.402] (-1497.074) -- 0:02:32
262000 -- (-1506.445) (-1501.384) (-1495.921) [-1490.572] * (-1496.277) (-1502.125) (-1501.620) [-1502.476] -- 0:02:32
262500 -- [-1496.220] (-1494.332) (-1496.284) (-1498.701) * [-1491.396] (-1511.335) (-1496.543) (-1497.806) -- 0:02:31
263000 -- (-1495.579) (-1494.758) (-1497.039) [-1492.744] * (-1493.561) (-1497.565) [-1493.975] (-1496.929) -- 0:02:31
263500 -- [-1494.171] (-1500.092) (-1501.346) (-1498.048) * (-1495.536) [-1493.199] (-1503.621) (-1496.808) -- 0:02:30
264000 -- (-1502.448) (-1495.967) (-1498.592) [-1493.790] * (-1494.776) (-1501.364) (-1500.110) [-1497.275] -- 0:02:30
264500 -- (-1497.786) (-1494.869) (-1504.363) [-1490.863] * (-1499.201) [-1497.183] (-1496.828) (-1504.088) -- 0:02:30
265000 -- (-1498.308) (-1490.989) (-1500.090) [-1495.212] * [-1495.144] (-1493.414) (-1503.391) (-1494.938) -- 0:02:32
Average standard deviation of split frequencies: 0.004430
265500 -- [-1492.688] (-1498.742) (-1497.215) (-1491.182) * (-1497.929) [-1491.729] (-1505.640) (-1497.907) -- 0:02:32
266000 -- (-1497.243) [-1492.892] (-1492.257) (-1497.175) * (-1501.284) [-1494.608] (-1499.055) (-1494.873) -- 0:02:31
266500 -- [-1504.032] (-1496.770) (-1506.161) (-1497.202) * (-1507.859) [-1491.948] (-1496.184) (-1494.130) -- 0:02:31
267000 -- (-1505.093) (-1506.500) [-1496.845] (-1495.055) * (-1500.306) (-1501.898) (-1506.169) [-1496.490] -- 0:02:30
267500 -- (-1504.620) (-1504.682) [-1497.667] (-1496.034) * (-1497.505) (-1493.252) (-1492.725) [-1493.560] -- 0:02:30
268000 -- (-1497.856) (-1499.729) (-1495.955) [-1497.176] * (-1494.039) (-1492.654) [-1496.636] (-1492.531) -- 0:02:30
268500 -- [-1496.060] (-1504.392) (-1494.657) (-1498.512) * (-1495.910) (-1496.211) [-1494.091] (-1501.788) -- 0:02:29
269000 -- (-1493.363) [-1500.169] (-1497.003) (-1495.869) * (-1496.678) (-1506.543) [-1497.250] (-1506.441) -- 0:02:29
269500 -- (-1493.751) (-1500.146) [-1500.454] (-1499.153) * (-1501.263) (-1503.922) [-1495.228] (-1508.725) -- 0:02:29
270000 -- (-1500.972) [-1496.183] (-1500.192) (-1498.479) * (-1500.248) (-1501.962) (-1506.118) [-1495.726] -- 0:02:31
Average standard deviation of split frequencies: 0.004354
270500 -- [-1496.895] (-1495.487) (-1493.373) (-1501.942) * (-1496.940) (-1499.135) [-1502.014] (-1500.120) -- 0:02:31
271000 -- (-1496.864) (-1499.873) (-1491.475) [-1495.340] * [-1494.168] (-1508.336) (-1493.982) (-1500.087) -- 0:02:30
271500 -- (-1509.737) (-1497.390) [-1493.119] (-1492.598) * (-1493.104) (-1492.176) [-1498.329] (-1507.436) -- 0:02:30
272000 -- (-1504.129) (-1496.522) [-1502.780] (-1497.730) * (-1496.886) [-1491.554] (-1497.166) (-1494.141) -- 0:02:29
272500 -- (-1501.983) (-1493.215) [-1495.281] (-1496.868) * (-1500.409) [-1492.426] (-1491.230) (-1498.934) -- 0:02:29
273000 -- (-1502.304) [-1497.088] (-1500.625) (-1498.257) * (-1499.898) (-1499.360) (-1490.992) [-1498.895] -- 0:02:29
273500 -- (-1505.331) (-1492.962) (-1494.826) [-1499.073] * (-1495.884) (-1496.345) (-1497.840) [-1499.509] -- 0:02:28
274000 -- (-1497.104) [-1495.705] (-1499.808) (-1497.662) * [-1491.470] (-1496.060) (-1499.156) (-1500.184) -- 0:02:28
274500 -- [-1499.545] (-1496.855) (-1495.606) (-1504.670) * (-1500.436) (-1495.562) [-1497.744] (-1497.830) -- 0:02:30
275000 -- [-1499.712] (-1505.072) (-1493.519) (-1502.017) * [-1496.793] (-1495.241) (-1493.040) (-1496.773) -- 0:02:30
Average standard deviation of split frequencies: 0.004270
275500 -- (-1501.696) [-1489.403] (-1498.487) (-1497.068) * (-1493.878) (-1496.425) (-1495.831) [-1490.604] -- 0:02:29
276000 -- [-1497.219] (-1497.410) (-1493.964) (-1495.533) * [-1495.773] (-1495.290) (-1492.641) (-1490.870) -- 0:02:29
276500 -- (-1497.851) (-1513.625) [-1493.857] (-1502.162) * (-1497.731) (-1495.072) [-1499.868] (-1500.875) -- 0:02:29
277000 -- (-1492.836) (-1498.026) (-1494.305) [-1495.798] * (-1495.690) [-1494.835] (-1500.977) (-1503.687) -- 0:02:28
277500 -- (-1490.620) (-1497.891) [-1494.122] (-1495.378) * (-1500.320) (-1495.177) (-1505.026) [-1491.393] -- 0:02:28
278000 -- (-1497.296) (-1495.279) [-1489.142] (-1493.192) * (-1505.938) (-1493.652) (-1492.763) [-1490.431] -- 0:02:28
278500 -- (-1495.211) (-1512.224) [-1496.464] (-1501.466) * (-1499.983) [-1492.796] (-1494.391) (-1499.603) -- 0:02:27
279000 -- (-1494.722) (-1504.239) [-1493.396] (-1502.267) * [-1496.444] (-1499.922) (-1494.449) (-1497.451) -- 0:02:27
279500 -- [-1491.849] (-1505.345) (-1493.678) (-1499.002) * [-1491.415] (-1496.228) (-1494.931) (-1502.633) -- 0:02:29
280000 -- (-1500.343) [-1494.097] (-1490.202) (-1502.835) * (-1493.557) [-1491.698] (-1501.156) (-1497.259) -- 0:02:29
Average standard deviation of split frequencies: 0.004199
280500 -- (-1500.789) (-1494.945) [-1492.064] (-1496.100) * (-1491.240) (-1492.551) (-1496.010) [-1502.803] -- 0:02:28
281000 -- (-1495.650) (-1503.334) (-1501.211) [-1495.065] * [-1498.296] (-1501.314) (-1497.766) (-1497.163) -- 0:02:28
281500 -- (-1499.536) [-1491.091] (-1504.215) (-1502.483) * (-1492.067) [-1496.456] (-1499.019) (-1498.951) -- 0:02:28
282000 -- (-1496.287) (-1495.221) [-1497.737] (-1496.283) * (-1496.094) (-1505.790) (-1501.202) [-1492.678] -- 0:02:27
282500 -- (-1498.310) [-1491.902] (-1506.950) (-1504.300) * (-1500.353) (-1497.318) (-1498.258) [-1498.352] -- 0:02:27
283000 -- [-1495.760] (-1491.051) (-1495.643) (-1500.950) * (-1497.191) (-1494.980) [-1493.611] (-1503.579) -- 0:02:26
283500 -- (-1498.575) (-1493.858) [-1496.743] (-1497.459) * [-1498.473] (-1498.181) (-1493.846) (-1496.138) -- 0:02:26
284000 -- [-1498.441] (-1498.434) (-1498.712) (-1497.999) * (-1497.453) (-1500.628) (-1506.126) [-1497.379] -- 0:02:26
284500 -- (-1496.244) [-1499.483] (-1498.666) (-1497.550) * (-1497.619) [-1501.688] (-1495.399) (-1498.391) -- 0:02:28
285000 -- (-1499.490) (-1499.224) [-1492.007] (-1497.650) * (-1493.770) [-1495.988] (-1494.592) (-1502.102) -- 0:02:28
Average standard deviation of split frequencies: 0.003297
285500 -- (-1491.953) (-1497.854) [-1493.818] (-1495.720) * (-1499.991) (-1495.269) [-1494.888] (-1496.184) -- 0:02:27
286000 -- (-1494.919) (-1495.124) (-1499.836) [-1501.135] * [-1498.766] (-1494.669) (-1496.062) (-1500.889) -- 0:02:27
286500 -- (-1495.979) (-1501.216) [-1499.377] (-1493.299) * [-1496.872] (-1496.077) (-1495.951) (-1503.236) -- 0:02:26
287000 -- (-1499.629) (-1497.417) (-1497.793) [-1494.296] * (-1505.645) (-1503.704) (-1494.325) [-1502.565] -- 0:02:26
287500 -- (-1497.877) [-1497.219] (-1495.769) (-1494.510) * (-1491.986) [-1499.869] (-1492.306) (-1510.269) -- 0:02:26
288000 -- [-1502.384] (-1499.910) (-1506.120) (-1496.670) * (-1497.551) (-1502.001) (-1494.246) [-1502.912] -- 0:02:25
288500 -- (-1503.338) (-1496.170) (-1502.021) [-1491.845] * (-1496.797) (-1494.724) [-1493.692] (-1497.828) -- 0:02:25
289000 -- [-1493.224] (-1499.224) (-1507.111) (-1494.287) * (-1498.702) (-1501.091) (-1494.445) [-1497.821] -- 0:02:27
289500 -- (-1499.880) (-1494.913) [-1494.909] (-1498.098) * (-1494.728) [-1499.848] (-1494.646) (-1493.514) -- 0:02:27
290000 -- (-1504.050) (-1494.613) (-1493.883) [-1496.780] * (-1495.258) [-1496.365] (-1492.119) (-1492.194) -- 0:02:26
Average standard deviation of split frequencies: 0.004055
290500 -- (-1500.231) (-1495.638) (-1495.839) [-1492.787] * (-1497.236) (-1501.116) [-1503.007] (-1493.355) -- 0:02:26
291000 -- (-1492.376) (-1502.445) (-1498.327) [-1493.004] * (-1495.298) (-1496.869) [-1491.700] (-1498.664) -- 0:02:26
291500 -- [-1498.046] (-1505.021) (-1504.102) (-1498.595) * (-1498.291) (-1493.133) [-1491.357] (-1501.437) -- 0:02:25
292000 -- (-1496.514) (-1497.610) (-1499.631) [-1494.869] * (-1507.181) (-1495.287) (-1490.031) [-1494.866] -- 0:02:25
292500 -- [-1494.729] (-1504.027) (-1497.356) (-1501.009) * (-1497.074) [-1493.978] (-1493.173) (-1497.195) -- 0:02:25
293000 -- (-1492.429) (-1493.251) [-1495.029] (-1491.813) * (-1501.699) (-1499.186) (-1498.807) [-1501.816] -- 0:02:24
293500 -- (-1497.682) (-1496.795) [-1495.311] (-1499.316) * (-1507.598) [-1493.893] (-1501.400) (-1493.693) -- 0:02:26
294000 -- (-1501.068) (-1496.475) [-1492.597] (-1498.042) * [-1495.519] (-1504.605) (-1499.129) (-1495.622) -- 0:02:26
294500 -- [-1497.551] (-1498.711) (-1493.148) (-1501.674) * (-1496.604) (-1498.343) (-1493.025) [-1490.892] -- 0:02:26
295000 -- (-1501.624) (-1495.751) [-1491.765] (-1501.730) * (-1501.455) [-1490.798] (-1494.866) (-1496.614) -- 0:02:25
Average standard deviation of split frequencies: 0.003185
295500 -- (-1498.953) [-1503.272] (-1497.527) (-1494.106) * (-1493.708) [-1492.105] (-1498.572) (-1497.283) -- 0:02:25
296000 -- (-1498.219) (-1493.573) (-1497.585) [-1491.840] * [-1493.402] (-1497.461) (-1504.466) (-1510.435) -- 0:02:25
296500 -- (-1496.045) (-1495.138) (-1497.491) [-1493.151] * (-1513.569) (-1495.008) [-1493.875] (-1497.551) -- 0:02:24
297000 -- (-1491.400) (-1495.595) (-1503.956) [-1495.577] * [-1498.482] (-1496.584) (-1492.269) (-1500.628) -- 0:02:24
297500 -- (-1497.195) (-1494.952) (-1498.266) [-1494.899] * [-1497.320] (-1491.790) (-1492.817) (-1494.612) -- 0:02:24
298000 -- (-1495.444) (-1502.515) (-1490.650) [-1494.812] * (-1495.086) (-1495.420) (-1494.060) [-1494.845] -- 0:02:26
298500 -- (-1498.542) [-1497.339] (-1497.430) (-1497.896) * (-1494.027) (-1493.227) [-1495.477] (-1498.302) -- 0:02:25
299000 -- (-1494.979) [-1496.582] (-1497.642) (-1492.824) * [-1498.371] (-1491.993) (-1493.118) (-1495.181) -- 0:02:25
299500 -- (-1492.925) (-1504.476) (-1498.769) [-1498.026] * (-1494.837) (-1492.865) [-1501.552] (-1499.785) -- 0:02:25
300000 -- (-1493.944) (-1499.795) [-1498.484] (-1498.606) * (-1495.820) [-1490.028] (-1498.153) (-1499.427) -- 0:02:24
Average standard deviation of split frequencies: 0.003136
300500 -- [-1495.472] (-1496.098) (-1496.321) (-1494.428) * (-1502.605) (-1496.600) [-1498.980] (-1503.794) -- 0:02:24
301000 -- (-1494.091) (-1494.925) [-1495.720] (-1500.814) * (-1496.229) [-1491.277] (-1501.956) (-1493.028) -- 0:02:23
301500 -- (-1494.055) (-1494.093) [-1495.069] (-1494.784) * (-1500.185) [-1494.821] (-1499.536) (-1494.320) -- 0:02:23
302000 -- (-1498.795) [-1492.872] (-1501.664) (-1499.525) * (-1489.050) [-1494.190] (-1501.118) (-1498.113) -- 0:02:25
302500 -- (-1496.990) (-1494.406) (-1499.466) [-1494.510] * (-1494.644) (-1495.352) (-1495.784) [-1494.674] -- 0:02:25
303000 -- (-1492.699) (-1498.276) [-1496.302] (-1495.400) * [-1489.674] (-1500.008) (-1497.807) (-1491.609) -- 0:02:24
303500 -- (-1500.848) [-1497.111] (-1494.820) (-1497.552) * [-1492.093] (-1505.102) (-1502.006) (-1497.273) -- 0:02:24
304000 -- (-1499.641) (-1499.920) (-1493.109) [-1507.434] * (-1493.229) (-1502.327) (-1498.693) [-1494.801] -- 0:02:24
304500 -- (-1498.058) (-1503.265) (-1501.018) [-1495.673] * (-1499.925) (-1497.804) (-1497.758) [-1496.173] -- 0:02:23
305000 -- [-1495.367] (-1496.548) (-1497.471) (-1494.459) * [-1498.484] (-1494.449) (-1504.119) (-1498.530) -- 0:02:23
Average standard deviation of split frequencies: 0.002311
305500 -- (-1497.336) (-1494.412) (-1503.557) [-1492.966] * (-1492.749) [-1498.236] (-1497.628) (-1495.615) -- 0:02:23
306000 -- (-1501.527) [-1493.502] (-1491.887) (-1501.510) * [-1491.765] (-1498.223) (-1501.680) (-1497.829) -- 0:02:22
306500 -- [-1496.149] (-1503.059) (-1493.481) (-1506.732) * (-1498.180) [-1496.889] (-1501.564) (-1499.304) -- 0:02:22
307000 -- (-1499.773) (-1499.090) [-1496.187] (-1501.346) * (-1496.757) [-1494.503] (-1492.153) (-1494.615) -- 0:02:24
307500 -- (-1496.584) (-1491.911) (-1496.290) [-1496.942] * (-1494.254) (-1500.774) (-1493.521) [-1493.945] -- 0:02:24
308000 -- [-1498.941] (-1494.253) (-1495.144) (-1504.121) * [-1493.331] (-1499.767) (-1500.235) (-1495.769) -- 0:02:23
308500 -- (-1496.347) (-1499.432) (-1495.917) [-1495.211] * (-1498.626) (-1494.259) [-1497.995] (-1494.787) -- 0:02:23
309000 -- [-1489.973] (-1491.518) (-1505.630) (-1493.359) * (-1498.004) (-1498.113) (-1498.275) [-1497.431] -- 0:02:23
309500 -- (-1497.166) [-1496.920] (-1500.604) (-1497.784) * (-1496.924) (-1496.948) (-1498.229) [-1495.750] -- 0:02:22
310000 -- (-1503.116) [-1496.240] (-1494.472) (-1506.709) * (-1495.311) (-1497.490) (-1492.826) [-1496.453] -- 0:02:22
Average standard deviation of split frequencies: 0.002276
310500 -- (-1498.640) [-1488.238] (-1499.737) (-1505.127) * (-1495.129) (-1497.598) [-1489.818] (-1498.238) -- 0:02:22
311000 -- (-1497.396) [-1498.691] (-1497.178) (-1502.656) * (-1493.470) (-1500.110) [-1492.726] (-1496.904) -- 0:02:21
311500 -- (-1495.005) (-1494.088) [-1492.710] (-1507.668) * (-1493.832) (-1494.241) (-1497.605) [-1494.833] -- 0:02:23
312000 -- (-1493.162) [-1496.990] (-1505.161) (-1503.666) * (-1503.279) (-1502.082) [-1493.395] (-1499.521) -- 0:02:23
312500 -- [-1495.199] (-1502.905) (-1496.360) (-1499.671) * (-1499.682) [-1495.595] (-1496.943) (-1498.700) -- 0:02:23
313000 -- (-1493.684) [-1501.206] (-1493.768) (-1499.562) * (-1498.223) (-1494.026) (-1494.377) [-1491.220] -- 0:02:22
313500 -- (-1492.771) (-1495.769) [-1500.212] (-1498.151) * (-1492.109) (-1495.902) [-1502.742] (-1504.727) -- 0:02:22
314000 -- (-1495.395) [-1489.793] (-1497.496) (-1499.948) * (-1500.370) (-1500.116) (-1493.500) [-1498.396] -- 0:02:22
314500 -- [-1492.714] (-1493.297) (-1496.468) (-1496.097) * (-1498.508) (-1499.065) [-1490.124] (-1504.102) -- 0:02:21
315000 -- (-1497.920) [-1498.864] (-1500.131) (-1501.470) * (-1494.057) (-1495.193) (-1498.405) [-1494.047] -- 0:02:21
Average standard deviation of split frequencies: 0.002238
315500 -- (-1494.079) (-1497.268) (-1499.166) [-1494.738] * (-1507.715) (-1494.360) (-1492.059) [-1493.176] -- 0:02:21
316000 -- (-1495.994) [-1493.345] (-1499.519) (-1498.148) * (-1506.369) (-1500.638) [-1496.905] (-1497.874) -- 0:02:20
316500 -- (-1495.532) (-1491.101) [-1492.742] (-1503.601) * (-1498.629) (-1501.066) (-1498.423) [-1494.384] -- 0:02:22
317000 -- [-1491.511] (-1492.494) (-1495.386) (-1493.331) * (-1500.401) (-1506.270) (-1496.386) [-1497.514] -- 0:02:22
317500 -- (-1494.965) [-1495.951] (-1497.732) (-1496.651) * (-1506.040) (-1503.074) [-1493.172] (-1489.339) -- 0:02:21
318000 -- [-1493.531] (-1497.579) (-1496.113) (-1496.541) * (-1501.957) (-1503.740) [-1492.853] (-1494.296) -- 0:02:21
318500 -- (-1494.817) (-1500.690) [-1497.683] (-1494.318) * (-1498.411) [-1497.151] (-1493.641) (-1494.282) -- 0:02:21
319000 -- [-1496.064] (-1496.834) (-1496.820) (-1496.586) * (-1500.066) [-1501.456] (-1494.432) (-1495.620) -- 0:02:20
319500 -- [-1497.587] (-1499.516) (-1499.840) (-1494.287) * (-1497.564) (-1498.941) [-1490.645] (-1497.904) -- 0:02:20
320000 -- (-1498.912) (-1504.177) [-1494.713] (-1495.446) * (-1500.185) (-1498.114) [-1499.125] (-1500.175) -- 0:02:20
Average standard deviation of split frequencies: 0.002205
320500 -- [-1498.021] (-1492.370) (-1501.188) (-1495.997) * (-1500.733) [-1489.730] (-1495.604) (-1495.137) -- 0:02:19
321000 -- (-1494.563) (-1491.970) (-1496.237) [-1499.295] * (-1500.538) [-1493.704] (-1500.979) (-1498.591) -- 0:02:21
321500 -- (-1504.547) (-1493.964) [-1500.502] (-1501.191) * (-1500.605) (-1502.424) (-1499.379) [-1495.555] -- 0:02:21
322000 -- (-1498.565) [-1490.311] (-1501.689) (-1494.885) * (-1495.958) (-1494.702) [-1495.242] (-1500.043) -- 0:02:21
322500 -- (-1495.820) (-1498.750) [-1500.541] (-1494.780) * (-1495.679) (-1496.486) [-1495.784] (-1500.240) -- 0:02:20
323000 -- (-1498.010) [-1500.158] (-1498.504) (-1499.823) * (-1492.797) (-1503.495) [-1497.925] (-1496.146) -- 0:02:20
323500 -- (-1496.657) (-1494.732) (-1503.864) [-1493.731] * (-1496.709) (-1514.080) (-1496.381) [-1499.265] -- 0:02:20
324000 -- (-1501.755) (-1490.849) [-1493.109] (-1493.246) * (-1498.874) (-1500.042) [-1489.865] (-1497.635) -- 0:02:19
324500 -- (-1492.149) [-1495.166] (-1494.978) (-1494.038) * [-1491.884] (-1495.453) (-1495.935) (-1501.171) -- 0:02:19
325000 -- (-1494.813) (-1491.584) [-1498.573] (-1496.640) * (-1497.410) (-1500.009) [-1491.840] (-1500.447) -- 0:02:19
Average standard deviation of split frequencies: 0.002169
325500 -- (-1502.511) [-1491.698] (-1497.950) (-1493.540) * [-1493.673] (-1494.570) (-1501.853) (-1497.613) -- 0:02:18
326000 -- (-1495.660) (-1497.423) (-1499.643) [-1498.589] * (-1493.155) (-1492.692) [-1491.117] (-1499.372) -- 0:02:20
326500 -- (-1494.272) [-1496.992] (-1495.042) (-1498.748) * (-1490.943) (-1497.438) (-1499.534) [-1497.960] -- 0:02:20
327000 -- [-1493.671] (-1498.003) (-1492.066) (-1490.690) * [-1495.672] (-1498.396) (-1495.881) (-1497.617) -- 0:02:19
327500 -- (-1494.613) [-1496.683] (-1498.154) (-1492.324) * (-1499.679) [-1490.805] (-1491.112) (-1494.741) -- 0:02:19
328000 -- (-1497.198) [-1493.205] (-1501.012) (-1497.181) * (-1492.730) (-1491.939) [-1496.694] (-1498.842) -- 0:02:19
328500 -- [-1492.962] (-1495.447) (-1494.540) (-1494.903) * (-1497.168) [-1495.124] (-1492.200) (-1501.867) -- 0:02:19
329000 -- (-1494.733) [-1495.971] (-1494.172) (-1493.628) * (-1492.041) (-1496.279) (-1492.385) [-1496.570] -- 0:02:18
329500 -- (-1492.162) [-1495.182] (-1496.415) (-1493.358) * [-1490.936] (-1498.760) (-1501.236) (-1502.404) -- 0:02:18
330000 -- (-1492.435) (-1495.389) [-1495.455] (-1500.611) * (-1494.629) (-1493.098) [-1496.658] (-1498.795) -- 0:02:18
Average standard deviation of split frequencies: 0.002138
330500 -- (-1499.626) [-1497.691] (-1495.094) (-1496.199) * (-1502.849) [-1495.331] (-1504.618) (-1501.692) -- 0:02:17
331000 -- (-1500.111) [-1497.311] (-1499.516) (-1498.085) * (-1502.688) [-1493.902] (-1498.288) (-1495.697) -- 0:02:19
331500 -- (-1495.319) (-1494.978) (-1494.889) [-1494.649] * (-1500.991) (-1494.896) (-1496.505) [-1497.376] -- 0:02:19
332000 -- [-1493.918] (-1494.085) (-1501.038) (-1494.123) * (-1498.189) (-1496.369) [-1493.460] (-1494.682) -- 0:02:18
332500 -- (-1495.290) (-1494.715) (-1495.604) [-1495.647] * [-1496.014] (-1497.427) (-1495.487) (-1496.408) -- 0:02:18
333000 -- (-1496.852) (-1496.522) [-1492.349] (-1499.327) * [-1496.956] (-1499.255) (-1493.646) (-1496.107) -- 0:02:18
333500 -- (-1500.282) [-1492.185] (-1495.748) (-1497.191) * (-1501.054) (-1497.160) [-1494.381] (-1500.903) -- 0:02:17
334000 -- [-1493.548] (-1494.263) (-1495.074) (-1497.501) * (-1497.586) (-1497.606) [-1491.515] (-1499.152) -- 0:02:17
334500 -- (-1494.155) [-1493.723] (-1497.120) (-1501.794) * [-1498.515] (-1497.765) (-1493.433) (-1503.585) -- 0:02:17
335000 -- (-1497.610) [-1496.664] (-1496.382) (-1496.898) * (-1495.344) [-1495.574] (-1493.273) (-1499.326) -- 0:02:16
Average standard deviation of split frequencies: 0.002104
335500 -- (-1498.279) (-1496.265) (-1497.497) [-1493.217] * (-1494.851) (-1498.292) [-1494.581] (-1490.121) -- 0:02:18
336000 -- [-1498.672] (-1502.300) (-1501.250) (-1499.321) * [-1498.986] (-1494.880) (-1496.575) (-1491.617) -- 0:02:18
336500 -- (-1499.131) (-1503.938) [-1495.403] (-1496.317) * (-1494.822) [-1494.367] (-1500.972) (-1495.646) -- 0:02:18
337000 -- [-1495.205] (-1496.757) (-1497.100) (-1502.172) * (-1492.761) (-1495.386) (-1494.248) [-1498.074] -- 0:02:17
337500 -- (-1500.227) (-1502.205) [-1499.164] (-1493.956) * (-1490.996) (-1495.516) [-1493.004] (-1497.721) -- 0:02:17
338000 -- (-1498.265) [-1497.032] (-1504.020) (-1500.717) * (-1497.336) (-1493.868) [-1495.384] (-1503.701) -- 0:02:17
338500 -- (-1497.479) (-1495.524) (-1492.545) [-1496.472] * [-1494.805] (-1499.321) (-1493.229) (-1506.791) -- 0:02:16
339000 -- [-1493.915] (-1495.223) (-1499.654) (-1494.091) * (-1496.154) (-1495.029) [-1497.182] (-1497.873) -- 0:02:16
339500 -- (-1498.926) (-1499.719) [-1499.108] (-1492.388) * (-1496.400) [-1502.404] (-1497.485) (-1502.668) -- 0:02:16
340000 -- [-1496.273] (-1495.388) (-1508.825) (-1498.816) * (-1498.204) (-1503.193) (-1503.967) [-1493.371] -- 0:02:15
Average standard deviation of split frequencies: 0.001384
340500 -- (-1501.146) (-1494.932) (-1496.570) [-1493.221] * (-1496.990) [-1492.524] (-1498.644) (-1493.649) -- 0:02:17
341000 -- (-1500.365) (-1495.089) (-1501.638) [-1493.448] * (-1502.417) (-1495.880) (-1492.045) [-1493.520] -- 0:02:17
341500 -- (-1497.980) (-1499.394) [-1500.192] (-1499.265) * (-1498.971) (-1496.516) [-1491.349] (-1501.591) -- 0:02:16
342000 -- (-1496.156) (-1495.851) [-1498.121] (-1500.151) * (-1504.508) (-1494.358) [-1501.811] (-1497.722) -- 0:02:16
342500 -- (-1504.115) [-1495.168] (-1500.084) (-1492.181) * (-1497.334) (-1495.036) [-1498.515] (-1498.421) -- 0:02:16
343000 -- (-1498.261) (-1497.429) (-1497.618) [-1492.267] * (-1499.765) [-1493.762] (-1495.138) (-1498.024) -- 0:02:15
343500 -- (-1497.451) (-1499.760) [-1496.233] (-1490.272) * [-1495.220] (-1495.308) (-1494.601) (-1498.123) -- 0:02:15
344000 -- (-1497.483) (-1497.076) (-1496.771) [-1501.465] * (-1496.417) (-1493.290) (-1493.805) [-1495.661] -- 0:02:15
344500 -- (-1504.816) (-1508.136) [-1499.748] (-1494.533) * (-1499.655) (-1495.729) [-1498.456] (-1495.150) -- 0:02:15
345000 -- [-1501.241] (-1506.959) (-1494.839) (-1500.565) * (-1502.716) (-1496.700) (-1495.043) [-1497.402] -- 0:02:14
Average standard deviation of split frequencies: 0.001362
345500 -- (-1502.254) (-1507.466) (-1501.852) [-1496.231] * [-1505.246] (-1496.413) (-1495.326) (-1497.508) -- 0:02:16
346000 -- (-1491.523) (-1500.213) (-1493.855) [-1494.165] * [-1493.494] (-1491.830) (-1498.888) (-1500.182) -- 0:02:16
346500 -- (-1492.074) [-1493.173] (-1493.212) (-1498.517) * (-1498.617) [-1492.311] (-1497.967) (-1501.794) -- 0:02:15
347000 -- (-1493.255) [-1497.733] (-1493.700) (-1505.358) * (-1497.717) (-1494.478) (-1506.968) [-1497.056] -- 0:02:15
347500 -- (-1492.811) (-1502.668) [-1494.277] (-1503.217) * (-1502.146) [-1490.078] (-1493.181) (-1499.845) -- 0:02:15
348000 -- (-1491.565) [-1498.290] (-1508.656) (-1496.489) * (-1503.996) (-1498.592) [-1496.149] (-1494.332) -- 0:02:14
348500 -- (-1502.111) (-1490.181) [-1491.522] (-1493.077) * (-1502.828) (-1503.974) (-1493.456) [-1493.894] -- 0:02:14
349000 -- (-1500.387) (-1493.645) (-1509.027) [-1498.725] * (-1497.428) [-1496.565] (-1493.843) (-1492.327) -- 0:02:14
349500 -- (-1495.300) (-1491.565) (-1496.908) [-1494.441] * (-1493.110) (-1493.207) [-1496.874] (-1496.861) -- 0:02:14
350000 -- (-1495.190) [-1500.763] (-1498.882) (-1496.599) * (-1498.346) (-1493.415) (-1493.472) [-1494.628] -- 0:02:15
Average standard deviation of split frequencies: 0.001344
350500 -- (-1495.104) (-1497.193) [-1494.917] (-1499.206) * (-1494.422) (-1495.890) [-1490.250] (-1499.168) -- 0:02:15
351000 -- (-1497.913) (-1500.553) [-1500.091] (-1507.074) * [-1499.016] (-1497.615) (-1496.706) (-1501.701) -- 0:02:14
351500 -- (-1500.526) (-1502.366) (-1493.806) [-1502.301] * (-1495.579) [-1499.301] (-1502.297) (-1508.389) -- 0:02:14
352000 -- (-1498.833) (-1505.657) (-1495.724) [-1504.278] * (-1495.361) [-1496.971] (-1508.484) (-1497.640) -- 0:02:14
352500 -- (-1495.555) [-1498.935] (-1494.655) (-1497.282) * (-1499.671) [-1496.200] (-1498.997) (-1493.430) -- 0:02:14
353000 -- (-1495.386) [-1494.067] (-1497.733) (-1501.010) * (-1498.344) [-1496.626] (-1503.747) (-1498.725) -- 0:02:13
353500 -- (-1499.856) (-1504.513) (-1499.380) [-1494.519] * (-1493.404) (-1502.573) (-1507.045) [-1501.887] -- 0:02:13
354000 -- (-1503.572) [-1498.544] (-1496.906) (-1494.957) * (-1498.589) [-1498.914] (-1505.129) (-1498.908) -- 0:02:13
354500 -- (-1505.807) (-1492.419) (-1499.985) [-1507.295] * (-1497.094) (-1500.289) (-1499.746) [-1499.601] -- 0:02:12
355000 -- (-1496.078) (-1495.913) [-1495.612] (-1500.558) * (-1497.587) (-1498.527) [-1493.381] (-1492.285) -- 0:02:14
Average standard deviation of split frequencies: 0.001324
355500 -- (-1501.900) [-1494.010] (-1498.935) (-1497.740) * (-1496.269) [-1493.877] (-1502.520) (-1492.596) -- 0:02:14
356000 -- (-1506.073) (-1503.439) [-1501.509] (-1496.986) * [-1493.591] (-1491.495) (-1496.611) (-1502.949) -- 0:02:13
356500 -- (-1497.129) (-1493.222) [-1496.860] (-1499.562) * (-1493.512) (-1500.516) [-1492.084] (-1501.951) -- 0:02:13
357000 -- (-1497.839) (-1497.991) (-1490.823) [-1491.738] * [-1492.862] (-1500.886) (-1500.301) (-1506.535) -- 0:02:13
357500 -- (-1496.988) [-1500.146] (-1500.709) (-1494.663) * [-1495.081] (-1499.617) (-1495.505) (-1499.966) -- 0:02:12
358000 -- (-1496.860) [-1493.458] (-1491.369) (-1495.148) * (-1497.899) (-1492.598) [-1491.526] (-1493.267) -- 0:02:12
358500 -- (-1503.629) (-1504.140) (-1492.231) [-1495.359] * (-1499.509) (-1503.083) [-1496.891] (-1496.149) -- 0:02:12
359000 -- (-1496.905) [-1495.637] (-1498.280) (-1492.839) * (-1500.754) (-1501.156) [-1493.382] (-1494.767) -- 0:02:12
359500 -- (-1498.710) (-1493.586) [-1496.017] (-1497.347) * (-1510.707) (-1503.416) (-1494.031) [-1494.107] -- 0:02:11
360000 -- (-1499.176) [-1493.374] (-1494.461) (-1492.701) * (-1502.736) (-1500.232) [-1506.555] (-1495.627) -- 0:02:13
Average standard deviation of split frequencies: 0.001307
360500 -- (-1497.965) (-1495.318) [-1501.838] (-1492.135) * [-1501.538] (-1496.966) (-1502.080) (-1496.270) -- 0:02:13
361000 -- (-1500.805) [-1496.520] (-1499.072) (-1493.508) * (-1494.601) [-1499.255] (-1507.919) (-1491.868) -- 0:02:12
361500 -- (-1496.697) (-1495.751) [-1499.235] (-1490.875) * (-1499.394) (-1503.759) (-1501.839) [-1492.848] -- 0:02:12
362000 -- [-1493.169] (-1499.353) (-1499.737) (-1495.327) * [-1492.321] (-1494.859) (-1500.712) (-1495.837) -- 0:02:12
362500 -- [-1495.908] (-1491.575) (-1493.972) (-1495.977) * (-1492.483) (-1496.317) (-1501.716) [-1497.973] -- 0:02:11
363000 -- (-1496.525) (-1494.307) [-1495.601] (-1491.913) * (-1491.282) (-1493.006) [-1499.441] (-1500.257) -- 0:02:11
363500 -- [-1491.491] (-1496.705) (-1497.363) (-1503.032) * (-1494.708) [-1497.174] (-1496.156) (-1503.557) -- 0:02:11
364000 -- [-1490.810] (-1492.707) (-1502.354) (-1497.037) * [-1495.053] (-1498.286) (-1497.524) (-1506.660) -- 0:02:11
364500 -- (-1501.698) [-1493.381] (-1501.540) (-1496.420) * [-1491.620] (-1504.009) (-1496.443) (-1503.729) -- 0:02:12
365000 -- (-1491.934) (-1494.148) (-1502.971) [-1496.617] * [-1493.849] (-1499.898) (-1497.056) (-1493.915) -- 0:02:12
Average standard deviation of split frequencies: 0.001288
365500 -- (-1496.124) (-1500.768) (-1492.282) [-1494.880] * [-1508.242] (-1500.230) (-1497.671) (-1500.756) -- 0:02:11
366000 -- (-1509.369) (-1497.603) (-1496.969) [-1502.057] * [-1492.604] (-1494.170) (-1496.456) (-1494.820) -- 0:02:11
366500 -- (-1507.710) (-1499.635) [-1493.523] (-1499.404) * [-1498.218] (-1494.476) (-1495.482) (-1504.606) -- 0:02:11
367000 -- (-1498.143) (-1499.332) [-1496.149] (-1495.980) * (-1497.384) [-1493.561] (-1491.141) (-1500.904) -- 0:02:11
367500 -- (-1492.314) (-1493.544) [-1496.265] (-1490.403) * (-1499.520) (-1493.854) [-1490.289] (-1497.876) -- 0:02:10
368000 -- [-1490.278] (-1498.811) (-1495.995) (-1499.092) * [-1498.095] (-1494.120) (-1498.453) (-1495.708) -- 0:02:10
368500 -- (-1492.180) (-1496.672) [-1493.522] (-1496.513) * (-1497.826) (-1495.558) [-1501.655] (-1498.379) -- 0:02:10
369000 -- (-1489.544) (-1495.832) (-1493.054) [-1495.949] * [-1494.622] (-1501.903) (-1497.144) (-1500.610) -- 0:02:09
369500 -- (-1502.498) [-1493.296] (-1493.182) (-1496.370) * [-1494.049] (-1495.542) (-1490.930) (-1495.338) -- 0:02:11
370000 -- [-1496.433] (-1494.707) (-1493.712) (-1506.097) * (-1494.082) (-1498.016) [-1495.283] (-1493.633) -- 0:02:11
Average standard deviation of split frequencies: 0.001272
370500 -- (-1493.541) [-1497.663] (-1496.968) (-1495.246) * (-1503.997) (-1499.229) [-1498.654] (-1496.341) -- 0:02:10
371000 -- [-1494.321] (-1492.422) (-1490.965) (-1497.547) * (-1496.149) (-1498.255) (-1491.799) [-1500.968] -- 0:02:10
371500 -- (-1491.116) (-1500.075) [-1495.031] (-1508.113) * (-1496.360) [-1500.264] (-1496.894) (-1501.342) -- 0:02:10
372000 -- [-1495.541] (-1501.078) (-1496.896) (-1503.434) * (-1496.599) [-1494.476] (-1491.432) (-1501.661) -- 0:02:09
372500 -- (-1496.750) (-1498.539) [-1494.924] (-1499.255) * (-1496.648) (-1497.869) (-1492.215) [-1496.904] -- 0:02:09
373000 -- [-1492.849] (-1502.274) (-1513.020) (-1498.835) * (-1493.643) (-1495.105) (-1497.768) [-1493.938] -- 0:02:09
373500 -- (-1494.380) (-1509.315) [-1495.081] (-1500.343) * [-1497.371] (-1496.404) (-1496.934) (-1494.456) -- 0:02:09
374000 -- (-1493.968) (-1499.567) [-1491.712] (-1506.106) * (-1497.510) (-1496.153) [-1500.993] (-1493.240) -- 0:02:08
374500 -- (-1502.717) (-1498.940) [-1488.874] (-1498.215) * (-1501.190) (-1495.410) [-1501.209] (-1495.263) -- 0:02:10
375000 -- [-1493.296] (-1489.990) (-1494.482) (-1495.379) * (-1497.898) [-1499.449] (-1495.076) (-1494.572) -- 0:02:10
Average standard deviation of split frequencies: 0.001254
375500 -- (-1493.216) (-1492.823) [-1497.079] (-1498.292) * (-1493.645) (-1496.527) [-1495.007] (-1492.956) -- 0:02:09
376000 -- (-1508.285) (-1494.219) (-1501.370) [-1497.076] * (-1491.521) (-1497.353) [-1494.496] (-1501.215) -- 0:02:09
376500 -- (-1494.288) [-1490.438] (-1495.796) (-1497.848) * [-1495.163] (-1501.634) (-1499.363) (-1495.266) -- 0:02:09
377000 -- (-1502.576) (-1500.659) [-1504.587] (-1496.460) * (-1496.718) (-1499.688) (-1497.743) [-1496.140] -- 0:02:08
377500 -- (-1500.442) [-1500.286] (-1496.998) (-1496.067) * (-1503.188) (-1495.497) (-1496.600) [-1502.092] -- 0:02:08
378000 -- [-1499.348] (-1500.299) (-1494.356) (-1492.990) * (-1495.890) [-1494.344] (-1493.516) (-1492.105) -- 0:02:08
378500 -- [-1493.884] (-1503.300) (-1501.340) (-1493.654) * (-1494.609) (-1491.514) (-1494.289) [-1498.051] -- 0:02:08
379000 -- (-1503.307) [-1497.115] (-1490.925) (-1498.269) * (-1503.398) (-1496.945) [-1496.856] (-1500.512) -- 0:02:09
379500 -- (-1498.916) (-1491.879) (-1495.085) [-1499.514] * (-1494.390) (-1497.642) [-1493.325] (-1494.473) -- 0:02:09
380000 -- (-1500.332) (-1494.403) [-1496.300] (-1496.882) * [-1496.432] (-1494.792) (-1498.784) (-1497.655) -- 0:02:08
Average standard deviation of split frequencies: 0.001238
380500 -- [-1496.171] (-1494.152) (-1496.874) (-1497.982) * (-1494.571) [-1494.940] (-1496.771) (-1505.757) -- 0:02:08
381000 -- (-1499.050) (-1496.928) (-1497.996) [-1496.032] * [-1497.970] (-1498.845) (-1494.581) (-1498.402) -- 0:02:08
381500 -- (-1498.242) (-1499.782) (-1494.283) [-1495.504] * (-1499.525) (-1498.435) (-1495.628) [-1494.906] -- 0:02:08
382000 -- (-1494.201) [-1494.460] (-1495.224) (-1497.218) * (-1497.771) [-1490.615] (-1507.799) (-1493.124) -- 0:02:07
382500 -- (-1491.586) (-1492.694) [-1497.566] (-1501.986) * (-1499.632) [-1494.061] (-1500.871) (-1493.402) -- 0:02:07
383000 -- (-1495.965) [-1497.569] (-1497.385) (-1499.408) * (-1499.861) [-1494.420] (-1493.989) (-1497.846) -- 0:02:07
383500 -- [-1494.622] (-1495.320) (-1496.058) (-1496.799) * (-1500.084) [-1498.581] (-1499.547) (-1499.579) -- 0:02:06
384000 -- (-1494.180) (-1493.870) [-1493.232] (-1497.034) * (-1492.440) (-1497.500) (-1496.521) [-1494.221] -- 0:02:08
384500 -- [-1491.638] (-1497.646) (-1505.771) (-1501.739) * (-1494.744) [-1492.990] (-1500.340) (-1497.372) -- 0:02:08
385000 -- (-1501.179) [-1500.847] (-1501.462) (-1504.400) * (-1500.219) (-1494.540) (-1500.916) [-1495.777] -- 0:02:07
Average standard deviation of split frequencies: 0.001221
385500 -- (-1502.323) (-1495.214) [-1495.551] (-1498.643) * [-1502.829] (-1496.944) (-1497.867) (-1493.500) -- 0:02:07
386000 -- (-1501.120) (-1492.891) [-1494.385] (-1500.417) * (-1506.133) [-1495.762] (-1495.821) (-1494.207) -- 0:02:07
386500 -- (-1498.084) (-1495.629) (-1490.905) [-1497.508] * (-1497.604) (-1499.041) [-1493.778] (-1498.086) -- 0:02:06
387000 -- (-1499.185) (-1497.618) (-1494.959) [-1495.071] * (-1492.981) (-1499.184) [-1498.173] (-1499.874) -- 0:02:06
387500 -- (-1496.792) (-1494.155) [-1494.329] (-1500.254) * [-1494.406] (-1502.414) (-1499.039) (-1498.923) -- 0:02:06
388000 -- (-1494.596) (-1492.729) (-1492.835) [-1498.390] * [-1492.630] (-1494.497) (-1500.054) (-1495.594) -- 0:02:06
388500 -- (-1495.182) [-1497.458] (-1503.398) (-1495.513) * (-1494.447) (-1497.408) [-1498.782] (-1500.093) -- 0:02:05
389000 -- (-1495.231) (-1499.351) [-1496.987] (-1493.715) * (-1499.537) [-1497.273] (-1497.454) (-1494.447) -- 0:02:07
389500 -- (-1495.347) (-1494.354) [-1491.277] (-1492.751) * (-1498.221) (-1502.258) [-1497.006] (-1498.854) -- 0:02:06
390000 -- [-1497.389] (-1495.940) (-1494.412) (-1496.798) * [-1501.258] (-1494.383) (-1495.682) (-1491.955) -- 0:02:06
Average standard deviation of split frequencies: 0.001207
390500 -- [-1496.551] (-1495.640) (-1495.735) (-1495.284) * (-1492.742) [-1493.579] (-1493.849) (-1497.696) -- 0:02:06
391000 -- [-1497.952] (-1499.235) (-1493.958) (-1501.911) * (-1496.742) (-1495.141) [-1495.030] (-1500.386) -- 0:02:06
391500 -- [-1496.916] (-1502.885) (-1495.975) (-1502.494) * (-1499.194) [-1495.018] (-1494.820) (-1504.779) -- 0:02:05
392000 -- (-1497.937) [-1499.870] (-1493.244) (-1500.339) * (-1494.379) (-1496.885) [-1498.111] (-1496.237) -- 0:02:05
392500 -- (-1490.479) (-1500.262) [-1493.974] (-1494.512) * (-1502.952) [-1494.005] (-1495.676) (-1496.008) -- 0:02:05
393000 -- (-1496.061) [-1498.735] (-1494.827) (-1496.314) * [-1497.144] (-1494.036) (-1492.691) (-1499.789) -- 0:02:05
393500 -- (-1495.554) [-1490.294] (-1498.408) (-1491.616) * (-1500.839) (-1496.611) [-1496.063] (-1497.230) -- 0:02:06
394000 -- [-1497.242] (-1492.548) (-1498.314) (-1503.916) * (-1494.567) (-1494.119) [-1495.342] (-1496.701) -- 0:02:06
394500 -- (-1498.374) (-1498.512) (-1491.339) [-1496.725] * (-1492.467) (-1501.935) (-1495.210) [-1491.425] -- 0:02:05
395000 -- [-1499.228] (-1506.686) (-1491.702) (-1496.670) * (-1501.567) [-1498.622] (-1494.566) (-1500.175) -- 0:02:05
Average standard deviation of split frequencies: 0.001190
395500 -- [-1492.609] (-1499.673) (-1491.472) (-1497.774) * (-1498.502) (-1494.629) (-1497.803) [-1498.958] -- 0:02:05
396000 -- (-1492.272) (-1496.365) [-1499.654] (-1496.611) * (-1494.157) (-1510.614) [-1492.207] (-1497.113) -- 0:02:05
396500 -- (-1491.412) (-1496.515) (-1497.952) [-1500.489] * (-1500.123) [-1494.846] (-1491.385) (-1493.485) -- 0:02:04
397000 -- [-1498.212] (-1497.514) (-1502.111) (-1506.049) * (-1492.515) (-1494.828) [-1498.445] (-1496.374) -- 0:02:04
397500 -- (-1501.597) (-1498.371) (-1497.710) [-1495.120] * (-1493.017) [-1501.227] (-1497.140) (-1492.260) -- 0:02:04
398000 -- [-1495.537] (-1497.713) (-1505.752) (-1495.516) * [-1503.625] (-1505.164) (-1494.772) (-1491.736) -- 0:02:04
398500 -- [-1495.390] (-1498.702) (-1505.204) (-1498.585) * (-1497.562) (-1495.103) [-1491.160] (-1495.339) -- 0:02:05
399000 -- (-1496.178) (-1498.158) (-1494.646) [-1501.382] * (-1494.117) (-1495.598) [-1500.747] (-1489.396) -- 0:02:05
399500 -- (-1499.382) (-1491.802) [-1492.079] (-1497.831) * (-1495.444) (-1493.334) (-1493.987) [-1495.711] -- 0:02:04
400000 -- [-1506.247] (-1497.391) (-1495.406) (-1498.519) * (-1494.201) (-1492.324) (-1496.299) [-1497.089] -- 0:02:04
Average standard deviation of split frequencies: 0.001765
400500 -- (-1496.627) (-1498.337) [-1496.076] (-1499.918) * (-1503.834) [-1493.196] (-1500.813) (-1496.361) -- 0:02:04
401000 -- [-1500.994] (-1495.316) (-1495.176) (-1496.987) * (-1497.009) (-1492.988) (-1503.874) [-1496.036] -- 0:02:03
401500 -- [-1498.571] (-1495.376) (-1508.766) (-1494.921) * (-1496.362) (-1492.139) [-1495.309] (-1492.517) -- 0:02:03
402000 -- (-1497.941) [-1498.310] (-1493.419) (-1501.791) * (-1497.855) (-1492.347) [-1491.019] (-1500.548) -- 0:02:03
402500 -- (-1506.134) (-1506.289) [-1496.738] (-1500.600) * (-1493.559) (-1488.271) (-1497.404) [-1495.533] -- 0:02:03
403000 -- (-1496.201) [-1504.753] (-1503.108) (-1492.813) * (-1495.536) (-1490.580) [-1494.294] (-1492.321) -- 0:02:02
403500 -- (-1498.099) (-1506.693) (-1494.236) [-1491.928] * (-1494.773) [-1491.242] (-1498.233) (-1495.541) -- 0:02:04
404000 -- (-1497.245) [-1494.017] (-1501.871) (-1495.427) * (-1493.633) (-1492.172) (-1496.006) [-1495.923] -- 0:02:03
404500 -- (-1491.697) [-1492.908] (-1494.954) (-1496.009) * [-1500.755] (-1493.907) (-1498.334) (-1498.095) -- 0:02:03
405000 -- [-1499.850] (-1502.102) (-1499.227) (-1495.849) * (-1495.999) (-1497.899) [-1494.393] (-1497.084) -- 0:02:03
Average standard deviation of split frequencies: 0.001742
405500 -- (-1494.695) (-1492.932) (-1496.834) [-1495.017] * (-1493.702) [-1495.710] (-1499.915) (-1495.510) -- 0:02:03
406000 -- (-1498.629) [-1495.585] (-1495.486) (-1495.128) * [-1494.628] (-1492.590) (-1495.999) (-1490.700) -- 0:02:02
406500 -- (-1501.286) (-1494.120) [-1495.348] (-1493.391) * [-1496.541] (-1494.566) (-1498.844) (-1497.572) -- 0:02:02
407000 -- [-1496.938] (-1493.311) (-1499.603) (-1495.884) * (-1499.851) [-1490.816] (-1498.708) (-1496.310) -- 0:02:02
407500 -- (-1488.995) (-1493.877) (-1494.061) [-1491.433] * (-1500.142) (-1491.764) (-1501.964) [-1494.771] -- 0:02:02
408000 -- [-1493.741] (-1493.208) (-1499.837) (-1491.733) * (-1497.602) (-1498.966) (-1498.994) [-1498.390] -- 0:02:03
408500 -- (-1499.914) (-1498.955) [-1498.236] (-1492.830) * (-1524.165) [-1494.306] (-1495.977) (-1498.647) -- 0:02:03
409000 -- (-1497.967) (-1502.362) [-1490.880] (-1500.266) * (-1500.719) [-1495.929] (-1501.259) (-1495.012) -- 0:02:02
409500 -- [-1496.219] (-1494.692) (-1491.788) (-1496.081) * [-1493.032] (-1494.666) (-1496.606) (-1505.567) -- 0:02:02
410000 -- (-1495.710) [-1492.165] (-1496.605) (-1490.647) * [-1495.820] (-1499.374) (-1500.249) (-1496.395) -- 0:02:02
Average standard deviation of split frequencies: 0.001722
410500 -- [-1491.999] (-1494.674) (-1494.396) (-1494.020) * (-1510.362) (-1498.208) (-1497.112) [-1493.603] -- 0:02:02
411000 -- (-1500.067) (-1499.288) [-1492.051] (-1495.868) * [-1493.856] (-1494.452) (-1497.764) (-1496.345) -- 0:02:01
411500 -- (-1494.721) (-1493.828) (-1493.233) [-1500.015] * (-1493.187) [-1495.076] (-1501.513) (-1497.904) -- 0:02:01
412000 -- [-1494.532] (-1491.090) (-1498.702) (-1493.169) * (-1497.669) [-1496.324] (-1498.224) (-1497.085) -- 0:02:01
412500 -- (-1502.877) (-1493.627) (-1496.785) [-1499.763] * (-1491.798) (-1493.816) (-1493.930) [-1494.302] -- 0:02:01
413000 -- (-1502.070) [-1492.979] (-1497.488) (-1498.737) * (-1494.910) [-1504.292] (-1496.598) (-1495.234) -- 0:02:02
413500 -- (-1498.928) (-1493.006) [-1502.698] (-1505.376) * (-1494.145) [-1496.711] (-1493.233) (-1496.911) -- 0:02:01
414000 -- (-1496.026) (-1503.635) [-1492.396] (-1499.025) * (-1494.103) (-1499.339) [-1490.838] (-1493.948) -- 0:02:01
414500 -- (-1493.009) [-1491.707] (-1495.953) (-1498.324) * (-1494.855) (-1495.450) [-1506.907] (-1500.463) -- 0:02:01
415000 -- (-1499.227) [-1492.950] (-1494.984) (-1497.659) * (-1495.368) [-1495.005] (-1496.445) (-1497.885) -- 0:02:01
Average standard deviation of split frequencies: 0.001700
415500 -- (-1503.843) (-1499.641) [-1496.790] (-1494.292) * (-1494.071) [-1505.592] (-1492.640) (-1492.976) -- 0:02:00
416000 -- [-1492.636] (-1504.686) (-1496.803) (-1490.277) * (-1501.057) (-1503.831) (-1498.467) [-1495.611] -- 0:02:00
416500 -- (-1493.608) [-1493.346] (-1493.682) (-1491.003) * (-1495.370) (-1498.661) (-1489.445) [-1497.939] -- 0:02:00
417000 -- [-1491.992] (-1496.564) (-1492.965) (-1498.044) * (-1503.887) (-1496.867) [-1493.193] (-1498.801) -- 0:02:00
417500 -- (-1499.153) (-1503.458) (-1497.071) [-1494.202] * (-1497.515) (-1499.694) [-1493.851] (-1507.181) -- 0:01:59
418000 -- (-1493.249) (-1493.624) (-1504.481) [-1499.637] * (-1506.834) [-1497.861] (-1492.695) (-1498.645) -- 0:02:01
418500 -- (-1492.559) [-1495.537] (-1499.155) (-1500.315) * [-1503.367] (-1499.755) (-1497.228) (-1504.736) -- 0:02:00
419000 -- [-1493.685] (-1503.279) (-1499.721) (-1501.054) * (-1505.463) (-1492.474) (-1501.056) [-1492.806] -- 0:02:00
419500 -- [-1496.954] (-1498.249) (-1499.221) (-1498.532) * (-1498.834) (-1500.912) [-1495.198] (-1495.301) -- 0:02:00
420000 -- [-1497.283] (-1496.146) (-1498.755) (-1491.362) * [-1497.642] (-1498.210) (-1499.837) (-1491.231) -- 0:02:00
Average standard deviation of split frequencies: 0.001681
420500 -- (-1500.972) [-1498.382] (-1497.944) (-1496.277) * (-1501.828) (-1497.390) [-1501.176] (-1497.496) -- 0:01:59
421000 -- [-1496.151] (-1503.941) (-1504.118) (-1496.360) * [-1499.760] (-1495.478) (-1503.702) (-1503.244) -- 0:01:59
421500 -- [-1497.193] (-1498.598) (-1498.614) (-1493.459) * (-1503.551) (-1493.544) (-1499.238) [-1497.412] -- 0:01:59
422000 -- (-1496.551) (-1494.487) (-1497.869) [-1490.825] * [-1496.732] (-1505.390) (-1497.474) (-1501.803) -- 0:01:59
422500 -- [-1497.923] (-1494.765) (-1497.498) (-1498.487) * [-1495.208] (-1501.846) (-1496.732) (-1496.651) -- 0:02:00
423000 -- (-1495.182) (-1499.351) (-1499.983) [-1497.629] * (-1490.599) [-1499.132] (-1492.975) (-1494.491) -- 0:02:00
423500 -- (-1492.558) (-1499.737) [-1494.395] (-1494.490) * (-1496.547) (-1497.787) (-1506.261) [-1492.894] -- 0:01:59
424000 -- (-1506.674) [-1498.739] (-1495.357) (-1491.750) * (-1494.752) (-1492.471) [-1495.185] (-1496.921) -- 0:01:59
424500 -- [-1494.998] (-1495.560) (-1490.932) (-1499.665) * (-1493.004) [-1492.766] (-1499.324) (-1493.095) -- 0:01:59
425000 -- (-1496.470) (-1490.584) [-1495.829] (-1495.789) * (-1495.981) [-1501.378] (-1499.859) (-1495.280) -- 0:01:59
Average standard deviation of split frequencies: 0.001660
425500 -- (-1501.213) (-1491.793) [-1492.211] (-1498.514) * (-1495.454) [-1492.554] (-1493.689) (-1501.793) -- 0:01:58
426000 -- (-1495.392) [-1494.540] (-1495.884) (-1492.608) * (-1497.189) (-1489.131) [-1496.048] (-1498.696) -- 0:01:58
426500 -- (-1496.385) (-1500.034) [-1494.488] (-1496.492) * (-1499.234) (-1496.095) [-1497.138] (-1501.235) -- 0:01:58
427000 -- (-1506.131) [-1495.325] (-1496.409) (-1492.170) * (-1489.967) (-1495.426) (-1498.612) [-1500.282] -- 0:01:58
427500 -- (-1495.688) [-1498.556] (-1496.502) (-1501.857) * (-1500.981) (-1499.988) [-1491.709] (-1499.260) -- 0:01:59
428000 -- [-1498.241] (-1494.436) (-1499.689) (-1492.005) * (-1491.928) (-1495.814) [-1492.456] (-1492.923) -- 0:01:58
428500 -- (-1490.836) (-1496.916) [-1497.519] (-1491.690) * (-1492.029) (-1497.722) (-1492.886) [-1493.355] -- 0:01:58
429000 -- (-1492.141) (-1499.085) (-1497.363) [-1495.864] * (-1492.849) (-1492.868) [-1494.094] (-1493.963) -- 0:01:58
429500 -- (-1500.060) (-1497.341) [-1497.461] (-1502.003) * (-1494.894) [-1496.106] (-1493.743) (-1496.310) -- 0:01:58
430000 -- (-1497.853) [-1497.060] (-1500.326) (-1496.891) * (-1491.422) (-1499.509) [-1496.439] (-1501.483) -- 0:01:57
Average standard deviation of split frequencies: 0.001642
430500 -- (-1496.242) (-1499.896) [-1498.081] (-1501.819) * [-1496.400] (-1505.978) (-1501.240) (-1500.080) -- 0:01:57
431000 -- (-1495.337) [-1491.873] (-1492.512) (-1502.534) * (-1495.587) (-1499.156) (-1501.445) [-1492.741] -- 0:01:57
431500 -- (-1493.909) [-1497.744] (-1493.782) (-1502.401) * [-1493.579] (-1488.822) (-1504.514) (-1495.790) -- 0:01:57
432000 -- (-1501.352) (-1495.752) [-1492.856] (-1498.168) * (-1502.000) (-1499.240) [-1496.724] (-1501.524) -- 0:01:57
432500 -- (-1494.178) (-1499.425) (-1496.681) [-1492.344] * (-1497.481) (-1502.826) [-1496.833] (-1496.647) -- 0:01:58
433000 -- (-1497.537) [-1494.703] (-1499.643) (-1492.444) * (-1497.956) [-1499.671] (-1495.209) (-1499.103) -- 0:01:57
433500 -- (-1504.805) (-1493.236) (-1494.833) [-1494.269] * [-1489.500] (-1508.620) (-1503.144) (-1496.997) -- 0:01:57
434000 -- (-1497.488) [-1492.550] (-1505.597) (-1491.384) * (-1497.368) [-1491.608] (-1509.127) (-1494.883) -- 0:01:57
434500 -- (-1490.876) (-1491.104) (-1497.891) [-1496.944] * (-1492.895) (-1494.247) (-1506.899) [-1499.230] -- 0:01:57
435000 -- (-1505.790) (-1502.772) (-1493.387) [-1495.039] * [-1493.677] (-1498.239) (-1500.122) (-1499.151) -- 0:01:56
Average standard deviation of split frequencies: 0.001081
435500 -- [-1494.324] (-1497.020) (-1499.697) (-1491.084) * (-1497.902) [-1494.702] (-1496.994) (-1504.529) -- 0:01:56
436000 -- (-1499.731) (-1498.819) (-1503.617) [-1496.698] * (-1494.598) (-1494.062) (-1494.382) [-1496.314] -- 0:01:56
436500 -- (-1493.769) (-1496.479) [-1494.063] (-1494.272) * (-1497.134) [-1498.286] (-1503.641) (-1497.664) -- 0:01:56
437000 -- (-1492.453) (-1495.633) (-1492.701) [-1491.239] * (-1496.024) (-1498.973) (-1495.925) [-1499.255] -- 0:01:57
437500 -- (-1501.031) (-1503.995) [-1499.427] (-1495.472) * [-1495.023] (-1493.315) (-1497.532) (-1497.273) -- 0:01:56
438000 -- (-1494.514) [-1498.449] (-1491.021) (-1493.255) * (-1502.583) (-1501.688) (-1494.566) [-1496.437] -- 0:01:56
438500 -- (-1497.378) (-1497.384) [-1492.114] (-1498.119) * [-1500.721] (-1504.238) (-1493.120) (-1495.470) -- 0:01:56
439000 -- (-1498.736) (-1491.989) (-1495.279) [-1499.495] * [-1494.906] (-1504.444) (-1494.367) (-1496.732) -- 0:01:56
439500 -- (-1494.847) [-1492.704] (-1500.795) (-1504.635) * (-1495.964) [-1493.396] (-1496.654) (-1494.954) -- 0:01:56
440000 -- [-1495.418] (-1497.913) (-1496.829) (-1502.422) * (-1497.064) (-1489.545) [-1497.109] (-1491.088) -- 0:01:55
Average standard deviation of split frequencies: 0.000535
440500 -- (-1497.236) (-1499.422) (-1494.134) [-1497.217] * (-1500.842) (-1492.823) (-1495.114) [-1496.416] -- 0:01:55
441000 -- (-1502.784) (-1500.009) (-1499.787) [-1493.610] * (-1496.222) [-1493.488] (-1495.913) (-1497.709) -- 0:01:55
441500 -- (-1498.107) [-1494.691] (-1497.171) (-1493.148) * (-1497.102) (-1494.433) [-1492.447] (-1494.634) -- 0:01:55
442000 -- (-1503.024) (-1498.489) (-1492.633) [-1493.010] * (-1498.631) [-1495.236] (-1496.696) (-1497.751) -- 0:01:56
442500 -- [-1499.011] (-1499.769) (-1491.834) (-1495.918) * (-1495.524) [-1493.798] (-1494.573) (-1492.891) -- 0:01:55
443000 -- (-1494.906) (-1497.949) (-1502.814) [-1492.986] * (-1495.252) (-1494.798) (-1493.470) [-1492.172] -- 0:01:55
443500 -- (-1495.706) [-1495.178] (-1496.309) (-1496.348) * [-1491.059] (-1498.168) (-1499.051) (-1508.760) -- 0:01:55
444000 -- (-1502.088) (-1494.372) [-1491.418] (-1491.373) * (-1495.256) (-1495.905) (-1499.344) [-1495.793] -- 0:01:55
444500 -- (-1502.980) (-1498.392) (-1491.926) [-1493.772] * [-1493.383] (-1494.731) (-1505.295) (-1495.637) -- 0:01:54
445000 -- (-1503.493) (-1496.358) (-1504.545) [-1494.855] * (-1496.016) [-1489.987] (-1503.109) (-1500.569) -- 0:01:54
Average standard deviation of split frequencies: 0.000528
445500 -- (-1498.990) (-1494.613) [-1494.182] (-1500.341) * (-1506.718) (-1498.470) [-1494.295] (-1493.025) -- 0:01:54
446000 -- (-1497.589) (-1496.775) (-1497.248) [-1497.831] * (-1508.398) [-1493.350] (-1493.852) (-1492.757) -- 0:01:54
446500 -- (-1494.242) (-1499.508) (-1495.344) [-1494.158] * [-1495.960] (-1498.126) (-1490.725) (-1497.653) -- 0:01:54
447000 -- (-1501.403) [-1502.971] (-1501.966) (-1497.953) * (-1505.748) (-1497.040) (-1495.337) [-1500.503] -- 0:01:55
447500 -- (-1497.292) (-1496.104) [-1501.916] (-1493.829) * (-1503.711) (-1500.875) (-1495.930) [-1498.273] -- 0:01:54
448000 -- (-1499.096) [-1493.994] (-1497.269) (-1491.841) * (-1498.495) (-1496.030) (-1490.990) [-1499.249] -- 0:01:54
448500 -- (-1493.280) (-1496.729) (-1510.561) [-1490.996] * (-1496.889) [-1495.422] (-1495.830) (-1501.126) -- 0:01:54
449000 -- [-1489.525] (-1494.027) (-1501.785) (-1493.465) * (-1491.825) (-1497.567) [-1490.734] (-1495.379) -- 0:01:54
449500 -- (-1499.519) [-1497.479] (-1494.293) (-1496.488) * (-1497.434) [-1492.391] (-1499.218) (-1496.134) -- 0:01:53
450000 -- (-1504.796) (-1511.916) (-1494.213) [-1494.440] * (-1497.231) [-1494.597] (-1495.398) (-1494.459) -- 0:01:53
Average standard deviation of split frequencies: 0.000523
450500 -- (-1498.640) [-1500.086] (-1500.938) (-1498.598) * (-1494.309) (-1494.739) [-1496.734] (-1496.603) -- 0:01:53
451000 -- (-1494.774) (-1497.833) [-1491.240] (-1495.320) * [-1488.471] (-1496.452) (-1495.135) (-1496.022) -- 0:01:53
451500 -- [-1489.056] (-1496.932) (-1492.847) (-1496.655) * (-1497.052) [-1498.005] (-1495.194) (-1496.771) -- 0:01:54
452000 -- (-1500.974) (-1498.138) (-1505.541) [-1508.409] * (-1497.715) (-1501.332) [-1498.469] (-1497.398) -- 0:01:53
452500 -- [-1489.353] (-1493.688) (-1492.212) (-1496.978) * [-1492.215] (-1503.601) (-1491.923) (-1491.228) -- 0:01:53
453000 -- (-1497.369) [-1493.641] (-1501.572) (-1502.612) * [-1491.755] (-1501.513) (-1499.083) (-1494.467) -- 0:01:53
453500 -- (-1494.999) (-1493.069) [-1495.527] (-1497.424) * (-1494.730) (-1494.693) (-1502.171) [-1496.615] -- 0:01:53
454000 -- (-1492.334) [-1494.672] (-1501.477) (-1500.865) * [-1494.059] (-1496.066) (-1494.573) (-1492.656) -- 0:01:53
454500 -- (-1499.914) (-1495.825) [-1496.584] (-1506.825) * (-1500.106) [-1497.159] (-1496.391) (-1496.152) -- 0:01:52
455000 -- [-1495.362] (-1496.804) (-1499.332) (-1500.272) * (-1503.777) (-1498.088) (-1499.429) [-1492.859] -- 0:01:52
Average standard deviation of split frequencies: 0.000517
455500 -- [-1495.469] (-1496.459) (-1494.285) (-1501.011) * (-1499.687) (-1497.374) [-1495.218] (-1496.176) -- 0:01:52
456000 -- [-1502.120] (-1503.398) (-1503.213) (-1496.343) * (-1491.836) (-1497.417) [-1495.279] (-1505.563) -- 0:01:52
456500 -- (-1492.919) (-1497.215) [-1495.900] (-1496.877) * (-1493.647) [-1496.302] (-1494.150) (-1493.458) -- 0:01:53
457000 -- (-1495.559) [-1498.351] (-1497.959) (-1503.138) * (-1496.828) (-1495.451) [-1500.955] (-1496.029) -- 0:01:52
457500 -- (-1492.585) (-1490.708) (-1496.263) [-1499.960] * (-1499.966) [-1497.103] (-1495.261) (-1496.028) -- 0:01:52
458000 -- (-1493.362) (-1500.886) (-1494.877) [-1493.937] * [-1490.695] (-1492.908) (-1492.742) (-1496.614) -- 0:01:52
458500 -- (-1496.930) [-1498.450] (-1494.907) (-1494.655) * (-1501.400) (-1492.499) [-1503.575] (-1504.068) -- 0:01:52
459000 -- (-1488.879) (-1497.672) (-1494.742) [-1493.427] * (-1507.102) (-1497.000) (-1494.083) [-1499.245] -- 0:01:51
459500 -- [-1498.614] (-1494.358) (-1498.701) (-1496.367) * (-1499.769) [-1493.668] (-1491.473) (-1498.139) -- 0:01:51
460000 -- (-1495.441) (-1495.491) (-1494.874) [-1496.212] * [-1495.079] (-1493.847) (-1492.160) (-1497.783) -- 0:01:51
Average standard deviation of split frequencies: 0.000512
460500 -- (-1496.550) (-1492.515) [-1491.934] (-1493.270) * (-1499.107) (-1493.225) (-1496.994) [-1497.492] -- 0:01:51
461000 -- (-1496.254) [-1492.530] (-1491.747) (-1503.183) * [-1495.638] (-1496.118) (-1492.819) (-1495.448) -- 0:01:51
461500 -- (-1496.693) (-1497.138) (-1498.931) [-1498.368] * (-1498.636) [-1495.930] (-1494.530) (-1498.422) -- 0:01:52
462000 -- (-1501.574) (-1495.699) [-1499.182] (-1495.946) * (-1505.045) (-1496.603) [-1490.707] (-1494.815) -- 0:01:51
462500 -- (-1495.050) (-1499.922) (-1496.935) [-1497.917] * (-1496.882) (-1495.224) (-1497.533) [-1500.359] -- 0:01:51
463000 -- (-1505.306) (-1497.250) [-1499.953] (-1496.926) * [-1493.876] (-1492.841) (-1495.812) (-1498.023) -- 0:01:51
463500 -- (-1498.601) (-1500.156) (-1495.793) [-1498.604] * (-1497.355) (-1496.917) (-1492.408) [-1497.623] -- 0:01:51
464000 -- [-1493.232] (-1499.579) (-1502.850) (-1502.075) * [-1496.207] (-1498.988) (-1505.154) (-1497.274) -- 0:01:50
464500 -- (-1493.848) [-1493.949] (-1501.521) (-1495.051) * [-1494.590] (-1494.459) (-1496.915) (-1504.634) -- 0:01:50
465000 -- (-1508.978) [-1497.822] (-1496.327) (-1494.980) * (-1496.235) [-1493.767] (-1504.608) (-1500.697) -- 0:01:50
Average standard deviation of split frequencies: 0.000506
465500 -- (-1493.267) (-1493.692) [-1498.913] (-1493.949) * (-1499.562) [-1488.535] (-1499.606) (-1493.042) -- 0:01:50
466000 -- (-1504.578) [-1496.006] (-1497.667) (-1495.301) * (-1496.953) [-1492.325] (-1492.604) (-1492.598) -- 0:01:51
466500 -- (-1502.495) (-1501.735) (-1492.428) [-1493.024] * [-1496.310] (-1507.177) (-1496.994) (-1498.740) -- 0:01:50
467000 -- (-1495.970) (-1502.021) [-1498.057] (-1498.581) * (-1501.253) (-1506.950) [-1501.524] (-1489.866) -- 0:01:50
467500 -- (-1499.742) (-1497.815) (-1493.417) [-1493.582] * (-1499.003) (-1497.452) (-1499.246) [-1489.843] -- 0:01:50
468000 -- [-1496.858] (-1497.558) (-1494.758) (-1496.520) * (-1500.006) [-1494.019] (-1499.053) (-1494.225) -- 0:01:50
468500 -- (-1496.691) [-1498.338] (-1492.002) (-1501.375) * (-1505.265) (-1494.467) (-1501.587) [-1502.137] -- 0:01:50
469000 -- [-1493.408] (-1502.336) (-1493.803) (-1501.326) * (-1499.627) (-1501.751) (-1498.188) [-1501.864] -- 0:01:49
469500 -- (-1493.416) [-1493.998] (-1493.409) (-1498.247) * (-1504.396) [-1493.167] (-1492.047) (-1496.329) -- 0:01:49
470000 -- [-1500.284] (-1498.031) (-1496.106) (-1494.777) * (-1498.419) (-1500.095) (-1501.106) [-1499.065] -- 0:01:49
Average standard deviation of split frequencies: 0.000501
470500 -- (-1505.505) [-1499.197] (-1494.452) (-1496.394) * (-1501.088) (-1500.211) [-1492.146] (-1494.186) -- 0:01:49
471000 -- (-1500.196) (-1496.556) (-1498.157) [-1493.912] * (-1496.716) (-1497.703) [-1499.075] (-1493.465) -- 0:01:50
471500 -- [-1491.941] (-1491.804) (-1493.624) (-1493.865) * (-1495.301) (-1493.703) [-1496.432] (-1495.048) -- 0:01:49
472000 -- (-1492.988) [-1493.278] (-1492.230) (-1494.088) * (-1496.598) (-1497.968) (-1497.908) [-1493.482] -- 0:01:49
472500 -- [-1492.552] (-1502.812) (-1491.763) (-1491.352) * [-1492.331] (-1497.432) (-1497.557) (-1492.878) -- 0:01:49
473000 -- [-1494.829] (-1491.961) (-1498.456) (-1496.200) * [-1498.380] (-1499.428) (-1494.771) (-1497.607) -- 0:01:49
473500 -- [-1493.288] (-1492.851) (-1504.003) (-1494.923) * (-1501.177) (-1498.387) (-1494.049) [-1494.196] -- 0:01:48
474000 -- (-1495.123) (-1499.941) [-1502.912] (-1493.135) * [-1502.372] (-1493.769) (-1496.960) (-1496.754) -- 0:01:48
474500 -- [-1500.960] (-1505.149) (-1492.134) (-1496.611) * [-1491.990] (-1501.721) (-1496.123) (-1493.610) -- 0:01:48
475000 -- [-1499.793] (-1500.451) (-1504.556) (-1497.972) * (-1497.352) (-1505.379) [-1495.224] (-1500.106) -- 0:01:48
Average standard deviation of split frequencies: 0.000495
475500 -- (-1496.150) [-1494.186] (-1506.706) (-1495.715) * [-1498.007] (-1495.866) (-1493.310) (-1503.477) -- 0:01:48
476000 -- (-1490.906) (-1498.267) (-1495.244) [-1500.848] * (-1502.284) (-1498.476) [-1494.568] (-1498.504) -- 0:01:48
476500 -- (-1496.577) (-1494.416) (-1501.445) [-1497.824] * [-1496.320] (-1489.733) (-1495.831) (-1503.691) -- 0:01:48
477000 -- [-1493.239] (-1497.475) (-1495.391) (-1504.307) * [-1497.161] (-1493.834) (-1497.792) (-1499.231) -- 0:01:48
477500 -- (-1494.284) (-1496.027) [-1495.109] (-1496.072) * (-1492.996) (-1491.973) (-1495.414) [-1494.465] -- 0:01:48
478000 -- [-1501.591] (-1497.421) (-1501.019) (-1498.058) * (-1497.506) [-1499.654] (-1494.034) (-1491.240) -- 0:01:48
478500 -- (-1499.846) [-1494.193] (-1502.306) (-1499.973) * (-1492.987) [-1493.492] (-1500.166) (-1495.759) -- 0:01:47
479000 -- (-1490.276) (-1493.565) [-1497.189] (-1495.066) * (-1495.934) [-1499.976] (-1502.389) (-1502.915) -- 0:01:47
479500 -- (-1502.032) (-1497.135) [-1493.390] (-1494.890) * [-1495.317] (-1493.898) (-1501.118) (-1495.643) -- 0:01:47
480000 -- (-1498.974) (-1494.358) (-1503.539) [-1494.194] * (-1494.025) (-1498.170) (-1498.106) [-1490.835] -- 0:01:47
Average standard deviation of split frequencies: 0.000490
480500 -- (-1496.796) [-1493.842] (-1492.769) (-1497.107) * (-1496.185) (-1493.883) (-1499.690) [-1492.026] -- 0:01:48
481000 -- (-1498.703) [-1502.159] (-1493.947) (-1500.408) * (-1496.786) [-1493.857] (-1499.061) (-1505.511) -- 0:01:47
481500 -- [-1494.854] (-1497.324) (-1494.960) (-1498.995) * (-1491.539) [-1499.761] (-1491.302) (-1494.386) -- 0:01:47
482000 -- (-1496.282) [-1495.183] (-1494.372) (-1505.053) * [-1493.301] (-1494.107) (-1494.749) (-1496.944) -- 0:01:47
482500 -- [-1492.870] (-1495.835) (-1491.035) (-1501.511) * (-1494.920) (-1493.200) (-1501.206) [-1492.902] -- 0:01:47
483000 -- [-1495.789] (-1493.540) (-1493.681) (-1496.183) * [-1498.125] (-1499.122) (-1491.999) (-1503.475) -- 0:01:47
483500 -- (-1501.465) (-1496.055) [-1495.971] (-1495.099) * (-1494.689) [-1493.495] (-1495.656) (-1498.622) -- 0:01:46
484000 -- (-1502.564) [-1496.138] (-1497.041) (-1498.734) * (-1498.988) (-1500.135) [-1494.438] (-1498.282) -- 0:01:46
484500 -- [-1498.383] (-1498.870) (-1493.435) (-1494.714) * (-1496.032) [-1492.893] (-1492.088) (-1500.927) -- 0:01:46
485000 -- (-1496.150) (-1499.075) [-1495.958] (-1499.548) * (-1489.213) (-1495.030) [-1495.144] (-1506.543) -- 0:01:46
Average standard deviation of split frequencies: 0.000485
485500 -- (-1496.319) (-1491.638) [-1495.093] (-1499.583) * (-1497.754) (-1503.086) [-1494.849] (-1494.448) -- 0:01:47
486000 -- (-1502.268) [-1499.689] (-1492.212) (-1492.095) * (-1491.607) (-1497.576) [-1494.120] (-1505.142) -- 0:01:46
486500 -- (-1497.801) (-1500.079) (-1492.412) [-1493.523] * [-1500.290] (-1493.121) (-1500.726) (-1501.328) -- 0:01:46
487000 -- [-1493.609] (-1493.242) (-1496.422) (-1501.519) * (-1493.969) (-1495.821) [-1500.001] (-1505.020) -- 0:01:46
487500 -- (-1497.886) (-1503.488) (-1500.785) [-1497.463] * (-1493.609) (-1501.942) [-1496.407] (-1501.541) -- 0:01:46
488000 -- (-1503.472) (-1494.778) (-1505.166) [-1497.161] * [-1501.526] (-1497.202) (-1497.978) (-1498.807) -- 0:01:45
488500 -- [-1495.551] (-1497.696) (-1497.251) (-1496.697) * [-1495.193] (-1494.697) (-1505.280) (-1502.302) -- 0:01:45
489000 -- (-1497.312) (-1494.744) (-1496.587) [-1490.913] * (-1495.675) [-1493.442] (-1497.169) (-1506.311) -- 0:01:45
489500 -- (-1497.722) [-1492.922] (-1497.008) (-1498.562) * (-1495.492) (-1503.078) [-1498.638] (-1499.703) -- 0:01:45
490000 -- (-1498.019) [-1492.945] (-1498.351) (-1497.869) * [-1500.426] (-1495.325) (-1503.814) (-1497.907) -- 0:01:45
Average standard deviation of split frequencies: 0.000480
490500 -- [-1491.685] (-1498.356) (-1492.576) (-1493.830) * (-1494.472) [-1491.382] (-1503.642) (-1499.818) -- 0:01:45
491000 -- (-1496.481) (-1497.089) (-1503.196) [-1499.035] * [-1494.918] (-1499.231) (-1497.433) (-1497.715) -- 0:01:45
491500 -- (-1497.693) [-1497.516] (-1496.004) (-1507.225) * (-1495.264) (-1502.092) [-1495.191] (-1507.280) -- 0:01:45
492000 -- [-1500.522] (-1492.527) (-1498.076) (-1503.829) * (-1496.268) [-1498.183] (-1498.122) (-1497.563) -- 0:01:45
492500 -- (-1502.523) [-1492.252] (-1496.825) (-1495.626) * (-1499.867) (-1503.681) [-1492.989] (-1498.280) -- 0:01:45
493000 -- (-1497.226) (-1499.195) (-1494.017) [-1499.558] * (-1495.724) [-1498.748] (-1493.774) (-1499.738) -- 0:01:44
493500 -- (-1498.027) (-1496.063) (-1502.193) [-1496.729] * [-1494.679] (-1498.976) (-1490.800) (-1496.253) -- 0:01:44
494000 -- (-1507.933) (-1494.749) [-1493.871] (-1496.318) * (-1506.859) [-1495.777] (-1496.812) (-1490.070) -- 0:01:44
494500 -- (-1495.434) [-1490.049] (-1495.605) (-1493.592) * (-1500.716) (-1497.629) [-1491.573] (-1502.476) -- 0:01:44
495000 -- (-1495.955) (-1494.291) [-1493.521] (-1499.720) * (-1502.276) (-1496.817) [-1494.472] (-1505.138) -- 0:01:45
Average standard deviation of split frequencies: 0.000475
495500 -- (-1493.411) (-1498.830) [-1492.490] (-1506.060) * (-1508.486) (-1493.626) [-1493.203] (-1497.924) -- 0:01:44
496000 -- (-1506.590) [-1491.547] (-1494.325) (-1497.111) * (-1506.843) [-1503.733] (-1492.329) (-1494.662) -- 0:01:44
496500 -- (-1500.807) [-1498.757] (-1495.372) (-1492.620) * (-1493.091) (-1495.979) (-1499.374) [-1500.805] -- 0:01:44
497000 -- (-1496.575) (-1495.940) [-1495.959] (-1496.824) * (-1495.052) [-1493.743] (-1494.940) (-1499.121) -- 0:01:44
497500 -- [-1492.194] (-1497.009) (-1495.909) (-1495.392) * (-1498.393) [-1495.588] (-1501.112) (-1501.734) -- 0:01:44
498000 -- (-1496.223) (-1493.238) [-1497.173] (-1494.322) * (-1509.826) (-1494.223) (-1496.124) [-1497.858] -- 0:01:43
498500 -- (-1494.475) (-1499.232) [-1493.391] (-1494.817) * (-1498.121) (-1496.379) (-1489.785) [-1494.580] -- 0:01:43
499000 -- (-1506.558) (-1493.230) (-1499.711) [-1495.054] * (-1497.034) (-1500.514) [-1493.355] (-1496.418) -- 0:01:43
499500 -- (-1503.075) [-1495.294] (-1495.619) (-1500.657) * [-1489.516] (-1497.297) (-1500.114) (-1496.752) -- 0:01:43
500000 -- [-1494.132] (-1494.751) (-1500.366) (-1488.183) * (-1495.771) (-1493.490) [-1496.699] (-1500.229) -- 0:01:44
Average standard deviation of split frequencies: 0.000471
500500 -- [-1495.202] (-1491.572) (-1496.340) (-1490.884) * (-1494.020) (-1493.136) [-1492.448] (-1495.784) -- 0:01:43
501000 -- (-1493.437) (-1492.561) [-1491.724] (-1493.173) * (-1493.899) (-1503.236) [-1500.268] (-1493.314) -- 0:01:43
501500 -- (-1495.834) (-1503.234) [-1495.851] (-1497.111) * (-1504.109) (-1492.376) [-1491.374] (-1496.164) -- 0:01:43
502000 -- (-1493.873) [-1497.805] (-1501.563) (-1493.657) * [-1490.888] (-1489.700) (-1496.932) (-1498.284) -- 0:01:43
502500 -- (-1496.190) [-1496.298] (-1495.180) (-1492.022) * [-1501.166] (-1494.966) (-1500.267) (-1498.573) -- 0:01:42
503000 -- (-1493.018) (-1493.785) [-1494.093] (-1496.123) * [-1495.526] (-1493.650) (-1494.498) (-1499.106) -- 0:01:42
503500 -- (-1501.113) (-1493.339) (-1504.749) [-1493.519] * (-1501.039) (-1502.990) (-1495.007) [-1496.614] -- 0:01:42
504000 -- (-1495.785) (-1495.910) (-1501.933) [-1491.056] * (-1501.430) [-1501.914] (-1495.617) (-1494.720) -- 0:01:42
504500 -- (-1497.263) (-1494.531) (-1495.865) [-1497.697] * [-1497.768] (-1498.996) (-1493.936) (-1498.418) -- 0:01:42
505000 -- (-1500.961) (-1494.275) [-1495.783] (-1491.969) * (-1493.268) (-1501.214) (-1498.795) [-1495.120] -- 0:01:42
Average standard deviation of split frequencies: 0.000932
505500 -- (-1503.510) [-1496.154] (-1493.573) (-1495.529) * [-1492.703] (-1507.206) (-1498.641) (-1498.077) -- 0:01:42
506000 -- (-1495.232) (-1491.710) [-1498.182] (-1491.981) * (-1496.599) [-1502.647] (-1503.370) (-1498.516) -- 0:01:42
506500 -- (-1495.193) [-1489.647] (-1496.070) (-1490.818) * [-1495.274] (-1499.033) (-1500.447) (-1499.279) -- 0:01:42
507000 -- [-1506.170] (-1494.837) (-1503.440) (-1491.323) * [-1496.814] (-1497.799) (-1507.565) (-1507.248) -- 0:01:42
507500 -- [-1491.842] (-1491.185) (-1495.924) (-1505.633) * (-1498.374) [-1496.554] (-1497.861) (-1508.113) -- 0:01:41
508000 -- [-1493.960] (-1494.934) (-1496.436) (-1496.851) * [-1495.891] (-1493.771) (-1500.331) (-1503.217) -- 0:01:41
508500 -- (-1494.490) [-1490.518] (-1494.480) (-1497.976) * (-1504.333) [-1493.429] (-1496.632) (-1506.925) -- 0:01:41
509000 -- (-1492.856) [-1496.095] (-1491.577) (-1494.890) * (-1495.037) [-1492.146] (-1499.613) (-1502.897) -- 0:01:41
509500 -- (-1497.663) (-1492.680) [-1495.401] (-1491.547) * [-1499.693] (-1493.474) (-1502.811) (-1498.818) -- 0:01:42
510000 -- (-1498.248) (-1503.685) [-1493.807] (-1496.316) * (-1504.605) [-1499.002] (-1496.559) (-1503.089) -- 0:01:41
Average standard deviation of split frequencies: 0.000923
510500 -- (-1493.085) (-1504.341) [-1495.339] (-1503.448) * [-1493.990] (-1498.496) (-1499.777) (-1500.938) -- 0:01:41
511000 -- (-1499.141) (-1493.540) (-1495.212) [-1497.313] * [-1493.899] (-1505.252) (-1496.726) (-1495.046) -- 0:01:41
511500 -- (-1498.345) [-1493.551] (-1499.932) (-1490.092) * (-1496.292) [-1499.608] (-1493.134) (-1496.534) -- 0:01:41
512000 -- (-1495.611) (-1493.955) (-1500.968) [-1491.500] * [-1503.867] (-1496.621) (-1494.569) (-1500.196) -- 0:01:41
512500 -- (-1494.663) [-1491.370] (-1508.931) (-1494.680) * (-1499.046) (-1499.498) [-1497.175] (-1501.646) -- 0:01:40
513000 -- (-1500.139) (-1494.109) (-1497.542) [-1493.104] * (-1496.408) (-1501.496) [-1494.443] (-1500.822) -- 0:01:40
513500 -- (-1494.422) [-1494.908] (-1502.103) (-1499.950) * (-1498.954) (-1498.857) (-1494.822) [-1498.260] -- 0:01:40
514000 -- (-1494.944) (-1500.863) (-1512.643) [-1494.472] * [-1492.154] (-1497.328) (-1492.440) (-1495.602) -- 0:01:40
514500 -- (-1492.715) [-1494.909] (-1495.808) (-1505.423) * [-1492.895] (-1498.253) (-1506.031) (-1496.548) -- 0:01:40
515000 -- (-1500.836) (-1496.287) [-1496.041] (-1497.147) * (-1494.641) (-1499.347) (-1500.224) [-1499.179] -- 0:01:40
Average standard deviation of split frequencies: 0.000914
515500 -- (-1497.059) (-1497.885) [-1495.641] (-1500.631) * [-1489.493] (-1493.886) (-1499.286) (-1501.378) -- 0:01:40
516000 -- (-1497.994) (-1499.374) (-1491.962) [-1499.088] * (-1492.741) [-1492.905] (-1494.668) (-1497.618) -- 0:01:40
516500 -- (-1494.833) (-1496.605) (-1495.935) [-1494.840] * [-1495.338] (-1496.611) (-1498.133) (-1500.007) -- 0:01:40
517000 -- [-1494.370] (-1497.796) (-1504.224) (-1496.669) * (-1497.159) (-1496.248) [-1502.012] (-1495.572) -- 0:01:39
517500 -- (-1495.737) (-1506.014) [-1501.196] (-1490.752) * (-1497.647) (-1493.279) (-1494.574) [-1496.654] -- 0:01:39
518000 -- (-1497.941) (-1500.820) (-1502.503) [-1498.427] * [-1504.561] (-1498.138) (-1498.673) (-1512.024) -- 0:01:39
518500 -- [-1494.646] (-1494.897) (-1495.492) (-1492.675) * (-1495.540) [-1499.255] (-1501.997) (-1505.080) -- 0:01:39
519000 -- [-1495.760] (-1495.805) (-1500.592) (-1494.655) * (-1500.906) (-1498.912) (-1496.485) [-1497.632] -- 0:01:39
519500 -- (-1492.478) (-1496.329) [-1497.502] (-1493.590) * (-1492.065) (-1503.266) [-1492.350] (-1502.590) -- 0:01:39
520000 -- (-1494.334) [-1503.756] (-1497.370) (-1503.257) * (-1494.835) (-1501.310) [-1494.332] (-1497.187) -- 0:01:39
Average standard deviation of split frequencies: 0.000905
520500 -- (-1491.807) (-1505.084) (-1493.950) [-1494.317] * (-1494.021) (-1498.339) [-1493.027] (-1492.176) -- 0:01:39
521000 -- (-1501.846) (-1495.167) [-1492.834] (-1494.909) * [-1500.788] (-1497.715) (-1494.843) (-1496.481) -- 0:01:39
521500 -- [-1493.854] (-1494.183) (-1499.111) (-1495.570) * (-1494.822) (-1500.135) [-1491.712] (-1502.257) -- 0:01:39
522000 -- (-1505.106) (-1503.610) [-1495.764] (-1494.526) * (-1496.966) (-1501.395) [-1493.249] (-1501.151) -- 0:01:38
522500 -- (-1497.642) (-1494.053) (-1498.771) [-1503.888] * (-1492.596) (-1505.608) [-1492.558] (-1499.798) -- 0:01:38
523000 -- [-1494.076] (-1498.141) (-1497.340) (-1496.266) * (-1493.703) (-1501.871) (-1493.375) [-1492.575] -- 0:01:38
523500 -- (-1499.970) (-1497.698) (-1494.646) [-1493.941] * (-1499.628) (-1498.382) [-1496.512] (-1498.734) -- 0:01:38
524000 -- (-1495.291) [-1492.890] (-1495.763) (-1495.620) * (-1500.730) [-1497.055] (-1495.846) (-1494.526) -- 0:01:38
524500 -- (-1497.399) (-1495.568) (-1501.185) [-1494.769] * [-1494.005] (-1496.667) (-1498.761) (-1497.661) -- 0:01:38
525000 -- (-1495.856) (-1492.804) [-1496.381] (-1498.176) * (-1497.590) (-1497.123) [-1499.870] (-1493.826) -- 0:01:38
Average standard deviation of split frequencies: 0.000896
525500 -- (-1492.875) (-1499.312) [-1494.992] (-1499.556) * (-1495.697) (-1496.285) [-1494.972] (-1500.530) -- 0:01:38
526000 -- (-1499.394) (-1491.206) [-1490.734] (-1498.357) * (-1504.812) (-1499.748) (-1494.072) [-1502.243] -- 0:01:38
526500 -- (-1502.170) (-1494.341) (-1495.986) [-1501.010] * (-1497.441) (-1498.960) (-1495.066) [-1495.570] -- 0:01:38
527000 -- (-1492.583) [-1496.703] (-1503.930) (-1494.543) * (-1494.148) (-1495.326) [-1502.877] (-1496.559) -- 0:01:37
527500 -- (-1491.645) [-1495.764] (-1498.423) (-1496.338) * [-1492.276] (-1499.458) (-1502.770) (-1495.430) -- 0:01:37
528000 -- (-1512.911) (-1500.183) [-1497.453] (-1504.678) * (-1495.568) (-1496.025) [-1492.776] (-1498.986) -- 0:01:37
528500 -- (-1500.545) (-1491.533) [-1496.322] (-1494.067) * (-1501.454) (-1496.266) [-1493.010] (-1497.016) -- 0:01:37
529000 -- [-1493.722] (-1489.516) (-1501.650) (-1495.165) * (-1498.194) [-1494.161] (-1494.048) (-1503.006) -- 0:01:37
529500 -- [-1491.511] (-1495.320) (-1501.610) (-1496.643) * (-1507.349) [-1494.125] (-1498.070) (-1500.659) -- 0:01:37
530000 -- (-1495.839) (-1495.894) (-1512.988) [-1500.772] * (-1501.800) [-1495.912] (-1498.223) (-1503.252) -- 0:01:37
Average standard deviation of split frequencies: 0.000888
530500 -- [-1499.692] (-1501.854) (-1504.852) (-1496.860) * [-1492.438] (-1492.414) (-1497.813) (-1509.488) -- 0:01:37
531000 -- (-1499.610) [-1498.758] (-1496.925) (-1496.983) * [-1495.283] (-1492.394) (-1493.064) (-1502.049) -- 0:01:37
531500 -- [-1493.649] (-1495.839) (-1499.252) (-1494.644) * (-1500.359) (-1501.663) [-1499.358] (-1499.434) -- 0:01:36
532000 -- [-1495.926] (-1489.656) (-1498.761) (-1494.778) * (-1499.289) (-1493.325) (-1495.787) [-1497.119] -- 0:01:36
532500 -- (-1498.076) [-1495.146] (-1505.346) (-1497.665) * (-1494.046) (-1496.597) [-1496.885] (-1497.749) -- 0:01:36
533000 -- (-1498.475) [-1494.066] (-1495.457) (-1497.627) * (-1507.641) [-1497.630] (-1499.317) (-1498.152) -- 0:01:36
533500 -- (-1496.878) (-1496.709) (-1499.272) [-1502.575] * [-1498.595] (-1499.100) (-1491.857) (-1495.250) -- 0:01:36
534000 -- (-1505.171) [-1492.161] (-1495.304) (-1495.946) * [-1496.916] (-1495.967) (-1494.177) (-1497.879) -- 0:01:36
534500 -- (-1497.556) (-1503.149) (-1501.807) [-1493.187] * (-1496.252) (-1495.392) (-1503.541) [-1495.979] -- 0:01:36
535000 -- (-1500.025) (-1503.700) [-1494.210] (-1492.649) * (-1501.813) (-1500.409) (-1492.284) [-1493.318] -- 0:01:36
Average standard deviation of split frequencies: 0.000879
535500 -- (-1495.171) (-1497.785) (-1496.710) [-1492.918] * (-1498.618) (-1501.855) (-1501.199) [-1496.408] -- 0:01:36
536000 -- (-1498.981) [-1498.136] (-1503.087) (-1498.430) * (-1494.895) (-1499.118) (-1497.668) [-1497.618] -- 0:01:36
536500 -- [-1498.084] (-1498.566) (-1497.673) (-1508.451) * (-1495.091) (-1495.120) (-1499.986) [-1494.277] -- 0:01:35
537000 -- (-1496.992) [-1494.221] (-1492.980) (-1500.221) * [-1497.519] (-1500.690) (-1499.166) (-1494.396) -- 0:01:35
537500 -- (-1500.391) (-1492.223) [-1491.326] (-1504.121) * [-1492.487] (-1494.696) (-1497.748) (-1505.804) -- 0:01:35
538000 -- (-1502.974) (-1492.176) [-1491.085] (-1500.382) * (-1491.046) (-1497.492) (-1501.719) [-1502.930] -- 0:01:35
538500 -- (-1504.154) [-1495.695] (-1494.359) (-1499.314) * (-1492.411) (-1496.130) [-1499.895] (-1499.719) -- 0:01:35
539000 -- [-1500.958] (-1501.076) (-1497.915) (-1497.827) * (-1495.060) [-1494.994] (-1497.293) (-1498.676) -- 0:01:35
539500 -- (-1501.073) (-1499.676) (-1496.384) [-1497.458] * [-1495.755] (-1495.636) (-1498.483) (-1506.054) -- 0:01:35
540000 -- [-1496.630] (-1502.422) (-1497.527) (-1504.967) * [-1494.396] (-1497.930) (-1497.959) (-1504.545) -- 0:01:35
Average standard deviation of split frequencies: 0.000872
540500 -- (-1492.974) (-1504.404) (-1501.998) [-1496.601] * [-1490.829] (-1504.116) (-1488.653) (-1495.883) -- 0:01:35
541000 -- (-1500.191) (-1502.763) [-1498.257] (-1500.498) * (-1494.949) (-1505.511) [-1496.982] (-1507.063) -- 0:01:35
541500 -- (-1493.354) (-1501.152) [-1498.356] (-1493.828) * [-1501.819] (-1496.170) (-1499.162) (-1494.136) -- 0:01:34
542000 -- (-1495.174) (-1492.659) (-1496.684) [-1492.207] * (-1501.771) [-1496.029] (-1497.723) (-1489.890) -- 0:01:34
542500 -- (-1499.962) [-1489.826] (-1497.989) (-1494.503) * [-1492.574] (-1499.079) (-1509.656) (-1494.007) -- 0:01:34
543000 -- (-1499.972) [-1492.821] (-1498.805) (-1497.608) * (-1494.571) (-1494.555) (-1500.535) [-1496.005] -- 0:01:34
543500 -- (-1499.936) (-1492.627) (-1497.243) [-1494.453] * [-1497.567] (-1492.331) (-1496.927) (-1495.868) -- 0:01:34
544000 -- [-1493.066] (-1494.402) (-1495.402) (-1500.116) * (-1497.604) [-1495.664] (-1498.476) (-1496.199) -- 0:01:34
544500 -- (-1493.623) (-1499.166) (-1491.750) [-1497.546] * [-1494.993] (-1501.216) (-1500.302) (-1501.332) -- 0:01:34
545000 -- (-1500.153) (-1492.015) [-1494.106] (-1493.973) * (-1493.484) (-1496.246) (-1501.532) [-1494.463] -- 0:01:34
Average standard deviation of split frequencies: 0.000863
545500 -- (-1495.293) [-1497.065] (-1496.643) (-1495.410) * [-1495.682] (-1502.465) (-1493.582) (-1497.487) -- 0:01:34
546000 -- (-1497.384) (-1498.696) (-1493.332) [-1498.165] * (-1490.545) (-1496.880) [-1496.869] (-1499.839) -- 0:01:33
546500 -- (-1504.698) [-1500.215] (-1498.100) (-1500.154) * [-1494.664] (-1501.293) (-1498.983) (-1491.861) -- 0:01:33
547000 -- (-1498.670) (-1495.973) [-1490.565] (-1502.909) * [-1495.641] (-1497.224) (-1489.013) (-1489.683) -- 0:01:33
547500 -- (-1500.712) [-1495.476] (-1501.372) (-1494.168) * (-1499.664) (-1493.355) (-1494.456) [-1499.533] -- 0:01:33
548000 -- [-1495.434] (-1495.529) (-1500.078) (-1493.521) * (-1499.438) (-1494.078) (-1498.527) [-1490.497] -- 0:01:33
548500 -- (-1491.623) (-1495.661) (-1495.617) [-1497.149] * (-1500.194) [-1494.395] (-1489.541) (-1496.378) -- 0:01:33
549000 -- (-1491.315) (-1492.841) (-1494.577) [-1491.916] * (-1497.882) (-1498.016) [-1492.785] (-1498.368) -- 0:01:33
549500 -- [-1494.301] (-1496.030) (-1493.674) (-1493.089) * (-1495.901) (-1495.127) [-1495.003] (-1499.894) -- 0:01:33
550000 -- (-1494.754) (-1493.147) (-1494.668) [-1492.827] * (-1499.045) (-1499.582) [-1492.964] (-1496.234) -- 0:01:33
Average standard deviation of split frequencies: 0.000856
550500 -- (-1496.398) (-1500.756) (-1493.459) [-1493.287] * (-1501.002) [-1491.678] (-1493.211) (-1497.918) -- 0:01:33
551000 -- (-1497.386) (-1499.497) (-1496.836) [-1498.310] * (-1494.868) (-1494.664) (-1496.275) [-1494.726] -- 0:01:32
551500 -- (-1500.423) (-1494.726) [-1503.681] (-1495.588) * (-1494.931) (-1503.282) [-1497.716] (-1495.560) -- 0:01:32
552000 -- (-1494.267) [-1498.099] (-1498.228) (-1496.164) * (-1495.670) (-1494.317) (-1492.245) [-1497.585] -- 0:01:32
552500 -- (-1494.907) (-1497.562) [-1498.991] (-1498.323) * (-1500.384) (-1491.601) [-1496.021] (-1492.606) -- 0:01:32
553000 -- (-1495.639) (-1490.028) [-1492.384] (-1501.409) * (-1493.368) (-1506.178) [-1496.703] (-1494.667) -- 0:01:32
553500 -- (-1499.203) [-1491.647] (-1494.268) (-1494.185) * (-1495.745) (-1493.950) [-1497.093] (-1491.157) -- 0:01:32
554000 -- (-1497.565) (-1496.672) [-1494.544] (-1498.867) * (-1502.025) [-1499.012] (-1498.804) (-1494.137) -- 0:01:32
554500 -- (-1499.469) (-1494.183) (-1490.826) [-1494.466] * [-1492.626] (-1494.528) (-1495.147) (-1491.007) -- 0:01:32
555000 -- (-1505.083) [-1494.045] (-1498.743) (-1496.183) * [-1490.262] (-1496.789) (-1490.728) (-1491.119) -- 0:01:32
Average standard deviation of split frequencies: 0.000848
555500 -- [-1498.647] (-1493.363) (-1496.073) (-1497.657) * (-1494.362) [-1497.035] (-1502.164) (-1494.362) -- 0:01:32
556000 -- (-1497.856) (-1496.820) (-1495.077) [-1495.873] * (-1494.075) (-1499.152) (-1497.246) [-1492.533] -- 0:01:31
556500 -- [-1496.943] (-1498.976) (-1497.438) (-1504.447) * (-1497.011) (-1495.077) [-1496.682] (-1494.574) -- 0:01:31
557000 -- [-1494.671] (-1501.842) (-1490.767) (-1500.622) * (-1499.637) (-1511.111) [-1493.368] (-1501.358) -- 0:01:31
557500 -- (-1494.372) (-1499.236) [-1491.644] (-1503.413) * (-1498.708) (-1500.295) [-1491.328] (-1504.522) -- 0:01:31
558000 -- [-1494.648] (-1497.400) (-1496.260) (-1495.151) * (-1505.007) (-1496.226) (-1499.669) [-1494.763] -- 0:01:31
558500 -- (-1493.991) (-1492.155) (-1491.518) [-1497.568] * (-1498.737) [-1501.398] (-1496.275) (-1502.373) -- 0:01:31
559000 -- (-1494.527) (-1492.319) [-1496.369] (-1501.774) * [-1501.360] (-1501.943) (-1493.448) (-1494.911) -- 0:01:31
559500 -- (-1494.381) (-1491.968) (-1493.220) [-1505.218] * (-1495.970) (-1492.820) [-1495.091] (-1492.017) -- 0:01:31
560000 -- (-1501.274) (-1497.913) [-1496.802] (-1507.721) * (-1503.071) [-1501.650] (-1493.338) (-1503.023) -- 0:01:31
Average standard deviation of split frequencies: 0.000841
560500 -- (-1496.453) (-1504.571) (-1500.580) [-1493.740] * (-1498.263) (-1496.123) (-1507.591) [-1497.789] -- 0:01:30
561000 -- [-1498.114] (-1502.202) (-1492.869) (-1494.482) * (-1502.408) [-1498.689] (-1502.442) (-1492.029) -- 0:01:30
561500 -- [-1493.462] (-1500.367) (-1495.673) (-1494.472) * (-1503.594) (-1496.930) (-1501.158) [-1491.373] -- 0:01:30
562000 -- [-1497.233] (-1500.660) (-1496.930) (-1510.849) * (-1499.319) [-1498.300] (-1496.975) (-1494.063) -- 0:01:30
562500 -- (-1492.807) [-1501.143] (-1497.043) (-1497.198) * (-1495.187) (-1499.105) (-1496.735) [-1489.527] -- 0:01:30
563000 -- (-1496.025) (-1495.035) (-1494.179) [-1500.769] * (-1493.251) (-1496.068) [-1497.439] (-1495.255) -- 0:01:30
563500 -- (-1500.075) (-1494.631) (-1498.259) [-1496.018] * (-1496.818) [-1491.284] (-1508.079) (-1491.925) -- 0:01:30
564000 -- (-1495.343) (-1497.491) [-1495.754] (-1502.464) * (-1491.416) [-1496.917] (-1500.482) (-1502.257) -- 0:01:30
564500 -- (-1497.049) [-1499.482] (-1495.901) (-1501.956) * (-1494.794) (-1497.046) (-1502.965) [-1493.503] -- 0:01:30
565000 -- (-1493.109) (-1496.064) (-1492.805) [-1490.546] * (-1498.740) (-1496.353) (-1504.916) [-1493.975] -- 0:01:30
Average standard deviation of split frequencies: 0.001249
565500 -- (-1492.678) (-1501.057) [-1494.473] (-1498.327) * (-1495.788) (-1499.439) (-1498.318) [-1495.684] -- 0:01:29
566000 -- (-1493.153) (-1495.095) (-1499.676) [-1495.807] * [-1489.461] (-1500.333) (-1505.158) (-1494.178) -- 0:01:29
566500 -- (-1488.876) [-1499.973] (-1495.501) (-1489.813) * (-1497.536) [-1497.421] (-1506.236) (-1501.884) -- 0:01:29
567000 -- (-1494.695) (-1502.668) [-1498.412] (-1492.923) * (-1495.056) (-1498.674) (-1498.140) [-1505.652] -- 0:01:29
567500 -- (-1493.804) (-1492.047) [-1493.414] (-1496.795) * (-1494.966) [-1499.679] (-1495.578) (-1502.541) -- 0:01:29
568000 -- (-1504.420) (-1502.027) (-1505.412) [-1495.722] * (-1494.822) (-1491.430) [-1496.314] (-1505.708) -- 0:01:29
568500 -- (-1509.012) [-1492.241] (-1499.620) (-1497.547) * [-1494.965] (-1491.697) (-1494.945) (-1497.783) -- 0:01:29
569000 -- (-1495.394) (-1495.825) [-1492.880] (-1493.641) * [-1493.616] (-1498.268) (-1497.648) (-1491.587) -- 0:01:29
569500 -- (-1497.488) (-1494.543) [-1493.461] (-1496.965) * (-1494.878) [-1498.309] (-1495.220) (-1491.992) -- 0:01:29
570000 -- (-1497.583) (-1495.247) [-1488.009] (-1495.301) * [-1496.025] (-1506.446) (-1497.780) (-1502.965) -- 0:01:29
Average standard deviation of split frequencies: 0.000826
570500 -- (-1496.037) (-1498.064) [-1493.709] (-1497.901) * (-1507.178) (-1499.126) (-1496.114) [-1491.006] -- 0:01:28
571000 -- (-1493.608) [-1492.175] (-1497.466) (-1491.286) * [-1500.524] (-1497.163) (-1500.606) (-1498.106) -- 0:01:28
571500 -- [-1492.839] (-1503.486) (-1496.468) (-1494.217) * (-1499.845) (-1494.989) (-1497.912) [-1497.302] -- 0:01:28
572000 -- (-1497.940) (-1494.303) (-1495.383) [-1492.477] * (-1501.080) (-1497.101) [-1497.633] (-1499.467) -- 0:01:28
572500 -- (-1504.445) (-1501.951) [-1501.336] (-1494.525) * (-1500.555) (-1494.704) (-1498.631) [-1494.146] -- 0:01:28
573000 -- (-1497.018) (-1504.992) (-1495.636) [-1495.256] * (-1498.160) [-1495.493] (-1503.515) (-1497.838) -- 0:01:28
573500 -- (-1497.136) (-1496.932) (-1498.067) [-1497.995] * (-1497.497) (-1495.300) (-1498.170) [-1496.080] -- 0:01:28
574000 -- [-1499.110] (-1501.805) (-1495.924) (-1496.760) * (-1497.897) [-1491.744] (-1498.369) (-1507.669) -- 0:01:28
574500 -- [-1493.438] (-1496.000) (-1499.186) (-1500.724) * (-1493.009) (-1494.910) [-1493.736] (-1495.748) -- 0:01:28
575000 -- (-1495.440) [-1494.941] (-1502.797) (-1494.164) * (-1495.296) [-1493.821] (-1494.010) (-1496.714) -- 0:01:27
Average standard deviation of split frequencies: 0.000818
575500 -- [-1495.560] (-1497.538) (-1495.492) (-1495.815) * (-1496.992) [-1492.789] (-1497.022) (-1502.750) -- 0:01:27
576000 -- (-1497.765) [-1498.667] (-1491.504) (-1498.277) * (-1495.551) (-1492.074) [-1498.046] (-1498.091) -- 0:01:27
576500 -- (-1493.419) (-1499.109) [-1497.192] (-1506.669) * (-1495.773) (-1500.791) [-1492.324] (-1500.204) -- 0:01:27
577000 -- (-1500.047) [-1497.960] (-1497.080) (-1498.215) * (-1497.788) (-1504.612) [-1492.801] (-1496.798) -- 0:01:27
577500 -- (-1503.329) [-1493.998] (-1494.465) (-1496.565) * (-1498.098) (-1503.717) (-1496.481) [-1512.324] -- 0:01:27
578000 -- (-1491.851) (-1501.634) (-1497.591) [-1492.988] * (-1495.055) (-1504.680) [-1495.866] (-1498.926) -- 0:01:27
578500 -- (-1498.122) (-1497.451) [-1500.529] (-1499.760) * [-1488.933] (-1512.264) (-1498.690) (-1494.524) -- 0:01:27
579000 -- (-1501.187) [-1497.497] (-1506.762) (-1498.043) * (-1493.272) (-1500.081) [-1495.340] (-1494.891) -- 0:01:27
579500 -- (-1490.405) [-1494.394] (-1496.981) (-1497.176) * (-1493.503) [-1491.521] (-1500.033) (-1496.960) -- 0:01:27
580000 -- (-1496.248) (-1492.579) (-1499.366) [-1497.260] * (-1492.415) (-1500.411) (-1494.183) [-1494.493] -- 0:01:26
Average standard deviation of split frequencies: 0.000406
580500 -- (-1500.210) (-1493.751) [-1493.782] (-1502.350) * [-1491.502] (-1498.137) (-1494.715) (-1498.977) -- 0:01:26
581000 -- (-1499.676) [-1500.355] (-1498.173) (-1499.937) * (-1504.667) (-1500.320) (-1499.176) [-1493.702] -- 0:01:26
581500 -- (-1495.869) (-1499.097) [-1502.795] (-1498.938) * (-1497.296) (-1499.751) (-1497.378) [-1495.206] -- 0:01:26
582000 -- (-1498.840) [-1496.055] (-1499.912) (-1497.818) * (-1494.306) (-1501.974) [-1494.558] (-1492.087) -- 0:01:26
582500 -- (-1502.639) [-1495.196] (-1496.005) (-1496.869) * (-1495.462) [-1495.150] (-1495.572) (-1491.184) -- 0:01:26
583000 -- [-1504.644] (-1501.531) (-1500.720) (-1493.978) * [-1495.137] (-1499.585) (-1500.758) (-1491.887) -- 0:01:26
583500 -- [-1497.034] (-1498.863) (-1497.460) (-1497.060) * (-1495.471) [-1498.036] (-1492.765) (-1491.063) -- 0:01:26
584000 -- (-1500.523) (-1491.664) [-1498.953] (-1499.677) * (-1499.560) (-1497.963) [-1498.569] (-1495.212) -- 0:01:26
584500 -- [-1494.882] (-1495.512) (-1494.116) (-1510.172) * [-1495.886] (-1498.955) (-1493.821) (-1494.925) -- 0:01:26
585000 -- [-1495.380] (-1492.417) (-1500.549) (-1494.469) * [-1490.619] (-1493.451) (-1492.669) (-1498.493) -- 0:01:25
Average standard deviation of split frequencies: 0.000402
585500 -- (-1501.891) [-1497.221] (-1501.178) (-1503.083) * (-1490.327) (-1499.868) (-1494.074) [-1496.056] -- 0:01:25
586000 -- (-1501.494) [-1498.203] (-1499.034) (-1498.980) * (-1496.215) [-1497.354] (-1495.488) (-1497.051) -- 0:01:25
586500 -- [-1492.317] (-1497.082) (-1494.203) (-1495.992) * (-1500.497) (-1492.873) [-1494.393] (-1501.149) -- 0:01:25
587000 -- (-1498.029) (-1495.160) (-1500.680) [-1507.105] * (-1495.620) (-1506.315) (-1497.824) [-1495.803] -- 0:01:25
587500 -- (-1497.130) [-1496.329] (-1493.517) (-1497.296) * [-1493.748] (-1498.304) (-1495.660) (-1497.852) -- 0:01:25
588000 -- (-1499.376) [-1494.285] (-1495.468) (-1496.577) * (-1503.277) (-1503.282) (-1495.294) [-1497.776] -- 0:01:25
588500 -- (-1499.343) (-1498.506) [-1493.051] (-1499.253) * (-1502.943) [-1493.823] (-1501.434) (-1503.080) -- 0:01:25
589000 -- (-1505.411) [-1494.404] (-1496.202) (-1497.054) * (-1498.765) (-1497.972) (-1503.007) [-1503.515] -- 0:01:25
589500 -- (-1500.239) (-1495.147) (-1498.040) [-1498.779] * (-1498.992) (-1496.004) [-1502.032] (-1499.445) -- 0:01:24
590000 -- (-1502.817) (-1504.525) (-1495.809) [-1496.167] * (-1501.339) (-1495.859) (-1506.133) [-1497.215] -- 0:01:24
Average standard deviation of split frequencies: 0.000399
590500 -- (-1501.276) (-1497.054) (-1496.452) [-1495.181] * (-1498.310) [-1497.319] (-1496.951) (-1494.372) -- 0:01:24
591000 -- (-1501.726) (-1497.911) (-1498.475) [-1496.600] * (-1497.405) (-1500.133) [-1492.323] (-1499.525) -- 0:01:24
591500 -- (-1498.694) [-1495.913] (-1494.376) (-1489.972) * (-1499.060) (-1495.354) [-1497.941] (-1498.588) -- 0:01:24
592000 -- (-1495.498) (-1497.546) (-1505.213) [-1491.717] * (-1498.205) [-1496.229] (-1502.912) (-1501.142) -- 0:01:24
592500 -- [-1489.642] (-1498.566) (-1493.571) (-1497.483) * (-1495.646) [-1498.717] (-1499.320) (-1498.787) -- 0:01:24
593000 -- [-1495.694] (-1492.916) (-1500.719) (-1499.843) * (-1493.290) [-1494.630] (-1492.544) (-1496.520) -- 0:01:24
593500 -- (-1493.161) (-1492.898) [-1491.475] (-1491.263) * (-1497.779) (-1503.335) (-1495.499) [-1496.074] -- 0:01:24
594000 -- (-1495.651) (-1500.236) (-1499.368) [-1494.832] * (-1495.728) (-1490.326) [-1498.532] (-1499.989) -- 0:01:24
594500 -- [-1495.510] (-1495.678) (-1493.040) (-1503.748) * (-1497.032) (-1493.752) [-1493.131] (-1500.731) -- 0:01:23
595000 -- (-1496.056) (-1506.510) [-1489.551] (-1510.662) * (-1490.755) (-1500.983) (-1494.538) [-1497.053] -- 0:01:23
Average standard deviation of split frequencies: 0.000000
595500 -- (-1491.905) [-1489.895] (-1490.254) (-1497.829) * (-1500.280) [-1494.239] (-1495.039) (-1500.471) -- 0:01:23
596000 -- [-1496.049] (-1496.772) (-1490.398) (-1500.678) * (-1494.787) (-1500.446) [-1498.442] (-1494.027) -- 0:01:23
596500 -- [-1498.022] (-1492.642) (-1500.376) (-1494.809) * (-1499.185) [-1490.400] (-1495.524) (-1497.633) -- 0:01:23
597000 -- [-1493.755] (-1497.972) (-1496.153) (-1494.865) * [-1499.568] (-1498.456) (-1495.292) (-1491.713) -- 0:01:23
597500 -- (-1490.836) (-1497.654) [-1496.575] (-1498.071) * (-1496.059) [-1492.875] (-1496.860) (-1497.721) -- 0:01:23
598000 -- [-1495.784] (-1495.112) (-1495.888) (-1493.316) * (-1498.544) (-1499.083) (-1495.637) [-1496.130] -- 0:01:23
598500 -- (-1496.139) [-1498.923] (-1498.295) (-1496.402) * (-1494.703) [-1499.042] (-1504.157) (-1498.234) -- 0:01:23
599000 -- [-1501.200] (-1499.108) (-1494.429) (-1496.549) * (-1503.238) (-1499.053) [-1499.137] (-1494.421) -- 0:01:23
599500 -- [-1495.622] (-1492.591) (-1492.373) (-1495.573) * (-1505.040) (-1493.558) [-1490.618] (-1498.033) -- 0:01:22
600000 -- (-1498.111) [-1495.770] (-1495.596) (-1494.502) * (-1503.360) (-1495.686) (-1497.100) [-1492.050] -- 0:01:22
Average standard deviation of split frequencies: 0.000000
600500 -- [-1500.680] (-1500.901) (-1501.570) (-1502.077) * [-1497.431] (-1496.703) (-1493.164) (-1500.845) -- 0:01:22
601000 -- (-1497.335) (-1515.113) (-1492.140) [-1492.927] * (-1498.168) (-1502.609) [-1494.774] (-1497.804) -- 0:01:22
601500 -- (-1501.912) (-1504.900) (-1499.918) [-1496.733] * (-1495.135) (-1497.873) (-1493.820) [-1495.533] -- 0:01:22
602000 -- (-1501.251) [-1497.399] (-1490.934) (-1495.242) * (-1506.164) (-1494.653) [-1496.499] (-1495.342) -- 0:01:22
602500 -- (-1496.603) (-1501.306) [-1495.964] (-1494.485) * (-1502.347) (-1498.327) [-1492.659] (-1494.744) -- 0:01:22
603000 -- (-1494.536) (-1501.230) [-1497.885] (-1498.096) * [-1502.690] (-1499.984) (-1491.905) (-1497.676) -- 0:01:22
603500 -- (-1498.497) (-1494.652) [-1496.376] (-1493.295) * (-1501.752) (-1503.751) (-1499.196) [-1491.232] -- 0:01:22
604000 -- [-1494.179] (-1497.886) (-1494.210) (-1494.909) * (-1500.142) (-1492.482) (-1502.128) [-1492.912] -- 0:01:21
604500 -- (-1503.766) (-1497.217) [-1494.968] (-1499.769) * (-1502.697) (-1494.177) [-1498.548] (-1493.049) -- 0:01:21
605000 -- (-1502.263) (-1500.778) (-1506.589) [-1498.493] * (-1503.120) (-1494.374) (-1498.407) [-1506.595] -- 0:01:21
Average standard deviation of split frequencies: 0.000000
605500 -- (-1491.512) [-1495.437] (-1493.716) (-1502.630) * [-1494.288] (-1504.410) (-1503.849) (-1496.567) -- 0:01:21
606000 -- (-1496.994) (-1500.863) [-1493.116] (-1499.091) * (-1498.731) (-1501.409) [-1498.855] (-1500.764) -- 0:01:21
606500 -- (-1497.019) (-1500.095) (-1498.039) [-1502.867] * [-1495.541] (-1493.301) (-1500.566) (-1500.349) -- 0:01:21
607000 -- (-1496.321) (-1495.421) (-1494.922) [-1492.413] * (-1498.943) [-1492.508] (-1500.709) (-1495.591) -- 0:01:21
607500 -- (-1501.788) (-1495.227) [-1490.901] (-1491.478) * [-1498.459] (-1493.716) (-1491.677) (-1500.584) -- 0:01:21
608000 -- (-1494.257) (-1497.578) [-1496.354] (-1495.235) * (-1501.492) (-1491.737) (-1504.770) [-1496.485] -- 0:01:21
608500 -- (-1497.779) [-1492.080] (-1491.256) (-1500.387) * (-1505.341) (-1494.699) [-1499.802] (-1498.531) -- 0:01:21
609000 -- (-1497.466) (-1494.110) (-1497.044) [-1496.026] * (-1496.282) (-1494.485) (-1495.175) [-1489.803] -- 0:01:20
609500 -- (-1505.134) (-1496.294) [-1494.341] (-1495.485) * (-1497.421) (-1492.418) [-1495.111] (-1508.981) -- 0:01:20
610000 -- (-1501.213) (-1493.303) (-1502.701) [-1494.867] * (-1495.423) (-1496.449) (-1499.423) [-1495.817] -- 0:01:20
Average standard deviation of split frequencies: 0.000000
610500 -- [-1497.376] (-1505.100) (-1495.922) (-1499.426) * (-1493.262) [-1493.623] (-1499.593) (-1496.403) -- 0:01:20
611000 -- (-1496.848) (-1496.943) (-1501.147) [-1494.464] * (-1500.700) [-1499.018] (-1492.006) (-1495.962) -- 0:01:20
611500 -- (-1501.413) [-1497.998] (-1500.923) (-1496.907) * (-1501.042) (-1496.292) (-1503.422) [-1496.434] -- 0:01:20
612000 -- (-1498.930) (-1505.679) (-1494.891) [-1511.819] * (-1496.385) [-1498.643] (-1497.053) (-1496.040) -- 0:01:20
612500 -- (-1500.034) (-1504.795) [-1492.141] (-1498.792) * (-1500.784) (-1499.924) (-1495.410) [-1501.787] -- 0:01:20
613000 -- (-1500.885) (-1497.996) (-1496.649) [-1498.746] * [-1498.062] (-1495.255) (-1495.312) (-1499.279) -- 0:01:20
613500 -- (-1493.366) [-1499.641] (-1495.001) (-1499.043) * [-1494.816] (-1509.922) (-1495.140) (-1500.768) -- 0:01:20
614000 -- [-1493.697] (-1495.685) (-1495.041) (-1498.699) * (-1494.949) (-1495.894) [-1496.246] (-1495.585) -- 0:01:19
614500 -- [-1493.160] (-1497.365) (-1495.139) (-1499.897) * [-1499.425] (-1502.493) (-1495.008) (-1496.557) -- 0:01:19
615000 -- (-1498.166) (-1493.402) [-1498.396] (-1498.611) * (-1500.929) (-1502.467) [-1492.861] (-1493.815) -- 0:01:19
Average standard deviation of split frequencies: 0.000383
615500 -- [-1494.832] (-1491.822) (-1493.399) (-1501.768) * (-1492.150) (-1493.368) (-1500.048) [-1504.737] -- 0:01:19
616000 -- (-1495.735) (-1500.913) [-1497.126] (-1501.513) * [-1497.722] (-1500.020) (-1499.325) (-1502.111) -- 0:01:19
616500 -- (-1495.918) [-1493.328] (-1490.145) (-1499.698) * (-1495.737) (-1500.016) (-1497.829) [-1503.275] -- 0:01:19
617000 -- (-1492.334) (-1490.605) [-1497.114] (-1496.241) * [-1499.985] (-1496.311) (-1499.002) (-1502.063) -- 0:01:19
617500 -- [-1496.260] (-1491.466) (-1505.906) (-1496.843) * (-1501.888) [-1502.531] (-1495.985) (-1495.034) -- 0:01:19
618000 -- (-1495.991) [-1502.327] (-1497.172) (-1501.360) * [-1492.695] (-1496.569) (-1499.970) (-1497.275) -- 0:01:19
618500 -- (-1496.359) (-1500.861) (-1497.401) [-1497.505] * (-1495.708) (-1494.272) [-1491.019] (-1497.022) -- 0:01:18
619000 -- (-1498.154) (-1493.821) [-1498.524] (-1500.153) * (-1495.579) [-1491.806] (-1492.804) (-1499.046) -- 0:01:18
619500 -- (-1503.974) [-1496.409] (-1493.212) (-1497.525) * (-1503.124) (-1497.126) [-1495.650] (-1496.669) -- 0:01:18
620000 -- (-1501.656) [-1493.622] (-1491.974) (-1498.202) * [-1497.666] (-1495.271) (-1501.566) (-1497.865) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
620500 -- (-1498.733) (-1498.216) [-1497.078] (-1494.896) * (-1500.679) [-1491.295] (-1501.966) (-1500.514) -- 0:01:18
621000 -- (-1497.093) (-1505.183) [-1499.812] (-1496.444) * (-1493.362) (-1490.768) [-1501.216] (-1498.353) -- 0:01:18
621500 -- (-1492.977) (-1501.291) (-1503.005) [-1493.021] * (-1490.191) (-1501.027) [-1492.949] (-1499.041) -- 0:01:18
622000 -- (-1496.865) (-1497.680) (-1497.465) [-1496.847] * (-1492.651) (-1493.528) [-1492.603] (-1500.753) -- 0:01:18
622500 -- (-1498.543) [-1494.087] (-1493.167) (-1502.400) * (-1492.071) (-1498.341) [-1503.275] (-1502.274) -- 0:01:18
623000 -- (-1493.015) (-1495.653) (-1503.796) [-1493.244] * (-1492.444) (-1506.649) [-1493.406] (-1500.071) -- 0:01:18
623500 -- (-1500.658) [-1496.653] (-1497.368) (-1500.573) * [-1492.573] (-1491.642) (-1498.785) (-1504.666) -- 0:01:17
624000 -- (-1498.810) (-1499.859) (-1497.359) [-1497.934] * [-1492.766] (-1496.476) (-1492.937) (-1495.451) -- 0:01:17
624500 -- [-1492.704] (-1497.784) (-1505.717) (-1500.074) * (-1496.265) (-1496.235) (-1497.066) [-1492.318] -- 0:01:17
625000 -- (-1500.083) (-1506.404) (-1505.404) [-1496.424] * (-1494.525) [-1493.909] (-1494.225) (-1500.931) -- 0:01:17
Average standard deviation of split frequencies: 0.000000
625500 -- (-1494.987) [-1492.303] (-1500.891) (-1496.127) * (-1491.175) [-1497.201] (-1497.104) (-1501.115) -- 0:01:17
626000 -- (-1501.476) (-1503.759) [-1492.813] (-1499.282) * (-1497.742) (-1494.740) [-1502.210] (-1495.652) -- 0:01:17
626500 -- (-1493.664) (-1500.238) [-1496.462] (-1497.937) * [-1496.004] (-1491.538) (-1495.957) (-1500.104) -- 0:01:17
627000 -- [-1496.357] (-1502.110) (-1503.027) (-1499.255) * (-1493.379) [-1492.564] (-1506.239) (-1504.745) -- 0:01:17
627500 -- (-1495.426) (-1501.934) (-1499.433) [-1499.348] * [-1499.195] (-1491.284) (-1499.769) (-1506.150) -- 0:01:17
628000 -- (-1491.702) (-1493.647) [-1496.734] (-1504.427) * [-1491.221] (-1491.301) (-1497.180) (-1500.979) -- 0:01:17
628500 -- (-1494.390) (-1494.606) (-1495.584) [-1496.607] * (-1493.812) (-1501.845) [-1496.305] (-1497.037) -- 0:01:16
629000 -- (-1492.053) (-1502.220) (-1501.770) [-1497.526] * (-1489.339) (-1495.542) [-1494.737] (-1504.952) -- 0:01:16
629500 -- (-1501.787) (-1500.093) (-1502.328) [-1497.948] * (-1495.582) [-1491.675] (-1496.449) (-1501.569) -- 0:01:16
630000 -- (-1502.066) (-1494.057) (-1497.505) [-1501.781] * (-1495.665) [-1494.871] (-1497.185) (-1492.570) -- 0:01:16
Average standard deviation of split frequencies: 0.000000
630500 -- [-1498.978] (-1497.730) (-1498.674) (-1503.261) * (-1493.151) (-1499.604) (-1496.593) [-1498.758] -- 0:01:16
631000 -- (-1494.358) (-1503.536) (-1498.488) [-1496.000] * (-1497.385) [-1494.686] (-1496.138) (-1501.463) -- 0:01:16
631500 -- (-1504.221) (-1498.582) (-1496.553) [-1489.488] * (-1500.672) [-1494.552] (-1496.064) (-1496.417) -- 0:01:16
632000 -- (-1490.404) [-1492.345] (-1493.371) (-1498.558) * (-1504.191) [-1495.496] (-1496.005) (-1502.577) -- 0:01:16
632500 -- [-1493.907] (-1506.955) (-1499.753) (-1498.731) * (-1495.721) [-1496.599] (-1498.449) (-1496.532) -- 0:01:16
633000 -- [-1495.802] (-1503.033) (-1500.868) (-1500.189) * (-1495.264) (-1495.401) (-1494.204) [-1497.781] -- 0:01:15
633500 -- (-1499.668) (-1497.396) (-1500.387) [-1490.898] * (-1495.215) [-1498.470] (-1492.798) (-1498.681) -- 0:01:15
634000 -- (-1494.769) (-1501.775) (-1497.213) [-1492.969] * (-1502.414) (-1496.287) [-1499.206] (-1495.206) -- 0:01:15
634500 -- [-1493.787] (-1494.139) (-1500.567) (-1497.940) * (-1494.419) (-1489.359) (-1495.640) [-1491.816] -- 0:01:15
635000 -- (-1497.543) (-1496.174) (-1495.196) [-1495.286] * (-1501.232) [-1496.316] (-1495.813) (-1497.848) -- 0:01:15
Average standard deviation of split frequencies: 0.000000
635500 -- (-1498.769) [-1497.463] (-1501.765) (-1491.505) * (-1503.991) (-1502.410) (-1501.891) [-1498.707] -- 0:01:15
636000 -- [-1494.950] (-1493.098) (-1495.464) (-1497.255) * [-1496.692] (-1502.142) (-1502.914) (-1497.597) -- 0:01:15
636500 -- (-1494.214) [-1497.807] (-1500.047) (-1494.328) * (-1501.377) [-1495.892] (-1497.887) (-1504.296) -- 0:01:15
637000 -- (-1490.828) (-1502.956) [-1494.026] (-1498.059) * (-1499.204) (-1491.934) (-1495.668) [-1492.057] -- 0:01:15
637500 -- (-1490.605) (-1502.468) [-1498.154] (-1507.069) * (-1496.930) [-1493.706] (-1493.666) (-1493.036) -- 0:01:15
638000 -- [-1492.274] (-1503.044) (-1499.869) (-1501.557) * (-1503.548) [-1494.695] (-1499.553) (-1496.097) -- 0:01:14
638500 -- (-1500.298) (-1497.437) [-1495.122] (-1496.668) * (-1492.849) (-1491.745) (-1497.611) [-1492.540] -- 0:01:14
639000 -- [-1489.754] (-1495.681) (-1503.194) (-1499.953) * [-1496.499] (-1494.191) (-1503.695) (-1492.563) -- 0:01:14
639500 -- (-1495.185) [-1497.060] (-1494.695) (-1499.478) * (-1497.895) (-1495.628) (-1500.334) [-1494.725] -- 0:01:14
640000 -- [-1497.564] (-1498.345) (-1496.475) (-1496.702) * (-1496.715) (-1493.267) (-1494.128) [-1496.457] -- 0:01:14
Average standard deviation of split frequencies: 0.000000
640500 -- [-1491.874] (-1504.430) (-1494.388) (-1492.760) * [-1501.977] (-1496.481) (-1499.973) (-1503.720) -- 0:01:14
641000 -- [-1496.857] (-1510.829) (-1495.846) (-1502.749) * (-1494.053) (-1495.146) (-1495.356) [-1491.723] -- 0:01:14
641500 -- (-1493.048) (-1504.872) [-1491.945] (-1494.851) * (-1504.769) [-1495.881] (-1496.526) (-1501.654) -- 0:01:14
642000 -- (-1505.036) (-1506.565) [-1493.596] (-1493.621) * (-1506.170) [-1499.098] (-1498.654) (-1502.277) -- 0:01:14
642500 -- (-1497.367) (-1496.438) [-1494.502] (-1495.210) * (-1494.516) (-1495.785) [-1493.510] (-1496.211) -- 0:01:14
643000 -- [-1496.089] (-1499.291) (-1498.063) (-1498.025) * [-1494.942] (-1501.515) (-1499.909) (-1495.268) -- 0:01:13
643500 -- [-1496.191] (-1492.095) (-1497.304) (-1494.445) * (-1494.910) (-1494.602) [-1494.830] (-1500.610) -- 0:01:13
644000 -- [-1493.482] (-1496.654) (-1493.556) (-1494.421) * [-1490.755] (-1501.799) (-1495.311) (-1500.580) -- 0:01:13
644500 -- (-1491.528) (-1496.833) (-1493.968) [-1498.463] * (-1494.655) (-1495.225) (-1497.311) [-1493.418] -- 0:01:13
645000 -- (-1493.804) [-1493.806] (-1499.413) (-1507.416) * (-1502.438) (-1501.328) (-1502.505) [-1498.220] -- 0:01:13
Average standard deviation of split frequencies: 0.000000
645500 -- (-1495.565) (-1496.477) (-1498.238) [-1493.065] * (-1506.845) (-1497.119) (-1497.395) [-1496.535] -- 0:01:13
646000 -- (-1494.835) (-1495.944) (-1496.052) [-1500.995] * (-1506.984) (-1495.441) [-1492.791] (-1496.729) -- 0:01:13
646500 -- [-1492.340] (-1500.254) (-1492.041) (-1500.062) * (-1504.557) [-1495.872] (-1491.214) (-1501.774) -- 0:01:13
647000 -- (-1496.027) (-1501.323) [-1489.617] (-1499.449) * [-1501.007] (-1493.652) (-1497.122) (-1499.883) -- 0:01:13
647500 -- (-1499.989) (-1495.832) [-1497.548] (-1491.442) * [-1498.758] (-1507.235) (-1497.456) (-1502.629) -- 0:01:12
648000 -- (-1499.903) (-1498.357) (-1493.989) [-1491.989] * (-1498.209) (-1496.545) (-1500.973) [-1498.497] -- 0:01:12
648500 -- (-1497.670) (-1495.040) (-1498.071) [-1492.841] * (-1502.956) (-1500.077) (-1498.870) [-1498.844] -- 0:01:12
649000 -- [-1500.968] (-1493.226) (-1502.220) (-1496.117) * (-1504.921) (-1496.370) (-1493.490) [-1496.373] -- 0:01:12
649500 -- [-1497.291] (-1490.933) (-1493.877) (-1500.174) * (-1503.692) [-1489.671] (-1494.421) (-1499.383) -- 0:01:12
650000 -- (-1498.106) (-1493.495) [-1495.514] (-1495.644) * (-1498.424) (-1497.730) (-1496.430) [-1495.769] -- 0:01:12
Average standard deviation of split frequencies: 0.000000
650500 -- (-1493.605) (-1500.727) (-1495.562) [-1493.846] * (-1498.166) (-1496.716) [-1493.016] (-1500.071) -- 0:01:12
651000 -- [-1491.989] (-1492.191) (-1490.995) (-1498.548) * (-1496.670) (-1497.579) [-1493.445] (-1498.745) -- 0:01:12
651500 -- (-1492.795) (-1498.608) [-1491.980] (-1498.072) * (-1500.457) (-1496.291) (-1491.558) [-1496.631] -- 0:01:12
652000 -- [-1500.586] (-1494.086) (-1490.586) (-1503.891) * (-1499.338) (-1496.802) [-1495.496] (-1499.133) -- 0:01:12
652500 -- [-1492.061] (-1495.470) (-1500.214) (-1496.720) * (-1497.571) [-1500.435] (-1492.919) (-1501.921) -- 0:01:11
653000 -- (-1497.859) (-1501.992) (-1497.329) [-1493.415] * (-1501.323) (-1496.633) [-1495.873] (-1493.124) -- 0:01:11
653500 -- (-1500.843) (-1496.213) [-1497.252] (-1505.291) * (-1494.044) (-1505.550) [-1493.485] (-1503.414) -- 0:01:11
654000 -- [-1492.501] (-1504.280) (-1499.531) (-1499.464) * [-1499.840] (-1503.068) (-1500.395) (-1491.414) -- 0:01:11
654500 -- (-1491.269) (-1499.718) (-1499.355) [-1499.704] * (-1498.844) (-1501.195) (-1497.134) [-1492.848] -- 0:01:11
655000 -- [-1493.051] (-1497.153) (-1500.343) (-1500.133) * (-1499.620) (-1500.360) [-1498.982] (-1490.810) -- 0:01:11
Average standard deviation of split frequencies: 0.000000
655500 -- (-1494.721) (-1493.438) (-1493.935) [-1491.973] * (-1493.133) (-1497.852) [-1493.127] (-1498.570) -- 0:01:11
656000 -- (-1493.299) (-1497.510) (-1495.370) [-1497.215] * [-1497.767] (-1494.529) (-1496.816) (-1507.596) -- 0:01:11
656500 -- (-1491.367) (-1497.240) [-1497.988] (-1501.184) * (-1498.837) (-1499.378) [-1497.436] (-1495.737) -- 0:01:11
657000 -- [-1494.933] (-1498.484) (-1496.566) (-1500.706) * [-1497.624] (-1500.419) (-1499.908) (-1496.054) -- 0:01:11
657500 -- (-1499.386) (-1497.689) [-1497.332] (-1492.728) * (-1501.316) [-1503.575] (-1497.466) (-1500.248) -- 0:01:10
658000 -- (-1491.846) (-1494.355) [-1496.786] (-1492.264) * (-1496.421) [-1498.663] (-1497.805) (-1496.052) -- 0:01:10
658500 -- (-1502.182) [-1494.553] (-1501.454) (-1491.090) * (-1504.412) (-1502.567) (-1499.166) [-1495.520] -- 0:01:10
659000 -- (-1501.414) [-1496.257] (-1495.920) (-1497.531) * (-1496.469) (-1499.286) [-1497.380] (-1493.309) -- 0:01:10
659500 -- [-1503.521] (-1494.853) (-1493.996) (-1503.018) * (-1496.595) (-1494.924) (-1493.923) [-1494.553] -- 0:01:10
660000 -- (-1495.758) (-1493.976) [-1492.977] (-1498.473) * (-1502.900) (-1496.656) (-1501.111) [-1498.981] -- 0:01:10
Average standard deviation of split frequencies: 0.000000
660500 -- (-1502.485) [-1490.949] (-1502.837) (-1493.245) * (-1501.863) (-1496.351) [-1499.426] (-1490.227) -- 0:01:10
661000 -- (-1501.243) (-1503.955) (-1498.706) [-1493.093] * (-1498.250) [-1498.983] (-1498.554) (-1500.332) -- 0:01:10
661500 -- (-1504.253) [-1493.540] (-1496.178) (-1491.746) * (-1501.106) [-1497.076] (-1493.044) (-1496.485) -- 0:01:10
662000 -- (-1502.467) [-1494.506] (-1497.020) (-1491.293) * [-1498.525] (-1495.982) (-1495.786) (-1494.830) -- 0:01:09
662500 -- (-1497.888) (-1496.988) [-1499.142] (-1492.340) * [-1495.910] (-1498.705) (-1499.815) (-1497.463) -- 0:01:09
663000 -- [-1493.148] (-1492.506) (-1490.329) (-1495.767) * (-1500.204) (-1497.707) [-1496.735] (-1496.448) -- 0:01:09
663500 -- (-1500.664) (-1502.292) (-1493.950) [-1493.636] * (-1491.980) [-1498.991] (-1498.426) (-1501.012) -- 0:01:09
664000 -- (-1499.784) [-1492.535] (-1498.614) (-1498.099) * (-1498.806) (-1492.971) [-1497.878] (-1507.674) -- 0:01:09
664500 -- (-1498.963) (-1501.008) [-1497.299] (-1494.518) * (-1491.919) (-1499.108) [-1492.747] (-1510.027) -- 0:01:09
665000 -- (-1506.349) (-1498.503) (-1504.211) [-1495.676] * (-1489.899) (-1505.510) [-1494.692] (-1498.678) -- 0:01:09
Average standard deviation of split frequencies: 0.000000
665500 -- [-1498.558] (-1495.747) (-1504.835) (-1492.783) * [-1494.837] (-1499.306) (-1495.130) (-1498.532) -- 0:01:09
666000 -- [-1492.404] (-1498.173) (-1496.835) (-1503.882) * (-1498.963) (-1496.941) [-1493.259] (-1502.035) -- 0:01:09
666500 -- (-1493.765) (-1497.919) [-1497.864] (-1501.276) * (-1498.833) [-1501.110] (-1503.451) (-1499.586) -- 0:01:09
667000 -- (-1494.681) [-1494.653] (-1498.646) (-1501.579) * (-1499.525) [-1502.256] (-1499.677) (-1496.006) -- 0:01:08
667500 -- (-1491.430) (-1493.730) [-1493.028] (-1500.855) * [-1497.718] (-1496.626) (-1495.318) (-1492.475) -- 0:01:08
668000 -- [-1496.122] (-1490.957) (-1501.301) (-1499.342) * (-1500.685) (-1493.158) (-1495.775) [-1494.920] -- 0:01:08
668500 -- [-1492.745] (-1494.791) (-1500.774) (-1501.317) * [-1490.999] (-1498.533) (-1495.826) (-1493.641) -- 0:01:08
669000 -- (-1495.213) (-1496.336) [-1495.520] (-1494.633) * (-1492.398) [-1495.939] (-1494.718) (-1496.900) -- 0:01:08
669500 -- (-1496.730) (-1503.648) [-1494.328] (-1501.773) * (-1498.041) (-1489.491) [-1492.373] (-1504.399) -- 0:01:08
670000 -- [-1493.085] (-1500.528) (-1495.227) (-1504.936) * (-1500.842) (-1498.076) [-1495.717] (-1492.325) -- 0:01:08
Average standard deviation of split frequencies: 0.000000
670500 -- (-1495.130) [-1494.929] (-1501.455) (-1502.833) * [-1494.831] (-1497.634) (-1495.272) (-1500.974) -- 0:01:08
671000 -- [-1492.844] (-1495.706) (-1499.617) (-1498.685) * (-1497.715) [-1493.744] (-1499.859) (-1502.038) -- 0:01:08
671500 -- (-1495.423) (-1496.193) [-1492.770] (-1503.940) * (-1497.122) (-1501.560) [-1494.715] (-1510.070) -- 0:01:07
672000 -- [-1496.754] (-1495.174) (-1503.838) (-1496.451) * (-1499.054) (-1493.846) [-1495.647] (-1498.483) -- 0:01:07
672500 -- (-1497.575) (-1495.542) [-1492.209] (-1492.440) * (-1500.508) [-1491.103] (-1493.907) (-1502.060) -- 0:01:07
673000 -- (-1500.193) [-1493.413] (-1505.025) (-1493.450) * (-1499.796) [-1499.337] (-1500.378) (-1498.523) -- 0:01:07
673500 -- [-1492.632] (-1498.482) (-1493.575) (-1496.513) * (-1500.853) (-1499.472) (-1497.798) [-1495.279] -- 0:01:07
674000 -- (-1492.099) (-1495.858) [-1490.123] (-1510.680) * [-1496.210] (-1495.615) (-1498.270) (-1497.912) -- 0:01:07
674500 -- [-1494.917] (-1497.026) (-1494.320) (-1499.324) * [-1496.472] (-1493.626) (-1503.768) (-1504.673) -- 0:01:07
675000 -- (-1499.041) (-1490.522) (-1499.290) [-1495.839] * (-1497.681) (-1504.988) (-1499.557) [-1493.479] -- 0:01:07
Average standard deviation of split frequencies: 0.000349
675500 -- (-1496.155) (-1496.226) [-1495.993] (-1498.079) * [-1498.245] (-1497.284) (-1495.959) (-1493.651) -- 0:01:07
676000 -- (-1492.639) (-1496.098) [-1501.335] (-1499.787) * (-1501.121) [-1495.695] (-1498.207) (-1493.304) -- 0:01:07
676500 -- (-1496.666) (-1495.220) (-1497.613) [-1502.408] * (-1505.687) (-1500.240) [-1497.678] (-1508.975) -- 0:01:06
677000 -- (-1507.795) (-1494.050) (-1501.707) [-1494.154] * (-1495.868) (-1497.018) (-1492.245) [-1502.902] -- 0:01:06
677500 -- (-1498.787) [-1497.990] (-1493.516) (-1502.037) * [-1496.873] (-1491.252) (-1497.677) (-1498.431) -- 0:01:06
678000 -- (-1499.745) [-1491.622] (-1501.221) (-1496.042) * (-1495.720) (-1499.546) [-1497.026] (-1493.007) -- 0:01:06
678500 -- (-1491.918) (-1502.950) (-1491.449) [-1498.879] * [-1494.925] (-1494.464) (-1492.861) (-1494.496) -- 0:01:06
679000 -- (-1493.869) (-1493.391) [-1497.477] (-1501.508) * (-1494.760) (-1496.361) [-1494.963] (-1499.678) -- 0:01:06
679500 -- (-1499.920) (-1496.028) (-1501.210) [-1496.339] * (-1497.532) [-1499.344] (-1494.023) (-1496.095) -- 0:01:06
680000 -- [-1493.731] (-1496.500) (-1492.269) (-1498.038) * [-1496.397] (-1511.192) (-1501.600) (-1493.351) -- 0:01:06
Average standard deviation of split frequencies: 0.000693
680500 -- (-1504.138) [-1497.422] (-1495.694) (-1499.376) * (-1496.998) (-1497.374) [-1492.405] (-1493.781) -- 0:01:06
681000 -- (-1506.911) [-1497.935] (-1492.765) (-1496.150) * (-1492.693) (-1495.191) (-1494.600) [-1498.486] -- 0:01:06
681500 -- (-1496.548) (-1500.640) [-1491.013] (-1495.351) * (-1495.733) [-1495.200] (-1492.493) (-1490.717) -- 0:01:05
682000 -- (-1493.400) (-1494.239) [-1493.729] (-1498.466) * (-1495.847) (-1496.317) (-1492.272) [-1495.246] -- 0:01:06
682500 -- (-1509.444) (-1495.871) [-1496.426] (-1494.209) * (-1492.089) (-1496.873) (-1493.053) [-1496.166] -- 0:01:06
683000 -- [-1491.969] (-1493.225) (-1495.789) (-1493.849) * (-1496.206) (-1502.829) [-1489.524] (-1494.528) -- 0:01:05
683500 -- (-1496.617) [-1499.352] (-1491.028) (-1493.717) * [-1495.638] (-1498.650) (-1492.725) (-1499.009) -- 0:01:05
684000 -- (-1499.726) (-1501.966) (-1493.570) [-1492.024] * (-1493.834) [-1496.478] (-1496.542) (-1503.914) -- 0:01:05
684500 -- [-1496.451] (-1500.584) (-1503.688) (-1492.453) * (-1496.851) (-1500.702) [-1498.345] (-1498.525) -- 0:01:05
685000 -- (-1499.245) (-1498.673) [-1498.491] (-1499.612) * [-1496.162] (-1501.544) (-1497.041) (-1493.356) -- 0:01:05
Average standard deviation of split frequencies: 0.000687
685500 -- (-1496.227) [-1493.951] (-1492.502) (-1496.251) * (-1497.750) [-1494.934] (-1498.648) (-1493.762) -- 0:01:05
686000 -- (-1498.416) (-1498.717) [-1491.890] (-1499.608) * (-1504.774) [-1501.037] (-1499.180) (-1505.879) -- 0:01:05
686500 -- [-1500.786] (-1499.923) (-1496.619) (-1498.481) * (-1501.239) [-1494.734] (-1499.882) (-1494.281) -- 0:01:05
687000 -- [-1493.826] (-1496.451) (-1497.033) (-1498.314) * (-1499.727) (-1505.208) [-1499.891] (-1502.919) -- 0:01:05
687500 -- [-1495.098] (-1496.376) (-1496.257) (-1502.384) * (-1497.019) (-1496.769) [-1495.140] (-1501.124) -- 0:01:05
688000 -- (-1502.843) (-1501.193) [-1497.007] (-1495.343) * (-1501.221) (-1505.539) (-1502.536) [-1498.430] -- 0:01:04
688500 -- (-1500.292) (-1496.255) [-1494.620] (-1497.112) * (-1496.243) [-1493.245] (-1499.550) (-1507.346) -- 0:01:04
689000 -- [-1496.950] (-1502.901) (-1496.601) (-1499.030) * (-1492.710) (-1501.029) [-1500.305] (-1498.265) -- 0:01:04
689500 -- (-1502.780) [-1499.013] (-1498.356) (-1494.834) * [-1493.581] (-1495.558) (-1494.162) (-1499.077) -- 0:01:04
690000 -- (-1503.684) (-1497.008) [-1495.357] (-1496.174) * (-1497.345) (-1494.831) (-1497.671) [-1497.059] -- 0:01:04
Average standard deviation of split frequencies: 0.001024
690500 -- (-1502.710) (-1500.462) (-1495.100) [-1494.701] * (-1497.107) (-1498.489) [-1498.810] (-1501.968) -- 0:01:04
691000 -- (-1497.710) [-1494.753] (-1497.439) (-1495.413) * (-1499.223) (-1493.336) [-1499.822] (-1500.748) -- 0:01:04
691500 -- (-1500.209) [-1495.308] (-1496.379) (-1497.542) * (-1496.897) (-1495.985) (-1495.885) [-1498.087] -- 0:01:04
692000 -- (-1498.083) (-1498.807) [-1497.245] (-1496.445) * (-1502.678) [-1491.630] (-1493.873) (-1498.679) -- 0:01:04
692500 -- (-1495.074) (-1492.982) (-1496.366) [-1489.191] * (-1497.716) (-1498.193) [-1493.150] (-1498.279) -- 0:01:03
693000 -- [-1491.783] (-1492.944) (-1500.610) (-1492.773) * [-1499.443] (-1498.472) (-1496.784) (-1499.426) -- 0:01:03
693500 -- [-1493.782] (-1496.642) (-1501.245) (-1492.884) * (-1497.239) (-1502.498) [-1492.890] (-1505.787) -- 0:01:03
694000 -- (-1497.631) (-1499.334) (-1492.549) [-1491.209] * [-1497.853] (-1505.227) (-1491.720) (-1498.013) -- 0:01:03
694500 -- (-1492.532) (-1503.726) (-1498.777) [-1492.431] * (-1497.179) (-1498.108) [-1493.540] (-1500.149) -- 0:01:03
695000 -- (-1495.864) [-1497.541] (-1493.246) (-1496.687) * (-1492.636) (-1496.507) (-1490.793) [-1492.199] -- 0:01:03
Average standard deviation of split frequencies: 0.001355
695500 -- [-1500.855] (-1500.438) (-1491.229) (-1500.968) * (-1494.988) (-1498.875) [-1498.789] (-1494.943) -- 0:01:03
696000 -- (-1503.741) (-1494.543) [-1492.827] (-1502.065) * (-1493.272) (-1504.536) (-1497.741) [-1494.207] -- 0:01:03
696500 -- (-1493.954) [-1493.756] (-1496.209) (-1493.665) * (-1499.048) [-1495.158] (-1502.967) (-1497.393) -- 0:01:03
697000 -- (-1496.054) [-1493.961] (-1496.931) (-1498.582) * (-1497.833) [-1495.060] (-1497.060) (-1495.671) -- 0:01:03
697500 -- (-1499.865) (-1500.512) [-1491.521] (-1503.284) * (-1498.039) [-1496.622] (-1504.720) (-1500.545) -- 0:01:02
698000 -- [-1496.564] (-1497.788) (-1496.707) (-1495.416) * (-1499.864) (-1503.899) (-1498.223) [-1493.406] -- 0:01:02
698500 -- (-1499.340) (-1495.039) [-1493.016] (-1499.195) * (-1498.187) (-1501.164) (-1496.293) [-1494.514] -- 0:01:02
699000 -- (-1494.088) [-1498.589] (-1493.298) (-1492.502) * (-1490.383) (-1495.170) (-1497.698) [-1500.928] -- 0:01:02
699500 -- [-1493.243] (-1504.685) (-1501.438) (-1497.223) * [-1494.148] (-1500.343) (-1497.197) (-1495.361) -- 0:01:02
700000 -- (-1495.816) (-1496.338) [-1503.548] (-1498.565) * (-1494.106) [-1500.238] (-1493.884) (-1496.936) -- 0:01:02
Average standard deviation of split frequencies: 0.001346
700500 -- [-1492.174] (-1497.580) (-1499.867) (-1498.527) * [-1495.040] (-1501.308) (-1497.356) (-1499.864) -- 0:01:02
701000 -- (-1501.063) (-1496.665) (-1498.053) [-1492.639] * (-1493.020) (-1492.935) (-1500.884) [-1496.724] -- 0:01:02
701500 -- [-1497.868] (-1493.982) (-1495.249) (-1493.564) * (-1492.757) (-1505.964) [-1496.876] (-1495.497) -- 0:01:02
702000 -- (-1491.109) [-1494.926] (-1500.085) (-1501.654) * (-1496.989) (-1500.141) (-1493.657) [-1504.813] -- 0:01:01
702500 -- (-1497.980) [-1496.016] (-1497.366) (-1496.972) * [-1492.724] (-1501.440) (-1503.202) (-1496.769) -- 0:01:01
703000 -- (-1507.124) [-1495.491] (-1495.271) (-1497.910) * (-1492.807) [-1500.901] (-1494.667) (-1492.689) -- 0:01:01
703500 -- (-1492.331) (-1496.637) [-1494.413] (-1493.471) * (-1493.159) (-1506.616) [-1498.516] (-1500.902) -- 0:01:01
704000 -- (-1495.089) (-1503.015) (-1492.392) [-1489.982] * (-1501.490) (-1506.991) (-1497.931) [-1494.905] -- 0:01:01
704500 -- (-1499.103) [-1492.117] (-1496.703) (-1500.016) * [-1496.758] (-1504.681) (-1495.847) (-1495.230) -- 0:01:01
705000 -- [-1498.519] (-1490.480) (-1498.186) (-1494.921) * [-1498.550] (-1497.289) (-1493.337) (-1496.900) -- 0:01:01
Average standard deviation of split frequencies: 0.001335
705500 -- [-1498.238] (-1491.451) (-1498.791) (-1498.691) * (-1491.982) [-1493.983] (-1502.990) (-1496.116) -- 0:01:01
706000 -- (-1511.412) [-1497.781] (-1498.124) (-1497.690) * (-1494.066) [-1495.096] (-1496.843) (-1495.678) -- 0:01:01
706500 -- (-1503.087) [-1497.437] (-1494.122) (-1502.632) * (-1496.065) (-1495.106) [-1492.963] (-1496.522) -- 0:01:01
707000 -- (-1498.940) [-1499.136] (-1499.350) (-1501.159) * [-1499.669] (-1488.886) (-1500.942) (-1494.388) -- 0:01:00
707500 -- (-1495.680) (-1495.372) (-1497.346) [-1497.178] * (-1497.311) (-1502.258) [-1500.892] (-1504.230) -- 0:01:00
708000 -- (-1502.443) (-1496.420) (-1498.302) [-1497.632] * (-1497.079) [-1495.289] (-1495.981) (-1499.764) -- 0:01:00
708500 -- (-1495.362) (-1493.731) (-1497.901) [-1499.830] * (-1496.146) (-1506.523) (-1498.587) [-1494.512] -- 0:01:00
709000 -- (-1499.762) (-1494.440) [-1492.793] (-1495.953) * [-1493.309] (-1496.021) (-1502.126) (-1493.125) -- 0:01:00
709500 -- (-1499.417) [-1497.858] (-1493.381) (-1498.009) * (-1495.239) (-1498.293) [-1492.513] (-1501.581) -- 0:01:00
710000 -- [-1494.175] (-1498.923) (-1504.043) (-1495.917) * (-1493.483) [-1498.857] (-1497.658) (-1493.630) -- 0:01:00
Average standard deviation of split frequencies: 0.001658
710500 -- [-1492.859] (-1506.852) (-1495.978) (-1498.009) * [-1495.638] (-1498.167) (-1498.405) (-1501.764) -- 0:01:00
711000 -- [-1493.274] (-1501.354) (-1502.389) (-1495.645) * (-1505.354) (-1502.798) (-1497.660) [-1494.826] -- 0:01:00
711500 -- (-1499.162) (-1492.578) (-1506.418) [-1492.954] * (-1505.756) (-1502.664) (-1498.199) [-1500.613] -- 0:01:00
712000 -- (-1502.362) [-1492.850] (-1497.641) (-1493.264) * [-1501.035] (-1497.152) (-1495.649) (-1497.661) -- 0:00:59
712500 -- (-1499.661) (-1494.403) [-1492.650] (-1504.243) * (-1500.794) (-1494.944) (-1494.163) [-1497.514] -- 0:00:59
713000 -- (-1502.026) (-1507.299) [-1493.116] (-1497.888) * (-1501.205) [-1496.739] (-1497.008) (-1496.088) -- 0:00:59
713500 -- [-1498.504] (-1494.808) (-1503.335) (-1494.520) * [-1498.366] (-1496.052) (-1497.529) (-1497.677) -- 0:00:59
714000 -- (-1494.663) (-1498.831) (-1508.018) [-1493.756] * [-1491.648] (-1496.036) (-1496.392) (-1497.675) -- 0:00:59
714500 -- (-1496.175) (-1494.094) (-1506.286) [-1492.336] * (-1496.730) (-1496.523) [-1493.284] (-1494.310) -- 0:00:59
715000 -- (-1491.742) (-1496.837) (-1500.545) [-1497.839] * (-1509.309) (-1495.116) [-1494.244] (-1498.053) -- 0:00:59
Average standard deviation of split frequencies: 0.001646
715500 -- (-1500.937) (-1499.966) (-1498.145) [-1492.459] * (-1501.843) (-1500.602) [-1494.132] (-1497.335) -- 0:00:59
716000 -- (-1492.324) (-1497.770) (-1504.547) [-1496.142] * (-1502.287) (-1499.861) [-1492.220] (-1494.210) -- 0:00:59
716500 -- (-1495.492) (-1496.226) (-1497.403) [-1496.329] * (-1497.545) [-1497.593] (-1495.187) (-1494.818) -- 0:00:58
717000 -- (-1503.867) (-1495.487) [-1499.454] (-1501.192) * [-1494.017] (-1498.394) (-1498.327) (-1493.077) -- 0:00:58
717500 -- (-1499.302) [-1493.721] (-1494.599) (-1499.132) * [-1494.326] (-1501.628) (-1499.781) (-1499.518) -- 0:00:58
718000 -- (-1492.748) (-1501.134) [-1493.407] (-1493.164) * (-1493.880) (-1495.135) (-1501.078) [-1498.772] -- 0:00:58
718500 -- (-1493.227) [-1497.698] (-1494.903) (-1498.641) * [-1501.447] (-1497.927) (-1494.027) (-1495.852) -- 0:00:58
719000 -- (-1498.443) (-1491.463) [-1497.734] (-1496.533) * (-1495.461) (-1501.564) (-1497.914) [-1506.141] -- 0:00:58
719500 -- [-1494.963] (-1494.178) (-1493.081) (-1499.011) * (-1502.391) [-1496.695] (-1499.652) (-1498.048) -- 0:00:58
720000 -- (-1493.983) [-1494.656] (-1496.198) (-1496.505) * (-1497.818) (-1497.674) (-1497.915) [-1492.076] -- 0:00:58
Average standard deviation of split frequencies: 0.001635
720500 -- (-1492.600) [-1495.994] (-1494.128) (-1498.056) * (-1498.803) (-1496.512) [-1497.642] (-1492.729) -- 0:00:58
721000 -- (-1493.180) (-1498.223) (-1493.523) [-1497.206] * (-1495.884) (-1498.018) [-1490.541] (-1495.437) -- 0:00:58
721500 -- (-1495.989) (-1500.091) (-1496.608) [-1496.297] * (-1497.365) (-1492.209) (-1491.762) [-1493.658] -- 0:00:57
722000 -- [-1494.351] (-1496.603) (-1497.002) (-1499.549) * [-1495.232] (-1490.860) (-1496.283) (-1495.269) -- 0:00:57
722500 -- (-1495.290) [-1498.987] (-1500.609) (-1493.122) * [-1495.195] (-1496.361) (-1503.912) (-1499.327) -- 0:00:57
723000 -- [-1494.362] (-1492.787) (-1495.999) (-1497.795) * (-1503.888) [-1494.864] (-1496.228) (-1498.517) -- 0:00:57
723500 -- (-1496.068) [-1497.345] (-1499.257) (-1498.578) * [-1498.874] (-1498.715) (-1497.047) (-1503.560) -- 0:00:57
724000 -- (-1493.352) [-1497.041] (-1498.362) (-1502.483) * (-1497.737) [-1496.160] (-1499.191) (-1502.818) -- 0:00:57
724500 -- (-1497.416) (-1495.902) (-1499.266) [-1501.315] * [-1490.067] (-1494.499) (-1504.696) (-1505.871) -- 0:00:57
725000 -- (-1495.149) (-1500.029) (-1508.361) [-1501.250] * (-1498.665) (-1499.066) (-1499.852) [-1496.658] -- 0:00:57
Average standard deviation of split frequencies: 0.001299
725500 -- (-1495.560) (-1493.878) [-1495.604] (-1493.511) * [-1499.411] (-1505.641) (-1507.003) (-1495.684) -- 0:00:57
726000 -- (-1489.880) (-1496.464) [-1496.902] (-1497.594) * (-1498.808) (-1496.746) [-1495.238] (-1491.694) -- 0:00:56
726500 -- (-1492.270) (-1490.011) (-1493.864) [-1497.169] * (-1494.996) [-1497.661] (-1494.264) (-1494.028) -- 0:00:56
727000 -- [-1495.439] (-1493.768) (-1498.276) (-1497.752) * (-1494.431) (-1500.442) (-1493.088) [-1494.184] -- 0:00:56
727500 -- [-1493.549] (-1494.545) (-1500.307) (-1492.206) * [-1493.952] (-1498.909) (-1493.400) (-1503.804) -- 0:00:56
728000 -- [-1495.519] (-1492.614) (-1496.508) (-1497.584) * (-1501.858) (-1499.599) [-1496.833] (-1494.582) -- 0:00:56
728500 -- (-1495.951) (-1496.483) (-1494.764) [-1493.526] * (-1497.580) (-1496.574) [-1492.772] (-1495.059) -- 0:00:56
729000 -- (-1493.139) (-1498.609) (-1498.080) [-1494.025] * [-1494.192] (-1492.731) (-1493.830) (-1498.881) -- 0:00:56
729500 -- (-1501.280) (-1504.493) (-1493.859) [-1495.302] * (-1497.502) [-1494.421] (-1498.927) (-1495.487) -- 0:00:56
730000 -- [-1491.906] (-1496.828) (-1493.336) (-1495.166) * (-1498.547) (-1500.558) (-1498.179) [-1495.813] -- 0:00:56
Average standard deviation of split frequencies: 0.001290
730500 -- (-1497.052) (-1499.985) [-1492.273] (-1494.584) * (-1499.929) [-1497.320] (-1499.390) (-1498.849) -- 0:00:56
731000 -- (-1495.069) (-1500.256) [-1494.734] (-1494.353) * (-1508.894) [-1496.733] (-1496.379) (-1498.817) -- 0:00:55
731500 -- [-1495.763] (-1501.418) (-1496.540) (-1498.710) * [-1495.623] (-1495.866) (-1494.093) (-1502.776) -- 0:00:55
732000 -- [-1501.186] (-1496.707) (-1497.595) (-1492.414) * (-1493.964) [-1496.474] (-1497.727) (-1494.074) -- 0:00:55
732500 -- [-1495.692] (-1495.876) (-1495.477) (-1499.306) * (-1501.429) [-1497.691] (-1499.548) (-1492.690) -- 0:00:55
733000 -- (-1503.188) (-1492.596) [-1490.183] (-1498.985) * (-1494.097) [-1493.239] (-1492.143) (-1494.888) -- 0:00:55
733500 -- (-1501.770) [-1497.395] (-1500.483) (-1500.913) * (-1497.661) (-1494.336) (-1496.674) [-1497.738] -- 0:00:55
734000 -- (-1502.573) (-1493.289) [-1493.813] (-1494.335) * (-1497.523) [-1494.319] (-1500.204) (-1500.233) -- 0:00:55
734500 -- (-1501.393) (-1500.512) [-1501.567] (-1497.205) * (-1493.158) (-1498.886) (-1498.437) [-1496.553] -- 0:00:55
735000 -- (-1501.530) (-1496.541) [-1500.118] (-1500.770) * (-1496.566) (-1491.545) [-1507.369] (-1503.683) -- 0:00:55
Average standard deviation of split frequencies: 0.001281
735500 -- (-1496.243) (-1502.219) [-1494.775] (-1496.555) * [-1498.470] (-1496.226) (-1496.153) (-1492.657) -- 0:00:55
736000 -- (-1500.410) [-1501.350] (-1495.320) (-1500.971) * [-1494.610] (-1502.181) (-1498.040) (-1498.464) -- 0:00:54
736500 -- (-1495.375) [-1501.087] (-1498.191) (-1493.870) * (-1498.919) (-1502.439) [-1493.415] (-1503.838) -- 0:00:54
737000 -- [-1496.165] (-1502.193) (-1491.091) (-1497.779) * [-1496.893] (-1504.161) (-1498.723) (-1496.541) -- 0:00:54
737500 -- (-1490.331) (-1501.923) [-1495.690] (-1498.838) * (-1504.028) (-1502.733) (-1497.843) [-1495.839] -- 0:00:54
738000 -- (-1493.404) (-1499.728) [-1494.330] (-1498.591) * [-1496.590] (-1495.207) (-1495.528) (-1499.249) -- 0:00:54
738500 -- (-1493.673) (-1506.644) [-1494.589] (-1493.678) * (-1497.790) (-1500.240) [-1497.621] (-1498.581) -- 0:00:54
739000 -- [-1493.351] (-1497.487) (-1496.939) (-1501.857) * [-1497.778] (-1496.708) (-1506.509) (-1508.315) -- 0:00:54
739500 -- (-1497.729) (-1504.069) (-1500.788) [-1494.732] * (-1497.077) [-1495.508] (-1499.294) (-1497.090) -- 0:00:54
740000 -- (-1492.608) (-1497.868) [-1502.076] (-1492.631) * (-1498.484) (-1500.839) (-1497.140) [-1494.566] -- 0:00:54
Average standard deviation of split frequencies: 0.001273
740500 -- (-1493.322) [-1495.839] (-1503.029) (-1495.184) * (-1503.130) (-1498.967) (-1498.452) [-1499.407] -- 0:00:53
741000 -- [-1492.907] (-1495.523) (-1503.261) (-1494.893) * [-1500.693] (-1504.232) (-1496.912) (-1494.941) -- 0:00:53
741500 -- (-1490.853) [-1495.920] (-1495.453) (-1493.650) * (-1491.292) [-1494.977] (-1501.173) (-1492.665) -- 0:00:53
742000 -- (-1493.160) (-1500.555) [-1492.582] (-1498.436) * (-1494.376) (-1494.358) (-1492.031) [-1492.897] -- 0:00:53
742500 -- (-1498.781) (-1495.237) (-1509.929) [-1501.156] * (-1491.256) [-1492.535] (-1496.417) (-1491.727) -- 0:00:53
743000 -- (-1503.012) (-1498.461) (-1507.261) [-1492.983] * [-1492.232] (-1491.567) (-1495.047) (-1493.117) -- 0:00:53
743500 -- (-1500.538) [-1490.242] (-1502.622) (-1496.213) * (-1497.904) [-1495.562] (-1496.324) (-1494.346) -- 0:00:53
744000 -- (-1496.711) [-1495.264] (-1500.062) (-1498.980) * (-1497.153) (-1496.173) (-1491.728) [-1491.168] -- 0:00:53
744500 -- (-1496.653) (-1501.559) (-1505.817) [-1496.251] * (-1497.483) (-1500.230) [-1492.854] (-1509.788) -- 0:00:53
745000 -- [-1493.617] (-1496.258) (-1501.397) (-1506.157) * (-1499.303) [-1498.488] (-1497.102) (-1501.234) -- 0:00:53
Average standard deviation of split frequencies: 0.001264
745500 -- (-1493.686) (-1500.371) [-1498.727] (-1497.014) * (-1501.341) (-1498.392) (-1497.456) [-1501.311] -- 0:00:52
746000 -- (-1496.436) (-1493.563) (-1492.959) [-1493.280] * (-1497.682) (-1496.143) (-1497.057) [-1501.433] -- 0:00:52
746500 -- [-1494.131] (-1491.421) (-1497.259) (-1497.454) * [-1499.114] (-1504.266) (-1496.102) (-1496.042) -- 0:00:52
747000 -- (-1504.778) (-1493.695) [-1495.830] (-1503.680) * [-1492.381] (-1497.338) (-1493.182) (-1498.146) -- 0:00:52
747500 -- (-1502.484) (-1503.435) [-1495.605] (-1489.320) * [-1499.230] (-1493.876) (-1495.253) (-1498.834) -- 0:00:52
748000 -- [-1495.855] (-1498.071) (-1500.915) (-1497.978) * (-1494.167) [-1495.080] (-1499.914) (-1501.306) -- 0:00:52
748500 -- (-1497.747) (-1491.082) (-1500.657) [-1492.764] * [-1492.076] (-1495.408) (-1499.389) (-1501.620) -- 0:00:52
749000 -- (-1497.987) (-1491.827) (-1499.364) [-1493.807] * (-1502.652) (-1497.049) [-1502.396] (-1504.025) -- 0:00:52
749500 -- (-1499.961) (-1499.225) (-1501.741) [-1490.645] * (-1496.892) (-1504.009) (-1498.928) [-1493.868] -- 0:00:52
750000 -- (-1503.668) (-1496.027) (-1495.744) [-1493.850] * (-1499.678) (-1496.300) (-1501.538) [-1493.334] -- 0:00:52
Average standard deviation of split frequencies: 0.001256
750500 -- (-1500.654) (-1503.335) (-1498.416) [-1491.330] * (-1499.807) (-1500.213) [-1501.505] (-1500.238) -- 0:00:51
751000 -- (-1496.009) (-1501.198) [-1503.478] (-1495.396) * (-1499.790) [-1492.727] (-1499.731) (-1498.729) -- 0:00:51
751500 -- [-1492.945] (-1497.557) (-1507.763) (-1495.884) * [-1496.049] (-1498.887) (-1496.385) (-1500.775) -- 0:00:51
752000 -- [-1496.978] (-1493.686) (-1498.203) (-1498.445) * [-1502.331] (-1494.962) (-1493.014) (-1499.554) -- 0:00:51
752500 -- [-1499.763] (-1501.584) (-1492.910) (-1498.460) * (-1494.484) [-1498.978] (-1496.054) (-1497.847) -- 0:00:51
753000 -- (-1497.623) (-1499.329) [-1496.633] (-1492.296) * [-1495.929] (-1497.316) (-1499.226) (-1499.966) -- 0:00:51
753500 -- [-1499.662] (-1506.477) (-1495.125) (-1498.141) * [-1494.301] (-1498.100) (-1498.325) (-1498.329) -- 0:00:51
754000 -- [-1491.973] (-1503.066) (-1495.041) (-1500.580) * (-1493.078) [-1499.419] (-1510.429) (-1495.473) -- 0:00:51
754500 -- (-1492.208) (-1504.544) (-1498.363) [-1493.382] * (-1492.661) [-1492.991] (-1491.154) (-1494.494) -- 0:00:51
755000 -- (-1496.074) (-1504.878) (-1497.285) [-1495.976] * (-1499.247) (-1505.203) [-1491.008] (-1499.317) -- 0:00:50
Average standard deviation of split frequencies: 0.001247
755500 -- (-1492.226) (-1510.681) [-1492.488] (-1502.152) * [-1505.950] (-1499.820) (-1498.246) (-1502.167) -- 0:00:50
756000 -- (-1499.172) (-1505.242) (-1493.352) [-1495.048] * (-1495.527) (-1496.143) (-1497.526) [-1496.238] -- 0:00:50
756500 -- (-1496.464) (-1498.698) (-1493.046) [-1497.143] * (-1499.316) (-1503.283) [-1497.316] (-1490.420) -- 0:00:50
757000 -- (-1503.349) (-1501.677) (-1497.968) [-1493.685] * (-1497.462) [-1500.676] (-1503.570) (-1504.295) -- 0:00:50
757500 -- (-1498.210) [-1502.774] (-1497.237) (-1497.613) * [-1493.056] (-1507.318) (-1496.861) (-1497.663) -- 0:00:50
758000 -- [-1497.259] (-1498.956) (-1498.696) (-1498.139) * [-1491.250] (-1496.230) (-1495.090) (-1503.814) -- 0:00:50
758500 -- (-1498.399) [-1505.773] (-1497.553) (-1498.108) * (-1490.779) (-1498.439) [-1498.049] (-1496.817) -- 0:00:50
759000 -- (-1495.046) (-1504.347) [-1490.618] (-1501.792) * [-1489.666] (-1492.129) (-1493.965) (-1492.042) -- 0:00:50
759500 -- (-1508.782) (-1499.168) [-1500.765] (-1497.530) * (-1498.444) (-1498.297) [-1497.808] (-1499.072) -- 0:00:50
760000 -- [-1498.756] (-1494.966) (-1492.123) (-1492.454) * (-1502.224) (-1500.357) (-1498.465) [-1500.511] -- 0:00:49
Average standard deviation of split frequencies: 0.001239
760500 -- (-1494.452) [-1494.261] (-1494.893) (-1498.421) * (-1495.711) [-1492.635] (-1499.156) (-1491.135) -- 0:00:49
761000 -- (-1493.414) [-1492.472] (-1498.579) (-1497.430) * (-1495.893) (-1495.949) [-1496.227] (-1491.339) -- 0:00:49
761500 -- [-1499.136] (-1498.283) (-1492.814) (-1503.941) * (-1496.241) (-1501.386) [-1495.530] (-1496.813) -- 0:00:49
762000 -- (-1496.341) (-1495.415) [-1491.644] (-1499.181) * [-1492.925] (-1500.544) (-1497.581) (-1495.199) -- 0:00:49
762500 -- (-1496.527) [-1493.594] (-1499.182) (-1495.445) * (-1496.280) (-1500.978) (-1497.398) [-1495.853] -- 0:00:49
763000 -- (-1498.633) [-1494.835] (-1495.300) (-1499.543) * (-1494.103) [-1498.273] (-1502.952) (-1495.509) -- 0:00:49
763500 -- (-1500.621) (-1499.870) [-1498.124] (-1500.590) * (-1497.925) (-1492.179) [-1496.709] (-1496.787) -- 0:00:49
764000 -- [-1498.891] (-1490.621) (-1497.509) (-1500.817) * (-1500.271) (-1490.595) (-1496.928) [-1494.044] -- 0:00:49
764500 -- (-1498.856) (-1490.346) [-1495.508] (-1498.935) * (-1496.979) [-1495.871] (-1492.448) (-1493.686) -- 0:00:48
765000 -- [-1495.850] (-1497.484) (-1496.639) (-1491.125) * (-1497.297) (-1504.925) (-1490.838) [-1492.741] -- 0:00:48
Average standard deviation of split frequencies: 0.001539
765500 -- (-1496.515) (-1500.152) (-1499.340) [-1494.193] * (-1497.748) (-1496.168) [-1492.397] (-1494.152) -- 0:00:48
766000 -- (-1500.054) (-1502.630) (-1495.465) [-1494.208] * (-1499.206) (-1490.709) (-1500.790) [-1498.450] -- 0:00:48
766500 -- (-1495.296) [-1497.514] (-1500.008) (-1496.286) * (-1506.696) (-1494.523) [-1496.452] (-1502.440) -- 0:00:48
767000 -- (-1502.951) [-1493.556] (-1501.362) (-1492.010) * [-1498.997] (-1501.827) (-1507.504) (-1497.749) -- 0:00:48
767500 -- (-1496.346) [-1497.254] (-1498.527) (-1497.263) * (-1495.755) [-1499.663] (-1497.179) (-1493.715) -- 0:00:48
768000 -- (-1498.219) (-1496.722) [-1499.061] (-1494.578) * [-1491.395] (-1498.940) (-1498.051) (-1500.492) -- 0:00:48
768500 -- (-1500.898) (-1494.480) (-1507.761) [-1496.288] * (-1503.664) (-1499.093) (-1497.650) [-1494.053] -- 0:00:48
769000 -- (-1498.842) (-1495.706) (-1499.793) [-1505.079] * (-1496.881) (-1499.082) (-1492.717) [-1493.369] -- 0:00:48
769500 -- (-1498.253) (-1496.544) [-1495.431] (-1495.332) * (-1494.993) (-1497.434) (-1496.582) [-1492.982] -- 0:00:47
770000 -- (-1502.248) (-1493.971) (-1500.108) [-1491.426] * (-1495.688) [-1494.583] (-1494.255) (-1495.973) -- 0:00:47
Average standard deviation of split frequencies: 0.001529
770500 -- (-1504.191) (-1492.585) [-1500.204] (-1499.653) * [-1496.622] (-1498.250) (-1496.152) (-1492.664) -- 0:00:47
771000 -- [-1495.391] (-1503.997) (-1497.514) (-1499.900) * (-1495.124) [-1502.231] (-1496.709) (-1493.760) -- 0:00:47
771500 -- (-1501.396) (-1498.664) [-1494.790] (-1493.587) * (-1499.040) (-1507.448) (-1496.098) [-1492.657] -- 0:00:47
772000 -- (-1500.740) (-1495.097) (-1491.242) [-1490.787] * (-1496.264) (-1495.475) (-1495.377) [-1496.565] -- 0:00:47
772500 -- [-1496.328] (-1497.939) (-1497.180) (-1488.438) * [-1495.350] (-1494.815) (-1496.139) (-1494.762) -- 0:00:47
773000 -- (-1499.202) (-1503.012) (-1494.745) [-1498.157] * (-1493.958) (-1494.243) (-1500.645) [-1491.679] -- 0:00:47
773500 -- (-1501.080) [-1498.299] (-1492.584) (-1498.006) * (-1499.969) (-1494.918) (-1498.391) [-1490.674] -- 0:00:47
774000 -- (-1498.479) (-1498.783) [-1499.018] (-1507.276) * (-1496.851) (-1497.232) (-1502.649) [-1499.732] -- 0:00:47
774500 -- [-1496.998] (-1494.116) (-1500.700) (-1501.624) * (-1494.098) [-1493.484] (-1501.334) (-1494.756) -- 0:00:46
775000 -- (-1493.335) (-1496.500) [-1499.122] (-1508.310) * (-1505.553) (-1492.639) (-1497.419) [-1498.349] -- 0:00:46
Average standard deviation of split frequencies: 0.001519
775500 -- [-1491.313] (-1497.693) (-1497.336) (-1495.346) * [-1495.783] (-1491.917) (-1494.626) (-1492.951) -- 0:00:46
776000 -- (-1501.432) (-1499.398) (-1502.817) [-1494.069] * [-1492.267] (-1497.548) (-1493.747) (-1495.092) -- 0:00:46
776500 -- (-1500.269) (-1499.437) (-1497.514) [-1492.641] * (-1492.799) (-1491.310) (-1494.164) [-1496.331] -- 0:00:46
777000 -- (-1502.209) (-1506.171) [-1495.709] (-1498.203) * (-1498.304) (-1493.417) [-1496.471] (-1496.547) -- 0:00:46
777500 -- [-1503.524] (-1501.053) (-1499.608) (-1499.839) * (-1497.312) [-1493.508] (-1503.777) (-1496.460) -- 0:00:46
778000 -- [-1492.518] (-1507.292) (-1498.677) (-1497.259) * (-1499.630) (-1491.669) [-1496.808] (-1493.353) -- 0:00:46
778500 -- [-1494.434] (-1495.942) (-1496.840) (-1498.557) * (-1500.910) (-1495.268) (-1498.566) [-1503.161] -- 0:00:46
779000 -- (-1500.447) (-1501.506) (-1495.779) [-1498.099] * (-1495.375) [-1503.831] (-1500.093) (-1495.479) -- 0:00:45
779500 -- (-1501.059) (-1506.617) (-1501.116) [-1502.392] * (-1495.438) [-1491.300] (-1500.896) (-1500.340) -- 0:00:45
780000 -- (-1506.153) (-1497.459) (-1496.698) [-1498.291] * (-1496.330) (-1499.134) (-1495.440) [-1495.638] -- 0:00:45
Average standard deviation of split frequencies: 0.002113
780500 -- (-1494.799) [-1496.519] (-1496.281) (-1493.528) * (-1505.084) [-1495.818] (-1496.528) (-1494.143) -- 0:00:45
781000 -- (-1496.254) [-1496.670] (-1493.129) (-1497.764) * (-1493.105) [-1491.488] (-1501.921) (-1498.200) -- 0:00:45
781500 -- (-1494.747) (-1501.079) [-1494.534] (-1495.065) * (-1495.807) [-1497.633] (-1493.124) (-1497.005) -- 0:00:45
782000 -- (-1498.947) (-1496.382) [-1500.209] (-1496.030) * (-1504.571) (-1498.917) (-1495.105) [-1492.648] -- 0:00:45
782500 -- (-1500.074) (-1503.301) (-1498.056) [-1491.052] * (-1503.085) (-1494.880) [-1492.410] (-1509.216) -- 0:00:45
783000 -- (-1495.784) (-1498.770) [-1494.011] (-1496.474) * [-1495.472] (-1500.405) (-1495.157) (-1497.758) -- 0:00:45
783500 -- (-1501.445) (-1495.354) (-1499.445) [-1494.511] * (-1494.924) [-1496.925] (-1496.581) (-1496.163) -- 0:00:45
784000 -- (-1491.887) (-1500.305) (-1497.260) [-1491.789] * (-1492.506) [-1496.711] (-1493.107) (-1498.201) -- 0:00:44
784500 -- [-1496.318] (-1494.107) (-1499.212) (-1494.714) * (-1494.867) [-1495.553] (-1491.854) (-1508.743) -- 0:00:44
785000 -- (-1492.315) (-1500.884) [-1497.772] (-1496.328) * (-1506.474) (-1498.453) [-1490.621] (-1503.304) -- 0:00:44
Average standard deviation of split frequencies: 0.002099
785500 -- (-1501.634) [-1494.715] (-1504.600) (-1491.574) * [-1497.680] (-1496.374) (-1498.081) (-1494.669) -- 0:00:44
786000 -- (-1497.538) (-1496.751) [-1491.410] (-1494.663) * (-1495.391) (-1499.581) [-1493.821] (-1504.720) -- 0:00:44
786500 -- (-1497.306) (-1492.643) [-1490.597] (-1505.737) * (-1502.182) [-1495.328] (-1503.158) (-1494.308) -- 0:00:44
787000 -- (-1496.940) [-1496.303] (-1492.252) (-1496.746) * (-1495.546) (-1496.811) [-1495.132] (-1501.308) -- 0:00:44
787500 -- (-1497.428) (-1501.074) (-1489.756) [-1498.470] * (-1498.489) [-1496.463] (-1491.917) (-1497.363) -- 0:00:44
788000 -- [-1498.789] (-1499.653) (-1498.973) (-1501.168) * (-1499.942) (-1496.541) (-1502.733) [-1500.919] -- 0:00:44
788500 -- (-1494.025) (-1496.454) [-1492.210] (-1509.695) * [-1498.014] (-1498.021) (-1502.985) (-1495.770) -- 0:00:43
789000 -- (-1496.724) (-1498.180) [-1494.017] (-1496.894) * (-1496.150) (-1494.061) (-1497.963) [-1499.000] -- 0:00:43
789500 -- (-1504.401) (-1496.335) [-1491.006] (-1492.142) * [-1492.690] (-1500.561) (-1497.622) (-1496.577) -- 0:00:43
790000 -- [-1495.693] (-1491.551) (-1498.535) (-1498.848) * (-1491.757) [-1494.786] (-1495.530) (-1498.231) -- 0:00:43
Average standard deviation of split frequencies: 0.002385
790500 -- (-1492.737) (-1496.317) [-1497.509] (-1496.817) * (-1493.749) [-1491.934] (-1497.757) (-1501.672) -- 0:00:43
791000 -- [-1491.547] (-1499.169) (-1494.394) (-1500.971) * (-1502.097) [-1492.898] (-1494.437) (-1497.638) -- 0:00:43
791500 -- (-1494.801) [-1499.826] (-1500.182) (-1491.917) * (-1495.233) [-1491.200] (-1497.682) (-1504.395) -- 0:00:43
792000 -- (-1491.973) (-1503.664) (-1497.225) [-1491.859] * [-1497.724] (-1491.314) (-1498.270) (-1501.324) -- 0:00:43
792500 -- (-1501.813) (-1495.979) (-1498.939) [-1489.246] * (-1494.775) (-1497.466) [-1499.646] (-1500.265) -- 0:00:43
793000 -- (-1497.176) (-1496.847) (-1498.203) [-1492.927] * (-1495.888) [-1493.747] (-1495.107) (-1501.519) -- 0:00:43
793500 -- (-1491.896) (-1505.514) (-1494.091) [-1492.380] * (-1496.449) (-1492.335) (-1497.658) [-1506.525] -- 0:00:42
794000 -- (-1498.413) (-1498.511) (-1498.058) [-1499.974] * [-1494.650] (-1496.042) (-1499.248) (-1496.953) -- 0:00:42
794500 -- (-1496.669) [-1492.580] (-1498.600) (-1491.706) * [-1491.639] (-1493.365) (-1506.093) (-1501.195) -- 0:00:42
795000 -- (-1493.847) (-1494.111) (-1504.675) [-1500.708] * (-1495.650) (-1497.874) (-1500.742) [-1504.303] -- 0:00:42
Average standard deviation of split frequencies: 0.002369
795500 -- (-1492.096) (-1501.430) [-1491.255] (-1500.363) * (-1497.506) (-1495.098) [-1501.706] (-1500.351) -- 0:00:42
796000 -- (-1508.316) (-1498.835) [-1493.639] (-1494.287) * (-1492.995) [-1496.935] (-1499.189) (-1493.809) -- 0:00:42
796500 -- (-1499.022) [-1493.948] (-1492.368) (-1496.956) * (-1493.608) (-1503.636) (-1498.413) [-1491.775] -- 0:00:42
797000 -- [-1500.074] (-1498.276) (-1498.177) (-1498.732) * (-1494.205) [-1495.507] (-1497.857) (-1493.356) -- 0:00:42
797500 -- (-1498.540) [-1493.221] (-1497.609) (-1496.308) * [-1491.643] (-1500.248) (-1501.009) (-1498.702) -- 0:00:42
798000 -- (-1494.927) (-1500.166) (-1491.224) [-1490.977] * (-1506.911) (-1495.385) (-1494.844) [-1496.769] -- 0:00:42
798500 -- (-1497.586) (-1494.634) [-1492.809] (-1493.940) * (-1501.569) [-1494.129] (-1497.429) (-1497.408) -- 0:00:41
799000 -- (-1497.596) (-1502.218) (-1494.611) [-1494.175] * [-1498.183] (-1495.459) (-1499.002) (-1504.945) -- 0:00:42
799500 -- (-1499.343) (-1499.296) (-1493.086) [-1495.693] * (-1496.897) (-1502.350) (-1491.249) [-1498.586] -- 0:00:41
800000 -- (-1495.672) (-1494.995) (-1496.530) [-1493.910] * [-1501.749] (-1496.044) (-1503.470) (-1496.765) -- 0:00:41
Average standard deviation of split frequencies: 0.002649
800500 -- (-1501.201) (-1503.280) [-1493.512] (-1495.284) * [-1495.048] (-1498.112) (-1490.388) (-1503.812) -- 0:00:41
801000 -- [-1496.511] (-1491.852) (-1501.328) (-1494.602) * (-1494.899) (-1509.062) [-1493.151] (-1499.762) -- 0:00:41
801500 -- [-1491.060] (-1496.097) (-1499.463) (-1500.336) * (-1502.342) (-1498.645) (-1502.564) [-1498.366] -- 0:00:41
802000 -- (-1498.738) [-1494.474] (-1493.914) (-1498.588) * (-1504.519) (-1496.238) [-1493.938] (-1495.895) -- 0:00:41
802500 -- (-1496.003) [-1494.887] (-1496.850) (-1492.247) * (-1496.947) (-1505.720) [-1491.701] (-1499.554) -- 0:00:41
803000 -- (-1494.781) [-1497.198] (-1491.105) (-1493.748) * (-1498.273) (-1497.776) (-1500.608) [-1496.839] -- 0:00:40
803500 -- (-1493.417) (-1497.560) [-1497.944] (-1493.723) * [-1495.576] (-1500.846) (-1498.327) (-1500.830) -- 0:00:40
804000 -- (-1497.917) (-1494.901) [-1495.342] (-1495.224) * (-1496.889) (-1498.400) [-1494.270] (-1496.385) -- 0:00:40
804500 -- (-1504.492) (-1493.139) (-1497.240) [-1493.852] * (-1504.054) (-1501.808) [-1495.717] (-1497.190) -- 0:00:40
805000 -- (-1503.973) [-1496.561] (-1498.108) (-1499.139) * (-1506.756) (-1494.969) (-1499.373) [-1492.938] -- 0:00:40
Average standard deviation of split frequencies: 0.002632
805500 -- (-1504.399) (-1494.611) [-1499.560] (-1495.401) * (-1513.557) (-1501.054) (-1492.402) [-1496.689] -- 0:00:40
806000 -- (-1500.977) (-1491.185) [-1496.395] (-1493.723) * (-1513.209) (-1490.328) [-1492.261] (-1497.876) -- 0:00:40
806500 -- (-1500.218) (-1492.059) (-1496.120) [-1493.055] * (-1502.014) (-1494.136) [-1498.720] (-1500.544) -- 0:00:40
807000 -- [-1496.091] (-1493.394) (-1496.226) (-1499.589) * (-1502.912) (-1493.671) [-1491.555] (-1491.483) -- 0:00:40
807500 -- (-1500.209) (-1493.578) [-1497.482] (-1505.516) * (-1499.376) (-1492.959) (-1495.817) [-1498.607] -- 0:00:40
808000 -- (-1495.744) [-1495.028] (-1500.484) (-1496.100) * [-1494.684] (-1497.612) (-1500.571) (-1497.153) -- 0:00:39
808500 -- (-1502.381) [-1493.485] (-1501.146) (-1495.825) * (-1499.062) [-1495.414] (-1494.715) (-1500.347) -- 0:00:40
809000 -- (-1495.082) [-1493.298] (-1501.636) (-1503.477) * (-1496.009) [-1493.208] (-1495.008) (-1502.177) -- 0:00:39
809500 -- (-1495.480) (-1501.446) (-1493.187) [-1499.543] * (-1496.711) (-1490.987) (-1495.446) [-1496.487] -- 0:00:39
810000 -- (-1494.266) (-1493.567) (-1500.147) [-1498.586] * (-1494.665) (-1494.169) [-1494.229] (-1498.347) -- 0:00:39
Average standard deviation of split frequencies: 0.002617
810500 -- (-1506.278) [-1491.804] (-1494.356) (-1498.700) * (-1501.740) (-1489.576) (-1495.753) [-1492.579] -- 0:00:39
811000 -- (-1497.988) [-1491.714] (-1502.472) (-1506.653) * (-1505.432) (-1490.454) [-1496.171] (-1500.594) -- 0:00:39
811500 -- (-1494.936) (-1492.741) (-1501.062) [-1495.501] * (-1494.263) [-1496.912] (-1492.980) (-1500.464) -- 0:00:39
812000 -- (-1494.706) (-1497.135) [-1495.786] (-1496.276) * (-1501.123) [-1492.127] (-1493.799) (-1491.738) -- 0:00:39
812500 -- (-1495.006) (-1491.414) (-1494.608) [-1499.362] * (-1508.597) [-1497.103] (-1494.193) (-1496.120) -- 0:00:39
813000 -- (-1494.492) (-1498.315) [-1495.557] (-1497.082) * (-1493.421) [-1496.182] (-1497.521) (-1493.542) -- 0:00:38
813500 -- (-1502.205) (-1505.211) [-1494.197] (-1499.480) * (-1495.500) (-1492.929) [-1491.639] (-1493.634) -- 0:00:38
814000 -- (-1490.298) (-1498.327) [-1497.546] (-1499.567) * (-1495.973) [-1494.134] (-1493.268) (-1491.378) -- 0:00:38
814500 -- [-1495.443] (-1505.084) (-1489.862) (-1498.378) * (-1495.806) (-1499.590) [-1498.973] (-1500.056) -- 0:00:38
815000 -- [-1492.737] (-1503.917) (-1502.938) (-1493.377) * [-1494.806] (-1495.408) (-1498.772) (-1495.323) -- 0:00:38
Average standard deviation of split frequencies: 0.002600
815500 -- (-1493.578) (-1502.633) [-1495.457] (-1491.927) * (-1493.311) (-1499.530) (-1500.224) [-1493.365] -- 0:00:38
816000 -- (-1502.449) [-1502.078] (-1500.057) (-1489.314) * [-1490.986] (-1499.958) (-1498.755) (-1497.483) -- 0:00:38
816500 -- [-1491.236] (-1499.255) (-1495.513) (-1495.938) * (-1499.086) [-1490.813] (-1495.353) (-1499.056) -- 0:00:38
817000 -- (-1497.814) (-1494.293) [-1495.361] (-1495.290) * (-1493.134) (-1496.961) [-1493.610] (-1502.601) -- 0:00:38
817500 -- (-1499.085) (-1493.756) [-1493.471] (-1498.419) * [-1502.173] (-1499.023) (-1494.474) (-1498.984) -- 0:00:37
818000 -- (-1503.675) [-1500.318] (-1500.164) (-1497.317) * (-1499.564) [-1494.725] (-1495.006) (-1498.367) -- 0:00:38
818500 -- [-1491.046] (-1498.013) (-1493.847) (-1500.051) * [-1501.102] (-1503.208) (-1497.736) (-1503.597) -- 0:00:37
819000 -- (-1495.066) (-1500.126) (-1500.569) [-1491.549] * (-1498.405) (-1489.224) [-1497.950] (-1497.306) -- 0:00:37
819500 -- (-1492.192) (-1501.492) (-1497.439) [-1488.107] * (-1494.123) (-1491.700) [-1498.127] (-1498.274) -- 0:00:37
820000 -- (-1496.443) (-1495.807) (-1495.121) [-1492.235] * (-1505.911) [-1491.486] (-1495.163) (-1494.463) -- 0:00:37
Average standard deviation of split frequencies: 0.002585
820500 -- (-1494.055) (-1495.580) (-1497.301) [-1496.521] * (-1499.810) [-1497.520] (-1500.663) (-1489.608) -- 0:00:37
821000 -- (-1493.193) (-1499.697) [-1490.883] (-1500.941) * (-1498.568) (-1496.281) (-1499.081) [-1496.284] -- 0:00:37
821500 -- (-1493.847) (-1499.514) [-1490.658] (-1499.672) * [-1498.656] (-1494.378) (-1498.475) (-1503.146) -- 0:00:37
822000 -- [-1496.181] (-1499.640) (-1497.276) (-1498.276) * (-1501.753) (-1495.857) [-1501.279] (-1495.750) -- 0:00:37
822500 -- (-1497.064) [-1494.962] (-1500.877) (-1499.640) * (-1496.675) [-1505.657] (-1502.789) (-1494.526) -- 0:00:36
823000 -- (-1494.418) (-1493.198) [-1498.002] (-1505.042) * (-1496.034) (-1498.756) [-1492.118] (-1496.529) -- 0:00:36
823500 -- [-1499.285] (-1500.143) (-1492.632) (-1507.324) * [-1494.388] (-1505.945) (-1500.736) (-1501.346) -- 0:00:36
824000 -- (-1499.878) [-1498.069] (-1499.297) (-1496.309) * [-1492.991] (-1497.659) (-1497.562) (-1504.861) -- 0:00:36
824500 -- (-1499.554) [-1497.568] (-1497.801) (-1493.140) * (-1493.980) (-1495.032) [-1495.251] (-1495.263) -- 0:00:36
825000 -- (-1496.188) (-1493.741) [-1492.855] (-1496.986) * [-1501.388] (-1489.972) (-1494.382) (-1492.790) -- 0:00:36
Average standard deviation of split frequencies: 0.002283
825500 -- (-1498.793) (-1491.278) (-1490.575) [-1489.454] * (-1500.231) [-1492.880] (-1497.430) (-1494.144) -- 0:00:36
826000 -- (-1502.727) [-1501.133] (-1494.410) (-1492.932) * (-1504.159) [-1496.291] (-1492.691) (-1493.510) -- 0:00:36
826500 -- (-1503.432) (-1490.564) [-1494.427] (-1492.220) * (-1501.693) (-1495.259) (-1505.707) [-1491.258] -- 0:00:36
827000 -- (-1496.424) (-1496.166) [-1494.810] (-1498.359) * (-1492.767) [-1493.382] (-1493.495) (-1494.031) -- 0:00:35
827500 -- [-1497.081] (-1496.619) (-1495.561) (-1495.416) * (-1495.999) [-1498.427] (-1495.857) (-1495.942) -- 0:00:35
828000 -- [-1495.099] (-1500.004) (-1498.541) (-1501.252) * [-1494.296] (-1497.818) (-1494.201) (-1498.258) -- 0:00:35
828500 -- (-1498.221) (-1494.732) (-1497.589) [-1494.141] * [-1492.219] (-1503.209) (-1497.170) (-1498.345) -- 0:00:35
829000 -- (-1499.590) (-1497.416) (-1500.344) [-1496.448] * (-1501.566) [-1496.945] (-1498.241) (-1493.887) -- 0:00:35
829500 -- [-1492.456] (-1497.767) (-1493.762) (-1496.258) * [-1494.368] (-1503.516) (-1490.237) (-1499.432) -- 0:00:35
830000 -- (-1501.034) (-1500.326) [-1493.474] (-1491.908) * (-1494.736) (-1498.829) (-1491.669) [-1495.681] -- 0:00:35
Average standard deviation of split frequencies: 0.002270
830500 -- [-1500.583] (-1493.335) (-1494.016) (-1499.004) * (-1494.256) (-1504.995) [-1499.009] (-1498.797) -- 0:00:35
831000 -- [-1497.421] (-1495.587) (-1492.768) (-1503.918) * (-1499.952) (-1492.683) [-1495.745] (-1504.407) -- 0:00:35
831500 -- (-1499.195) (-1497.179) [-1495.322] (-1500.744) * (-1495.359) [-1489.766] (-1505.376) (-1499.513) -- 0:00:35
832000 -- (-1501.207) (-1497.511) (-1488.617) [-1504.503] * (-1503.836) (-1493.489) [-1499.583] (-1493.878) -- 0:00:34
832500 -- [-1499.266] (-1497.730) (-1504.381) (-1505.098) * (-1500.589) (-1495.347) (-1499.258) [-1493.029] -- 0:00:35
833000 -- (-1498.563) [-1495.610] (-1499.995) (-1491.881) * (-1495.963) (-1499.060) (-1499.216) [-1497.195] -- 0:00:34
833500 -- [-1496.051] (-1497.001) (-1497.525) (-1497.876) * (-1498.919) (-1499.217) (-1493.502) [-1493.983] -- 0:00:34
834000 -- [-1499.111] (-1499.286) (-1493.181) (-1504.084) * [-1496.309] (-1496.434) (-1494.736) (-1497.209) -- 0:00:34
834500 -- (-1497.663) (-1495.359) [-1493.151] (-1498.449) * (-1496.553) (-1496.002) (-1494.500) [-1497.255] -- 0:00:34
835000 -- (-1499.753) (-1496.658) [-1494.862] (-1505.005) * [-1498.174] (-1505.421) (-1491.817) (-1491.836) -- 0:00:34
Average standard deviation of split frequencies: 0.002256
835500 -- (-1505.364) (-1493.538) (-1495.945) [-1495.587] * (-1493.505) [-1505.655] (-1493.492) (-1503.111) -- 0:00:34
836000 -- (-1502.727) (-1496.822) [-1494.277] (-1504.251) * (-1495.269) [-1495.864] (-1497.395) (-1500.264) -- 0:00:34
836500 -- (-1495.102) (-1504.422) [-1501.964] (-1492.799) * (-1499.254) [-1496.578] (-1501.295) (-1497.331) -- 0:00:34
837000 -- (-1494.642) (-1497.538) [-1493.410] (-1498.338) * [-1503.037] (-1493.589) (-1504.996) (-1492.511) -- 0:00:33
837500 -- [-1491.679] (-1497.141) (-1492.669) (-1499.147) * (-1498.592) (-1494.923) (-1504.570) [-1493.138] -- 0:00:33
838000 -- [-1492.982] (-1500.194) (-1494.048) (-1490.261) * (-1503.616) (-1490.812) (-1495.180) [-1496.068] -- 0:00:33
838500 -- (-1503.017) (-1500.147) [-1497.408] (-1499.064) * (-1500.824) [-1499.452] (-1506.777) (-1494.801) -- 0:00:33
839000 -- (-1507.802) (-1499.013) (-1500.069) [-1501.425] * [-1499.308] (-1495.689) (-1499.014) (-1501.010) -- 0:00:33
839500 -- (-1500.078) [-1494.710] (-1495.442) (-1492.899) * [-1499.905] (-1497.402) (-1502.281) (-1501.097) -- 0:00:33
840000 -- (-1493.551) [-1493.677] (-1498.620) (-1497.152) * (-1498.840) [-1499.871] (-1509.645) (-1495.225) -- 0:00:33
Average standard deviation of split frequencies: 0.002243
840500 -- (-1497.056) (-1496.404) (-1504.246) [-1499.727] * (-1495.462) [-1496.300] (-1497.993) (-1496.040) -- 0:00:33
841000 -- (-1501.084) (-1493.713) [-1496.250] (-1502.576) * (-1490.768) (-1493.672) (-1493.752) [-1495.794] -- 0:00:33
841500 -- (-1493.025) (-1495.982) [-1496.282] (-1496.281) * (-1499.076) [-1494.556] (-1492.562) (-1506.105) -- 0:00:32
842000 -- (-1493.813) [-1494.942] (-1495.509) (-1495.110) * (-1494.457) (-1493.924) [-1492.096] (-1495.719) -- 0:00:33
842500 -- (-1496.509) [-1495.643] (-1498.897) (-1495.417) * (-1492.709) [-1491.084] (-1496.888) (-1504.779) -- 0:00:32
843000 -- [-1498.436] (-1500.197) (-1497.291) (-1495.931) * (-1492.187) (-1494.522) [-1491.239] (-1505.220) -- 0:00:32
843500 -- [-1505.345] (-1492.713) (-1497.256) (-1493.031) * (-1491.835) (-1491.928) [-1496.399] (-1508.615) -- 0:00:32
844000 -- (-1500.996) [-1493.755] (-1498.159) (-1494.539) * (-1495.194) (-1494.401) (-1504.361) [-1500.946] -- 0:00:32
844500 -- (-1496.835) (-1494.842) [-1495.288] (-1495.431) * [-1490.834] (-1493.619) (-1504.727) (-1499.816) -- 0:00:32
845000 -- [-1497.281] (-1497.056) (-1492.476) (-1491.931) * [-1495.878] (-1492.250) (-1499.839) (-1497.456) -- 0:00:32
Average standard deviation of split frequencies: 0.002229
845500 -- [-1495.209] (-1495.982) (-1497.291) (-1501.317) * (-1496.722) [-1500.905] (-1494.131) (-1495.298) -- 0:00:32
846000 -- (-1491.894) (-1493.647) (-1502.501) [-1496.075] * (-1499.103) [-1493.855] (-1497.366) (-1494.733) -- 0:00:32
846500 -- (-1494.535) (-1494.142) (-1498.404) [-1498.834] * [-1493.201] (-1493.187) (-1492.495) (-1495.406) -- 0:00:31
847000 -- (-1498.542) (-1494.436) (-1492.141) [-1494.423] * [-1493.630] (-1497.045) (-1501.960) (-1496.871) -- 0:00:31
847500 -- (-1502.259) [-1495.653] (-1496.479) (-1494.325) * [-1492.908] (-1500.221) (-1496.425) (-1499.479) -- 0:00:31
848000 -- (-1502.185) [-1496.588] (-1504.364) (-1502.099) * [-1498.417] (-1491.425) (-1502.075) (-1500.242) -- 0:00:31
848500 -- (-1496.267) [-1491.657] (-1498.420) (-1492.173) * (-1495.709) (-1491.303) (-1498.294) [-1499.813] -- 0:00:31
849000 -- (-1499.512) (-1494.422) [-1493.321] (-1495.361) * [-1494.447] (-1500.239) (-1496.432) (-1499.202) -- 0:00:31
849500 -- (-1499.404) [-1492.813] (-1493.122) (-1496.235) * (-1503.737) (-1492.069) (-1497.106) [-1499.550] -- 0:00:31
850000 -- (-1492.983) (-1495.822) [-1495.810] (-1495.964) * (-1505.065) [-1492.379] (-1499.495) (-1496.448) -- 0:00:31
Average standard deviation of split frequencies: 0.002217
850500 -- (-1495.385) (-1492.958) [-1497.979] (-1499.303) * [-1493.669] (-1496.236) (-1492.444) (-1498.335) -- 0:00:31
851000 -- (-1506.743) (-1497.297) [-1495.109] (-1505.779) * (-1503.935) [-1495.872] (-1495.602) (-1499.766) -- 0:00:30
851500 -- (-1493.844) [-1497.078] (-1494.798) (-1499.568) * (-1507.808) (-1492.628) [-1494.935] (-1495.006) -- 0:00:31
852000 -- (-1503.509) (-1500.573) (-1496.006) [-1501.351] * (-1499.887) (-1499.670) [-1495.439] (-1493.096) -- 0:00:30
852500 -- (-1492.655) (-1505.051) (-1499.561) [-1494.466] * (-1500.475) (-1500.416) (-1492.096) [-1497.148] -- 0:00:30
853000 -- (-1498.709) (-1506.441) (-1494.727) [-1498.116] * [-1493.244] (-1500.941) (-1507.202) (-1497.861) -- 0:00:30
853500 -- (-1492.787) (-1496.498) [-1496.951] (-1496.117) * [-1496.929] (-1497.548) (-1504.011) (-1500.100) -- 0:00:30
854000 -- [-1496.237] (-1501.566) (-1498.001) (-1496.456) * (-1498.296) (-1502.931) [-1499.766] (-1496.398) -- 0:00:30
854500 -- (-1499.660) (-1503.630) (-1499.480) [-1492.407] * (-1498.722) [-1497.392] (-1505.123) (-1496.552) -- 0:00:30
855000 -- [-1500.281] (-1495.391) (-1497.905) (-1500.104) * (-1498.111) [-1498.453] (-1497.164) (-1502.180) -- 0:00:30
Average standard deviation of split frequencies: 0.002203
855500 -- (-1498.311) [-1494.301] (-1498.823) (-1503.194) * (-1497.280) [-1496.464] (-1502.679) (-1497.451) -- 0:00:30
856000 -- (-1499.568) [-1499.679] (-1495.912) (-1508.571) * [-1492.113] (-1499.343) (-1498.832) (-1501.441) -- 0:00:29
856500 -- (-1495.554) (-1501.114) (-1491.266) [-1496.439] * (-1496.220) (-1496.986) [-1496.293] (-1493.670) -- 0:00:29
857000 -- (-1504.616) (-1492.117) (-1497.117) [-1495.595] * (-1501.225) [-1498.269] (-1500.779) (-1490.950) -- 0:00:29
857500 -- [-1496.161] (-1495.037) (-1509.488) (-1495.025) * (-1501.633) (-1489.561) [-1498.019] (-1499.458) -- 0:00:29
858000 -- [-1495.796] (-1493.982) (-1495.313) (-1494.370) * (-1497.144) [-1500.985] (-1497.936) (-1498.792) -- 0:00:29
858500 -- [-1496.407] (-1500.943) (-1500.581) (-1495.325) * (-1498.055) (-1501.131) [-1494.666] (-1492.216) -- 0:00:29
859000 -- (-1498.501) [-1499.220] (-1503.246) (-1496.748) * (-1496.449) [-1494.982] (-1489.925) (-1495.781) -- 0:00:29
859500 -- [-1499.346] (-1506.015) (-1504.273) (-1500.663) * (-1501.774) (-1497.910) [-1492.753] (-1501.850) -- 0:00:29
860000 -- [-1495.860] (-1510.305) (-1500.245) (-1497.901) * (-1498.783) [-1492.798] (-1492.827) (-1495.459) -- 0:00:29
Average standard deviation of split frequencies: 0.002191
860500 -- (-1495.073) (-1506.488) [-1497.635] (-1502.516) * (-1505.048) (-1492.514) [-1493.656] (-1490.436) -- 0:00:29
861000 -- (-1499.788) [-1505.579] (-1502.611) (-1503.131) * (-1505.812) (-1496.294) [-1489.708] (-1490.503) -- 0:00:29
861500 -- [-1496.224] (-1504.242) (-1499.712) (-1505.745) * (-1500.151) (-1492.294) (-1492.569) [-1495.220] -- 0:00:28
862000 -- (-1493.164) (-1496.425) [-1503.938] (-1506.978) * (-1495.728) (-1493.060) (-1494.385) [-1499.438] -- 0:00:28
862500 -- [-1498.631] (-1496.630) (-1497.847) (-1510.720) * (-1493.209) (-1498.191) (-1496.824) [-1496.092] -- 0:00:28
863000 -- (-1497.425) [-1493.127] (-1499.180) (-1503.451) * [-1500.197] (-1508.083) (-1499.331) (-1499.980) -- 0:00:28
863500 -- [-1495.261] (-1490.874) (-1498.306) (-1498.229) * (-1492.780) (-1497.461) (-1503.256) [-1494.359] -- 0:00:28
864000 -- (-1499.625) [-1502.673] (-1499.217) (-1509.489) * (-1493.816) (-1497.313) (-1500.836) [-1498.803] -- 0:00:28
864500 -- (-1499.175) (-1489.821) [-1495.783] (-1492.675) * (-1499.203) (-1494.238) (-1501.517) [-1495.553] -- 0:00:28
865000 -- (-1501.674) (-1500.625) (-1502.857) [-1495.729] * (-1496.266) [-1492.330] (-1499.659) (-1491.664) -- 0:00:28
Average standard deviation of split frequencies: 0.002450
865500 -- [-1494.881] (-1495.266) (-1507.619) (-1493.929) * (-1493.879) (-1499.964) [-1500.855] (-1494.769) -- 0:00:27
866000 -- [-1492.703] (-1495.809) (-1503.031) (-1500.296) * [-1502.487] (-1500.243) (-1492.074) (-1497.229) -- 0:00:28
866500 -- (-1502.803) (-1495.091) (-1500.888) [-1493.996] * (-1503.351) (-1496.352) [-1495.747] (-1499.766) -- 0:00:27
867000 -- [-1493.746] (-1499.163) (-1496.802) (-1503.238) * (-1494.155) (-1500.559) (-1494.104) [-1497.654] -- 0:00:27
867500 -- (-1506.243) [-1498.859] (-1494.295) (-1502.330) * [-1495.568] (-1497.059) (-1499.571) (-1498.471) -- 0:00:27
868000 -- (-1500.978) (-1494.531) (-1495.362) [-1495.493] * (-1499.776) (-1500.532) (-1502.286) [-1498.117] -- 0:00:27
868500 -- (-1504.751) (-1492.284) (-1498.380) [-1496.885] * (-1499.487) (-1503.288) [-1497.309] (-1499.344) -- 0:00:27
869000 -- (-1495.310) [-1495.727] (-1501.053) (-1494.114) * (-1501.458) [-1495.099] (-1501.158) (-1494.967) -- 0:00:27
869500 -- (-1501.516) (-1492.103) [-1494.909] (-1494.670) * (-1499.946) (-1502.170) (-1499.958) [-1496.704] -- 0:00:27
870000 -- (-1500.875) (-1496.627) (-1504.835) [-1499.761] * (-1498.883) (-1500.828) (-1492.890) [-1492.844] -- 0:00:27
Average standard deviation of split frequencies: 0.002436
870500 -- [-1504.332] (-1496.753) (-1493.513) (-1496.330) * (-1497.045) (-1501.769) (-1505.075) [-1492.159] -- 0:00:27
871000 -- (-1503.684) [-1500.991] (-1500.790) (-1497.936) * (-1500.639) [-1503.125] (-1500.914) (-1494.203) -- 0:00:26
871500 -- [-1499.691] (-1497.682) (-1502.891) (-1497.931) * (-1507.158) (-1497.822) (-1495.422) [-1491.254] -- 0:00:26
872000 -- (-1500.391) [-1499.013] (-1494.488) (-1497.004) * [-1496.539] (-1498.281) (-1493.816) (-1496.514) -- 0:00:26
872500 -- (-1498.049) (-1499.065) [-1495.597] (-1496.829) * (-1494.789) [-1495.267] (-1492.588) (-1491.121) -- 0:00:26
873000 -- [-1495.857] (-1491.911) (-1500.823) (-1496.808) * [-1493.268] (-1496.958) (-1494.453) (-1495.069) -- 0:00:26
873500 -- (-1496.445) (-1497.665) (-1501.125) [-1497.656] * [-1498.601] (-1499.351) (-1495.247) (-1496.447) -- 0:00:26
874000 -- (-1492.965) [-1494.591] (-1497.122) (-1503.308) * (-1497.674) (-1493.833) [-1495.350] (-1500.992) -- 0:00:26
874500 -- (-1491.368) (-1501.818) [-1490.544] (-1494.199) * (-1494.051) (-1501.669) [-1494.762] (-1500.251) -- 0:00:26
875000 -- (-1497.618) [-1497.522] (-1494.810) (-1499.867) * [-1490.690] (-1500.962) (-1495.101) (-1495.130) -- 0:00:26
Average standard deviation of split frequencies: 0.002422
875500 -- (-1498.639) [-1495.317] (-1494.731) (-1495.331) * [-1499.637] (-1497.683) (-1496.606) (-1496.370) -- 0:00:26
876000 -- (-1502.768) [-1493.425] (-1495.371) (-1494.075) * (-1502.952) [-1495.196] (-1491.259) (-1495.263) -- 0:00:25
876500 -- (-1499.726) (-1501.834) [-1500.293] (-1490.930) * (-1495.748) [-1492.743] (-1497.673) (-1501.022) -- 0:00:25
877000 -- (-1499.262) (-1502.397) [-1497.221] (-1494.257) * (-1498.833) [-1495.310] (-1503.792) (-1494.599) -- 0:00:25
877500 -- (-1501.336) [-1503.028] (-1502.892) (-1493.248) * (-1494.678) [-1495.914] (-1499.737) (-1495.160) -- 0:00:25
878000 -- (-1496.828) (-1509.171) (-1492.855) [-1493.124] * (-1507.337) (-1499.838) (-1498.033) [-1497.907] -- 0:00:25
878500 -- [-1497.501] (-1503.759) (-1499.389) (-1497.863) * (-1502.145) (-1500.694) [-1495.136] (-1494.961) -- 0:00:25
879000 -- [-1494.145] (-1499.281) (-1498.650) (-1494.456) * (-1502.249) (-1497.310) (-1491.838) [-1494.644] -- 0:00:25
879500 -- (-1494.683) [-1495.128] (-1501.447) (-1499.260) * (-1503.725) (-1493.292) [-1494.115] (-1494.346) -- 0:00:25
880000 -- (-1497.828) (-1495.927) (-1494.268) [-1493.843] * [-1497.040] (-1501.512) (-1499.827) (-1495.209) -- 0:00:25
Average standard deviation of split frequencies: 0.002409
880500 -- (-1498.663) [-1493.147] (-1493.706) (-1497.512) * [-1494.288] (-1501.600) (-1504.063) (-1499.294) -- 0:00:24
881000 -- (-1501.282) (-1506.903) [-1495.664] (-1495.852) * (-1499.664) (-1492.649) (-1495.388) [-1496.332] -- 0:00:24
881500 -- (-1493.114) (-1498.656) (-1497.852) [-1494.598] * [-1496.457] (-1498.897) (-1490.119) (-1497.276) -- 0:00:24
882000 -- (-1494.532) (-1497.217) [-1497.715] (-1495.423) * (-1498.520) (-1496.624) (-1492.689) [-1491.837] -- 0:00:24
882500 -- [-1494.627] (-1506.532) (-1492.239) (-1494.443) * (-1503.543) (-1494.992) [-1493.806] (-1495.172) -- 0:00:24
883000 -- (-1492.707) [-1491.593] (-1490.952) (-1496.204) * (-1493.292) (-1490.985) (-1497.428) [-1498.595] -- 0:00:24
883500 -- (-1497.911) (-1494.395) [-1500.704] (-1497.505) * [-1492.842] (-1492.514) (-1493.253) (-1492.131) -- 0:00:24
884000 -- (-1500.120) [-1494.115] (-1502.915) (-1497.709) * (-1503.463) (-1495.020) (-1496.220) [-1492.304] -- 0:00:24
884500 -- [-1496.390] (-1496.991) (-1504.010) (-1496.219) * [-1491.397] (-1498.202) (-1499.276) (-1497.288) -- 0:00:24
885000 -- (-1494.687) [-1490.824] (-1501.600) (-1496.575) * (-1496.288) (-1493.368) (-1492.925) [-1493.266] -- 0:00:24
Average standard deviation of split frequencies: 0.002394
885500 -- (-1501.105) (-1505.910) [-1495.612] (-1491.261) * (-1490.179) (-1497.300) [-1490.486] (-1494.119) -- 0:00:23
886000 -- (-1501.861) [-1491.375] (-1495.843) (-1499.203) * [-1495.698] (-1493.326) (-1496.863) (-1502.099) -- 0:00:23
886500 -- (-1499.471) [-1493.548] (-1500.341) (-1498.667) * (-1497.012) (-1496.522) [-1497.579] (-1502.672) -- 0:00:23
887000 -- (-1509.525) (-1504.573) (-1493.634) [-1496.395] * (-1500.607) [-1495.156] (-1497.571) (-1493.292) -- 0:00:23
887500 -- (-1501.973) [-1492.135] (-1492.686) (-1498.485) * (-1494.920) [-1496.841] (-1496.107) (-1499.876) -- 0:00:23
888000 -- (-1501.305) [-1494.671] (-1489.964) (-1493.994) * (-1504.740) (-1493.124) (-1499.618) [-1495.737] -- 0:00:23
888500 -- (-1494.051) [-1495.518] (-1495.173) (-1495.191) * (-1493.965) (-1497.504) (-1496.535) [-1504.365] -- 0:00:23
889000 -- (-1497.387) (-1498.309) [-1495.328] (-1492.712) * (-1494.355) [-1496.383] (-1500.556) (-1498.172) -- 0:00:23
889500 -- (-1506.120) (-1494.164) [-1492.048] (-1493.006) * (-1498.094) (-1491.146) [-1498.670] (-1491.831) -- 0:00:22
890000 -- (-1492.202) [-1493.174] (-1499.409) (-1500.295) * (-1498.354) (-1497.819) (-1500.976) [-1499.996] -- 0:00:22
Average standard deviation of split frequencies: 0.002382
890500 -- (-1492.570) (-1493.260) (-1490.089) [-1499.638] * (-1507.306) (-1495.140) [-1501.424] (-1490.973) -- 0:00:22
891000 -- [-1497.108] (-1495.510) (-1494.685) (-1496.772) * (-1498.342) [-1492.515] (-1501.299) (-1493.982) -- 0:00:22
891500 -- (-1494.351) (-1499.917) (-1489.423) [-1500.596] * (-1500.576) (-1495.324) [-1498.114] (-1497.759) -- 0:00:22
892000 -- (-1496.991) [-1494.526] (-1501.175) (-1494.840) * (-1495.408) [-1498.666] (-1503.272) (-1495.941) -- 0:00:22
892500 -- (-1498.435) [-1493.600] (-1507.822) (-1495.476) * (-1495.516) (-1497.977) (-1495.095) [-1497.210] -- 0:00:22
893000 -- (-1497.279) (-1498.521) (-1500.774) [-1494.777] * [-1495.858] (-1498.347) (-1501.201) (-1502.118) -- 0:00:22
893500 -- [-1494.808] (-1496.652) (-1504.272) (-1497.061) * (-1497.764) [-1493.376] (-1506.968) (-1501.220) -- 0:00:22
894000 -- (-1490.286) [-1494.146] (-1501.840) (-1498.955) * [-1498.311] (-1492.998) (-1503.363) (-1496.795) -- 0:00:22
894500 -- (-1493.021) (-1494.383) (-1498.381) [-1497.423] * (-1502.045) (-1495.126) (-1502.234) [-1493.643] -- 0:00:22
895000 -- (-1498.996) [-1497.110] (-1503.191) (-1494.540) * (-1498.901) [-1495.920] (-1498.250) (-1493.780) -- 0:00:21
Average standard deviation of split frequencies: 0.002368
895500 -- (-1495.944) (-1500.778) (-1496.367) [-1495.061] * (-1496.061) [-1493.828] (-1501.140) (-1495.272) -- 0:00:21
896000 -- (-1496.181) (-1494.056) [-1495.562] (-1495.041) * (-1496.870) [-1496.620] (-1499.090) (-1498.522) -- 0:00:21
896500 -- (-1498.131) (-1492.785) [-1492.923] (-1497.339) * (-1493.451) (-1498.429) (-1493.088) [-1494.918] -- 0:00:21
897000 -- (-1501.233) [-1501.278] (-1502.862) (-1502.971) * (-1500.160) [-1495.835] (-1495.925) (-1499.831) -- 0:00:21
897500 -- (-1504.266) [-1498.306] (-1495.736) (-1493.015) * (-1502.427) (-1494.284) (-1500.371) [-1498.281] -- 0:00:21
898000 -- (-1504.672) [-1494.750] (-1495.982) (-1493.445) * [-1501.041] (-1492.909) (-1498.740) (-1506.122) -- 0:00:21
898500 -- (-1500.875) (-1499.316) (-1497.632) [-1499.026] * [-1500.939] (-1491.602) (-1494.422) (-1497.109) -- 0:00:21
899000 -- (-1500.539) [-1499.197] (-1500.227) (-1498.884) * (-1495.271) (-1500.911) (-1499.272) [-1501.550] -- 0:00:21
899500 -- (-1497.780) [-1491.616] (-1495.304) (-1490.376) * (-1504.007) (-1494.191) (-1502.593) [-1497.468] -- 0:00:21
900000 -- (-1493.906) (-1497.770) [-1493.835] (-1499.848) * (-1503.375) (-1496.651) (-1501.849) [-1494.909] -- 0:00:20
Average standard deviation of split frequencies: 0.002355
900500 -- (-1496.830) [-1496.174] (-1497.142) (-1500.216) * (-1499.882) (-1501.118) [-1493.958] (-1499.591) -- 0:00:20
901000 -- [-1495.325] (-1501.225) (-1497.122) (-1492.106) * [-1499.893] (-1494.268) (-1497.202) (-1499.038) -- 0:00:20
901500 -- (-1495.175) (-1495.062) (-1496.726) [-1495.722] * [-1493.855] (-1491.376) (-1498.422) (-1496.767) -- 0:00:20
902000 -- (-1496.413) (-1496.788) [-1496.246] (-1498.898) * (-1498.089) (-1496.375) (-1497.286) [-1494.911] -- 0:00:20
902500 -- (-1500.289) (-1494.600) (-1495.611) [-1495.642] * (-1494.340) (-1494.969) (-1504.753) [-1493.852] -- 0:00:20
903000 -- (-1496.737) (-1495.091) (-1499.086) [-1495.845] * [-1495.408] (-1497.385) (-1499.755) (-1496.043) -- 0:00:20
903500 -- (-1493.331) [-1498.454] (-1500.924) (-1489.526) * (-1499.447) (-1498.394) (-1499.500) [-1491.953] -- 0:00:20
904000 -- (-1494.502) (-1496.457) [-1493.753] (-1492.198) * (-1498.793) (-1499.304) [-1491.354] (-1497.368) -- 0:00:19
904500 -- (-1496.843) (-1496.834) [-1493.397] (-1500.419) * [-1496.157] (-1499.603) (-1495.229) (-1498.071) -- 0:00:19
905000 -- (-1505.567) (-1504.780) [-1496.564] (-1493.806) * (-1498.810) [-1487.714] (-1494.609) (-1497.600) -- 0:00:19
Average standard deviation of split frequencies: 0.002341
905500 -- [-1494.366] (-1493.055) (-1498.372) (-1490.852) * (-1501.185) [-1490.620] (-1502.841) (-1492.575) -- 0:00:19
906000 -- (-1491.691) (-1496.349) [-1495.147] (-1498.446) * (-1496.235) [-1502.174] (-1505.246) (-1491.430) -- 0:00:19
906500 -- [-1492.581] (-1490.458) (-1496.144) (-1495.554) * [-1496.057] (-1498.340) (-1504.623) (-1499.505) -- 0:00:19
907000 -- (-1495.724) [-1491.028] (-1493.072) (-1494.957) * [-1496.657] (-1502.574) (-1498.061) (-1506.080) -- 0:00:19
907500 -- (-1494.560) [-1492.799] (-1495.883) (-1493.890) * [-1504.898] (-1501.352) (-1502.819) (-1497.163) -- 0:00:19
908000 -- (-1498.191) [-1493.308] (-1500.838) (-1498.605) * (-1497.903) (-1498.668) [-1496.898] (-1495.006) -- 0:00:19
908500 -- [-1492.585] (-1491.791) (-1502.246) (-1498.994) * (-1499.282) (-1498.861) [-1495.444] (-1497.643) -- 0:00:19
909000 -- (-1493.540) [-1494.034] (-1504.339) (-1495.921) * (-1490.367) (-1500.923) (-1492.425) [-1492.810] -- 0:00:19
909500 -- (-1496.060) (-1496.782) [-1500.524] (-1497.308) * [-1500.988] (-1498.768) (-1502.714) (-1498.528) -- 0:00:18
910000 -- (-1497.844) (-1497.734) [-1499.911] (-1493.886) * [-1497.119] (-1495.936) (-1503.111) (-1493.924) -- 0:00:18
Average standard deviation of split frequencies: 0.002329
910500 -- (-1499.479) (-1491.773) (-1499.658) [-1494.692] * [-1489.347] (-1499.534) (-1493.701) (-1491.299) -- 0:00:18
911000 -- (-1494.159) (-1497.052) [-1494.927] (-1493.186) * (-1492.188) [-1496.100] (-1491.833) (-1495.823) -- 0:00:18
911500 -- [-1498.014] (-1501.632) (-1495.163) (-1495.263) * [-1496.165] (-1497.314) (-1492.534) (-1498.176) -- 0:00:18
912000 -- (-1499.041) (-1500.362) [-1491.520] (-1498.193) * (-1498.943) (-1495.886) [-1491.929] (-1492.292) -- 0:00:18
912500 -- (-1504.878) [-1499.679] (-1500.557) (-1493.372) * (-1498.372) (-1500.048) [-1495.029] (-1498.776) -- 0:00:18
913000 -- (-1504.406) (-1494.988) [-1499.051] (-1498.154) * (-1505.272) [-1493.195] (-1494.615) (-1496.618) -- 0:00:18
913500 -- (-1489.887) (-1500.749) (-1499.369) [-1496.150] * (-1497.986) [-1495.197] (-1497.183) (-1497.624) -- 0:00:17
914000 -- (-1494.887) (-1499.073) [-1500.367] (-1507.203) * (-1499.089) (-1499.137) (-1499.979) [-1497.524] -- 0:00:17
914500 -- (-1498.519) (-1494.937) [-1494.858] (-1502.744) * [-1495.504] (-1491.752) (-1497.000) (-1503.635) -- 0:00:17
915000 -- (-1493.347) (-1505.841) (-1492.793) [-1500.162] * (-1495.436) (-1492.467) [-1491.801] (-1494.727) -- 0:00:17
Average standard deviation of split frequencies: 0.002316
915500 -- (-1498.723) (-1493.905) [-1495.870] (-1498.088) * (-1495.310) [-1492.671] (-1499.076) (-1496.447) -- 0:00:17
916000 -- [-1494.342] (-1493.982) (-1501.965) (-1493.570) * (-1498.247) (-1491.755) [-1495.652] (-1495.628) -- 0:00:17
916500 -- (-1490.531) (-1501.662) [-1493.746] (-1496.074) * (-1494.315) (-1494.069) (-1497.277) [-1490.731] -- 0:00:17
917000 -- [-1489.369] (-1494.716) (-1491.937) (-1496.253) * (-1501.600) (-1503.310) (-1496.975) [-1494.103] -- 0:00:17
917500 -- [-1493.610] (-1505.307) (-1495.496) (-1496.472) * (-1499.684) (-1499.077) (-1494.540) [-1492.240] -- 0:00:17
918000 -- (-1490.719) (-1494.033) (-1496.911) [-1493.371] * (-1495.117) (-1492.768) [-1498.633] (-1494.653) -- 0:00:17
918500 -- (-1492.295) (-1502.428) (-1492.106) [-1492.455] * [-1496.386] (-1494.685) (-1504.491) (-1492.730) -- 0:00:17
919000 -- (-1494.314) (-1495.867) (-1498.857) [-1495.562] * (-1493.188) [-1496.386] (-1495.567) (-1497.158) -- 0:00:16
919500 -- (-1495.502) [-1494.179] (-1502.850) (-1497.175) * (-1501.906) (-1494.276) (-1500.544) [-1495.708] -- 0:00:16
920000 -- (-1496.163) (-1495.920) (-1494.912) [-1496.911] * (-1497.447) [-1496.377] (-1492.550) (-1498.374) -- 0:00:16
Average standard deviation of split frequencies: 0.002304
920500 -- (-1499.366) (-1496.536) [-1497.207] (-1509.643) * [-1494.769] (-1502.375) (-1493.221) (-1506.983) -- 0:00:16
921000 -- (-1504.674) (-1496.099) (-1501.907) [-1499.392] * (-1494.269) (-1499.332) [-1495.604] (-1496.518) -- 0:00:16
921500 -- (-1495.640) (-1504.116) [-1501.087] (-1496.628) * (-1493.315) (-1500.028) (-1496.944) [-1493.610] -- 0:00:16
922000 -- [-1486.689] (-1498.420) (-1494.673) (-1497.790) * (-1493.879) (-1496.481) (-1506.768) [-1500.758] -- 0:00:16
922500 -- (-1493.431) (-1493.264) (-1503.579) [-1493.697] * [-1493.824] (-1495.306) (-1505.595) (-1495.973) -- 0:00:16
923000 -- (-1499.000) [-1497.774] (-1495.481) (-1492.991) * (-1497.843) (-1501.059) [-1496.683] (-1501.876) -- 0:00:16
923500 -- (-1500.996) (-1503.352) (-1501.215) [-1495.743] * (-1498.338) [-1492.772] (-1493.616) (-1491.861) -- 0:00:15
924000 -- [-1493.884] (-1495.446) (-1497.143) (-1493.823) * [-1494.830] (-1503.760) (-1496.408) (-1497.816) -- 0:00:15
924500 -- (-1496.510) (-1493.861) [-1501.042] (-1499.312) * [-1490.176] (-1498.261) (-1500.311) (-1501.960) -- 0:00:15
925000 -- (-1493.424) (-1505.908) (-1501.578) [-1500.460] * (-1498.262) (-1500.009) [-1501.338] (-1499.881) -- 0:00:15
Average standard deviation of split frequencies: 0.002291
925500 -- (-1493.610) (-1505.937) [-1490.032] (-1503.082) * (-1495.043) (-1507.469) (-1502.868) [-1500.560] -- 0:00:15
926000 -- [-1495.924] (-1493.801) (-1493.116) (-1507.448) * (-1495.482) [-1500.322] (-1508.563) (-1501.261) -- 0:00:15
926500 -- (-1496.148) (-1501.907) [-1495.001] (-1499.469) * (-1497.782) (-1497.570) [-1502.234] (-1501.171) -- 0:00:15
927000 -- (-1493.588) (-1493.408) (-1496.851) [-1498.786] * [-1496.575] (-1503.507) (-1506.495) (-1489.942) -- 0:00:15
927500 -- [-1494.462] (-1494.301) (-1493.969) (-1499.950) * (-1500.784) (-1498.164) [-1501.733] (-1494.862) -- 0:00:15
928000 -- [-1498.153] (-1506.848) (-1494.501) (-1493.396) * (-1495.986) [-1497.827] (-1500.651) (-1495.179) -- 0:00:15
928500 -- [-1490.765] (-1495.669) (-1495.217) (-1496.552) * (-1491.724) (-1492.316) (-1501.543) [-1498.614] -- 0:00:14
929000 -- [-1492.853] (-1504.034) (-1501.607) (-1494.576) * (-1495.203) [-1494.996] (-1497.569) (-1497.372) -- 0:00:14
929500 -- [-1496.338] (-1503.718) (-1500.143) (-1495.504) * (-1497.539) (-1499.675) [-1497.109] (-1493.028) -- 0:00:14
930000 -- (-1497.541) (-1507.289) [-1495.300] (-1502.382) * (-1492.561) (-1494.354) (-1498.021) [-1497.374] -- 0:00:14
Average standard deviation of split frequencies: 0.002279
930500 -- (-1503.985) (-1494.794) [-1495.084] (-1499.473) * [-1496.259] (-1497.239) (-1494.887) (-1500.970) -- 0:00:14
931000 -- (-1497.791) (-1495.202) (-1498.370) [-1495.807] * (-1497.103) (-1499.501) [-1494.237] (-1500.472) -- 0:00:14
931500 -- [-1494.908] (-1498.564) (-1493.822) (-1497.601) * (-1494.543) (-1498.440) (-1499.394) [-1496.112] -- 0:00:14
932000 -- (-1507.693) [-1491.808] (-1501.472) (-1495.563) * [-1497.360] (-1500.122) (-1515.562) (-1501.036) -- 0:00:14
932500 -- (-1498.841) (-1495.053) (-1500.980) [-1491.381] * (-1491.877) (-1497.858) (-1500.078) [-1495.031] -- 0:00:14
933000 -- (-1497.218) [-1491.537] (-1497.918) (-1503.231) * [-1497.810] (-1494.997) (-1509.441) (-1493.583) -- 0:00:14
933500 -- (-1493.902) (-1491.953) (-1492.440) [-1496.765] * (-1495.579) (-1500.047) (-1502.811) [-1492.754] -- 0:00:13
934000 -- [-1494.347] (-1497.954) (-1501.079) (-1494.150) * [-1493.670] (-1498.469) (-1496.653) (-1491.073) -- 0:00:13
934500 -- [-1499.305] (-1495.349) (-1500.312) (-1497.838) * (-1511.214) (-1504.202) (-1495.271) [-1502.160] -- 0:00:13
935000 -- (-1495.310) (-1502.451) (-1502.028) [-1497.144] * [-1494.218] (-1498.610) (-1491.440) (-1493.315) -- 0:00:13
Average standard deviation of split frequencies: 0.002266
935500 -- (-1500.156) [-1495.576] (-1501.909) (-1498.766) * (-1505.205) (-1499.278) (-1498.353) [-1496.303] -- 0:00:13
936000 -- (-1493.340) (-1492.667) (-1492.360) [-1496.504] * (-1498.751) (-1500.543) (-1498.104) [-1492.594] -- 0:00:13
936500 -- [-1499.524] (-1496.767) (-1492.615) (-1496.078) * [-1502.308] (-1500.276) (-1492.079) (-1506.054) -- 0:00:13
937000 -- (-1496.937) (-1498.325) [-1495.133] (-1503.513) * [-1497.835] (-1499.196) (-1498.979) (-1509.570) -- 0:00:13
937500 -- (-1494.241) (-1495.074) (-1504.063) [-1500.847] * [-1492.535] (-1493.850) (-1493.386) (-1503.782) -- 0:00:13
938000 -- (-1497.302) [-1494.382] (-1503.363) (-1504.975) * (-1493.548) [-1497.208] (-1497.973) (-1492.261) -- 0:00:12
938500 -- (-1496.996) (-1491.637) (-1498.975) [-1500.671] * (-1491.569) (-1492.067) (-1494.863) [-1497.214] -- 0:00:12
939000 -- (-1499.229) (-1493.191) (-1513.424) [-1496.539] * [-1501.520] (-1496.435) (-1503.854) (-1504.883) -- 0:00:12
939500 -- [-1492.698] (-1498.383) (-1501.231) (-1491.538) * (-1507.693) (-1493.207) (-1496.404) [-1493.912] -- 0:00:12
940000 -- [-1498.110] (-1496.414) (-1503.347) (-1495.869) * (-1499.414) [-1489.786] (-1499.011) (-1494.536) -- 0:00:12
Average standard deviation of split frequencies: 0.002005
940500 -- (-1500.902) [-1497.862] (-1505.702) (-1496.451) * (-1510.904) [-1494.639] (-1488.358) (-1499.924) -- 0:00:12
941000 -- (-1511.281) (-1496.433) (-1500.748) [-1495.979] * (-1496.636) (-1505.266) [-1493.274] (-1492.875) -- 0:00:12
941500 -- (-1504.537) (-1501.014) [-1500.437] (-1500.672) * [-1494.906] (-1499.470) (-1498.644) (-1498.831) -- 0:00:12
942000 -- (-1496.977) [-1497.052] (-1497.332) (-1494.092) * (-1499.398) (-1501.966) (-1493.027) [-1493.417] -- 0:00:12
942500 -- (-1500.977) [-1501.679] (-1500.977) (-1505.077) * (-1503.580) (-1495.336) [-1495.356] (-1494.232) -- 0:00:12
943000 -- (-1495.543) (-1502.816) [-1500.473] (-1496.453) * (-1500.383) [-1493.739] (-1501.532) (-1496.510) -- 0:00:11
943500 -- (-1497.688) [-1493.054] (-1498.254) (-1496.661) * (-1496.913) [-1493.452] (-1492.716) (-1493.752) -- 0:00:11
944000 -- (-1498.033) (-1497.996) (-1496.711) [-1496.702] * [-1499.493] (-1503.258) (-1497.154) (-1492.062) -- 0:00:11
944500 -- (-1500.468) (-1500.190) (-1495.479) [-1493.029] * (-1497.626) (-1497.240) (-1489.615) [-1496.153] -- 0:00:11
945000 -- [-1507.032] (-1503.560) (-1502.228) (-1497.237) * (-1506.906) [-1496.640] (-1497.918) (-1502.263) -- 0:00:11
Average standard deviation of split frequencies: 0.001993
945500 -- [-1500.398] (-1495.328) (-1508.609) (-1497.931) * (-1494.776) [-1495.441] (-1500.646) (-1495.330) -- 0:00:11
946000 -- (-1496.213) [-1497.102] (-1496.468) (-1497.755) * (-1497.966) (-1494.423) [-1491.442] (-1493.894) -- 0:00:11
946500 -- (-1495.093) [-1493.153] (-1502.990) (-1497.323) * (-1500.214) (-1493.550) (-1499.356) [-1494.710] -- 0:00:11
947000 -- (-1501.313) (-1495.553) (-1502.761) [-1493.056] * (-1499.097) (-1503.137) [-1494.125] (-1501.777) -- 0:00:11
947500 -- [-1493.814] (-1496.916) (-1503.557) (-1493.433) * [-1497.171] (-1495.798) (-1499.229) (-1494.430) -- 0:00:10
948000 -- [-1493.032] (-1494.312) (-1499.221) (-1492.259) * (-1498.462) (-1499.408) (-1497.537) [-1491.280] -- 0:00:10
948500 -- (-1496.965) (-1500.749) (-1501.398) [-1489.550] * (-1495.774) (-1499.187) [-1492.660] (-1495.181) -- 0:00:10
949000 -- [-1499.757] (-1502.731) (-1494.730) (-1499.101) * (-1500.488) (-1495.289) (-1500.783) [-1494.021] -- 0:00:10
949500 -- [-1499.610] (-1498.303) (-1498.486) (-1497.619) * (-1493.245) (-1491.463) [-1494.290] (-1501.906) -- 0:00:10
950000 -- (-1503.415) (-1501.007) (-1504.393) [-1496.047] * (-1494.076) (-1492.082) (-1493.492) [-1499.954] -- 0:00:10
Average standard deviation of split frequencies: 0.001983
950500 -- (-1496.678) (-1495.006) (-1498.344) [-1494.500] * [-1494.293] (-1501.644) (-1495.604) (-1496.704) -- 0:00:10
951000 -- [-1491.086] (-1500.663) (-1495.557) (-1498.093) * (-1499.438) (-1491.461) [-1491.889] (-1495.386) -- 0:00:10
951500 -- (-1492.113) (-1499.297) [-1493.210] (-1495.619) * (-1505.496) (-1502.826) [-1494.824] (-1496.577) -- 0:00:10
952000 -- (-1495.032) (-1496.954) [-1498.457] (-1499.546) * [-1495.705] (-1497.644) (-1496.177) (-1495.638) -- 0:00:10
952500 -- (-1497.174) [-1493.199] (-1491.607) (-1499.635) * (-1500.788) [-1493.558] (-1492.833) (-1499.288) -- 0:00:09
953000 -- [-1499.159] (-1496.769) (-1495.324) (-1496.542) * (-1499.692) [-1496.584] (-1492.388) (-1495.017) -- 0:00:09
953500 -- (-1499.705) (-1501.018) [-1500.235] (-1493.293) * (-1493.464) (-1495.222) (-1496.859) [-1495.782] -- 0:00:09
954000 -- [-1501.889] (-1500.452) (-1496.151) (-1494.782) * (-1490.770) [-1491.881] (-1494.114) (-1493.679) -- 0:00:09
954500 -- (-1503.285) (-1494.146) (-1491.304) [-1495.431] * (-1492.543) (-1496.759) [-1495.382] (-1493.360) -- 0:00:09
955000 -- (-1491.999) (-1497.419) [-1500.685] (-1494.936) * (-1496.662) [-1498.964] (-1491.708) (-1492.734) -- 0:00:09
Average standard deviation of split frequencies: 0.002219
955500 -- (-1490.608) (-1499.286) (-1493.278) [-1494.899] * (-1502.703) (-1494.871) [-1498.939] (-1495.748) -- 0:00:09
956000 -- [-1498.640] (-1497.030) (-1494.776) (-1492.374) * (-1520.194) (-1498.201) [-1498.110] (-1498.951) -- 0:00:09
956500 -- (-1500.040) [-1495.670] (-1506.519) (-1495.983) * (-1507.701) (-1493.694) [-1497.157] (-1497.530) -- 0:00:09
957000 -- (-1495.563) (-1502.019) [-1496.844] (-1499.675) * (-1496.305) (-1494.924) [-1496.489] (-1508.838) -- 0:00:08
957500 -- (-1502.152) (-1496.529) [-1497.028] (-1494.910) * [-1497.016] (-1500.088) (-1493.735) (-1492.309) -- 0:00:08
958000 -- (-1498.018) [-1499.828] (-1493.445) (-1498.698) * (-1500.248) [-1499.423] (-1494.463) (-1494.467) -- 0:00:08
958500 -- (-1495.186) [-1496.166] (-1496.700) (-1502.876) * (-1504.371) (-1494.289) [-1493.129] (-1501.716) -- 0:00:08
959000 -- (-1496.533) (-1494.925) [-1495.995] (-1495.045) * (-1497.212) (-1498.909) (-1494.125) [-1500.593] -- 0:00:08
959500 -- [-1494.440] (-1492.871) (-1497.562) (-1499.331) * [-1495.565] (-1494.813) (-1497.032) (-1499.578) -- 0:00:08
960000 -- (-1494.011) [-1495.317] (-1501.091) (-1493.478) * [-1491.308] (-1501.850) (-1498.793) (-1495.514) -- 0:00:08
Average standard deviation of split frequencies: 0.002454
960500 -- (-1492.819) [-1498.760] (-1502.630) (-1498.880) * [-1496.325] (-1505.426) (-1503.335) (-1494.462) -- 0:00:08
961000 -- (-1500.876) (-1495.414) (-1501.553) [-1507.286] * [-1494.530] (-1499.247) (-1495.454) (-1495.487) -- 0:00:08
961500 -- (-1493.724) [-1495.647] (-1510.823) (-1504.820) * (-1496.455) (-1502.204) [-1497.940] (-1499.417) -- 0:00:08
962000 -- (-1496.728) (-1499.588) (-1505.570) [-1502.637] * (-1492.121) (-1496.579) (-1493.603) [-1494.978] -- 0:00:07
962500 -- (-1499.730) (-1491.543) (-1498.949) [-1501.080] * [-1494.020] (-1496.772) (-1499.416) (-1494.237) -- 0:00:07
963000 -- [-1492.256] (-1496.428) (-1499.380) (-1495.832) * (-1492.390) [-1501.380] (-1504.043) (-1502.210) -- 0:00:07
963500 -- [-1496.765] (-1494.467) (-1502.282) (-1495.517) * (-1493.748) [-1495.607] (-1499.968) (-1507.390) -- 0:00:07
964000 -- (-1496.604) [-1492.872] (-1500.459) (-1496.731) * (-1491.420) (-1506.624) (-1497.800) [-1497.772] -- 0:00:07
964500 -- [-1498.705] (-1496.935) (-1502.302) (-1498.834) * (-1503.820) [-1498.490] (-1502.624) (-1492.183) -- 0:00:07
965000 -- (-1495.323) (-1495.284) (-1501.677) [-1498.024] * (-1500.205) [-1497.700] (-1502.379) (-1499.323) -- 0:00:07
Average standard deviation of split frequencies: 0.002196
965500 -- (-1498.653) (-1495.568) [-1498.835] (-1495.464) * (-1499.217) (-1498.644) (-1502.400) [-1490.153] -- 0:00:07
966000 -- (-1498.012) [-1495.726] (-1497.827) (-1493.140) * (-1494.872) (-1498.134) (-1493.293) [-1492.148] -- 0:00:07
966500 -- (-1500.670) [-1493.630] (-1503.522) (-1498.382) * [-1500.880] (-1495.358) (-1497.506) (-1492.275) -- 0:00:07
967000 -- (-1494.410) [-1492.558] (-1496.032) (-1497.885) * (-1495.413) (-1494.838) (-1502.626) [-1495.661] -- 0:00:06
967500 -- (-1491.669) [-1493.107] (-1503.021) (-1501.062) * (-1491.502) (-1491.588) [-1496.004] (-1502.362) -- 0:00:06
968000 -- [-1497.897] (-1497.873) (-1499.972) (-1492.223) * (-1495.871) (-1496.705) [-1495.201] (-1501.486) -- 0:00:06
968500 -- (-1500.865) (-1497.423) [-1495.896] (-1504.136) * (-1490.314) [-1504.882] (-1490.903) (-1499.449) -- 0:00:06
969000 -- [-1490.789] (-1497.972) (-1496.883) (-1497.757) * (-1499.253) (-1498.034) (-1496.290) [-1494.871] -- 0:00:06
969500 -- [-1493.079] (-1498.996) (-1497.999) (-1497.610) * (-1496.075) (-1491.729) [-1498.325] (-1502.483) -- 0:00:06
970000 -- [-1496.591] (-1500.267) (-1503.377) (-1504.092) * [-1497.578] (-1493.330) (-1497.173) (-1503.575) -- 0:00:06
Average standard deviation of split frequencies: 0.002185
970500 -- (-1498.995) (-1499.281) (-1495.759) [-1495.001] * (-1494.211) (-1497.178) [-1492.298] (-1508.694) -- 0:00:06
971000 -- (-1494.757) (-1497.415) [-1495.773] (-1494.202) * [-1494.851] (-1499.813) (-1500.444) (-1500.650) -- 0:00:06
971500 -- [-1500.072] (-1495.203) (-1495.013) (-1497.131) * [-1496.803] (-1491.778) (-1500.061) (-1499.382) -- 0:00:05
972000 -- (-1498.442) [-1494.939] (-1491.247) (-1492.655) * (-1505.582) (-1493.431) [-1492.370] (-1499.682) -- 0:00:05
972500 -- (-1499.468) (-1505.767) (-1495.205) [-1494.592] * (-1498.435) [-1490.273] (-1492.929) (-1499.054) -- 0:00:05
973000 -- (-1498.244) (-1498.384) [-1496.513] (-1502.048) * (-1498.223) (-1494.181) (-1500.668) [-1497.528] -- 0:00:05
973500 -- (-1496.947) (-1504.440) [-1495.011] (-1499.794) * (-1503.580) [-1494.506] (-1499.110) (-1494.445) -- 0:00:05
974000 -- (-1499.137) [-1496.733] (-1500.244) (-1502.237) * (-1497.538) (-1491.182) [-1501.724] (-1499.624) -- 0:00:05
974500 -- (-1499.523) [-1497.914] (-1495.702) (-1503.097) * (-1495.065) [-1490.835] (-1496.950) (-1500.850) -- 0:00:05
975000 -- (-1495.803) (-1497.052) (-1502.438) [-1491.163] * (-1499.519) (-1497.495) [-1496.619] (-1503.441) -- 0:00:05
Average standard deviation of split frequencies: 0.002173
975500 -- [-1495.384] (-1494.754) (-1495.510) (-1498.248) * (-1497.263) [-1490.064] (-1497.014) (-1504.261) -- 0:00:05
976000 -- [-1493.090] (-1501.597) (-1492.414) (-1503.468) * (-1496.037) (-1494.579) [-1496.793] (-1496.232) -- 0:00:05
976500 -- (-1496.577) (-1499.348) [-1493.264] (-1496.089) * [-1494.606] (-1503.004) (-1492.776) (-1502.265) -- 0:00:04
977000 -- (-1499.344) (-1504.471) (-1495.282) [-1492.477] * [-1496.395] (-1504.112) (-1493.549) (-1496.248) -- 0:00:04
977500 -- (-1493.507) [-1499.469] (-1508.403) (-1498.524) * (-1497.832) (-1501.688) (-1495.716) [-1499.177] -- 0:00:04
978000 -- (-1498.511) [-1495.851] (-1498.855) (-1497.323) * [-1501.571] (-1498.968) (-1503.244) (-1498.422) -- 0:00:04
978500 -- (-1497.210) (-1502.445) (-1494.294) [-1491.687] * (-1496.358) [-1495.089] (-1493.361) (-1497.014) -- 0:00:04
979000 -- [-1494.070] (-1494.549) (-1501.966) (-1498.134) * (-1496.605) (-1497.877) (-1492.761) [-1493.248] -- 0:00:04
979500 -- (-1497.636) (-1501.707) (-1499.206) [-1496.058] * (-1493.854) [-1490.275] (-1497.902) (-1497.690) -- 0:00:04
980000 -- (-1498.341) (-1499.205) [-1493.376] (-1499.020) * (-1495.692) [-1495.666] (-1504.163) (-1493.928) -- 0:00:04
Average standard deviation of split frequencies: 0.002403
980500 -- [-1496.670] (-1495.625) (-1496.113) (-1496.226) * (-1500.718) (-1503.607) [-1496.508] (-1491.280) -- 0:00:04
981000 -- (-1501.430) (-1498.032) (-1495.203) [-1493.826] * [-1494.017] (-1504.389) (-1491.066) (-1489.599) -- 0:00:03
981500 -- (-1506.398) (-1496.440) (-1498.195) [-1493.685] * [-1497.084] (-1499.168) (-1501.427) (-1496.679) -- 0:00:03
982000 -- [-1497.584] (-1506.082) (-1502.754) (-1493.050) * (-1499.070) [-1500.050] (-1503.819) (-1494.542) -- 0:00:03
982500 -- (-1494.944) (-1498.455) [-1492.872] (-1494.855) * (-1498.370) (-1500.139) (-1496.772) [-1493.979] -- 0:00:03
983000 -- [-1489.179] (-1493.975) (-1496.081) (-1494.870) * (-1490.775) (-1500.715) (-1496.135) [-1496.749] -- 0:00:03
983500 -- [-1495.355] (-1502.547) (-1492.403) (-1496.166) * (-1504.469) (-1492.636) [-1505.585] (-1489.729) -- 0:00:03
984000 -- (-1501.310) (-1502.452) (-1498.411) [-1496.384] * (-1498.898) [-1496.270] (-1493.469) (-1494.312) -- 0:00:03
984500 -- (-1500.013) (-1493.937) [-1492.956] (-1506.312) * (-1494.329) [-1501.030] (-1499.141) (-1494.167) -- 0:00:03
985000 -- (-1499.273) (-1498.656) (-1494.207) [-1495.543] * (-1497.549) [-1493.530] (-1499.032) (-1495.678) -- 0:00:03
Average standard deviation of split frequencies: 0.002390
985500 -- (-1498.271) (-1500.200) [-1494.415] (-1496.491) * (-1507.851) [-1492.969] (-1499.319) (-1501.602) -- 0:00:03
986000 -- (-1501.711) [-1492.434] (-1497.199) (-1500.350) * (-1495.742) [-1493.701] (-1504.624) (-1497.020) -- 0:00:02
986500 -- (-1505.318) (-1497.422) (-1501.938) [-1497.864] * (-1493.830) (-1494.430) [-1502.509] (-1503.225) -- 0:00:02
987000 -- (-1498.975) (-1494.939) [-1500.731] (-1498.490) * (-1496.219) [-1494.497] (-1496.321) (-1503.115) -- 0:00:02
987500 -- (-1497.551) (-1498.369) (-1496.251) [-1492.303] * (-1495.613) (-1502.557) (-1496.150) [-1493.125] -- 0:00:02
988000 -- (-1504.335) (-1496.427) [-1494.279] (-1499.784) * (-1495.296) (-1498.217) [-1494.951] (-1498.114) -- 0:00:02
988500 -- (-1495.397) (-1504.015) (-1495.461) [-1496.832] * [-1492.853] (-1492.877) (-1496.665) (-1501.160) -- 0:00:02
989000 -- (-1497.087) (-1491.732) (-1497.214) [-1493.838] * (-1494.178) (-1497.452) (-1501.251) [-1496.020] -- 0:00:02
989500 -- (-1503.118) (-1496.643) (-1498.320) [-1488.580] * (-1497.952) [-1497.955] (-1492.642) (-1494.731) -- 0:00:02
990000 -- (-1499.689) [-1487.984] (-1493.307) (-1493.590) * [-1505.399] (-1495.585) (-1494.795) (-1492.770) -- 0:00:02
Average standard deviation of split frequencies: 0.002379
990500 -- (-1498.823) (-1497.332) (-1494.407) [-1493.292] * (-1498.765) (-1501.972) [-1493.020] (-1493.962) -- 0:00:01
991000 -- (-1499.410) [-1491.706] (-1496.436) (-1498.998) * [-1497.725] (-1503.304) (-1496.795) (-1495.815) -- 0:00:01
991500 -- (-1501.360) (-1496.563) (-1508.520) [-1500.668] * (-1498.938) [-1497.236] (-1501.665) (-1494.100) -- 0:00:01
992000 -- [-1499.473] (-1498.113) (-1501.517) (-1500.737) * (-1498.420) [-1507.290] (-1502.036) (-1498.512) -- 0:00:01
992500 -- [-1495.173] (-1496.782) (-1495.287) (-1497.430) * (-1503.029) [-1501.700] (-1497.974) (-1495.477) -- 0:00:01
993000 -- (-1494.566) (-1503.669) (-1491.207) [-1494.163] * (-1494.764) [-1503.129] (-1493.976) (-1497.800) -- 0:00:01
993500 -- (-1494.804) (-1506.118) (-1496.894) [-1498.534] * (-1496.995) (-1502.701) (-1496.078) [-1497.297] -- 0:00:01
994000 -- (-1499.076) (-1504.249) (-1492.528) [-1493.072] * (-1499.858) (-1493.896) (-1493.675) [-1497.915] -- 0:00:01
994500 -- [-1493.506] (-1503.989) (-1499.864) (-1495.242) * (-1503.890) (-1494.376) [-1491.724] (-1492.728) -- 0:00:01
995000 -- [-1495.008] (-1496.463) (-1498.229) (-1495.040) * (-1496.993) (-1493.903) [-1497.676] (-1495.050) -- 0:00:01
Average standard deviation of split frequencies: 0.002366
995500 -- (-1494.207) (-1497.090) [-1503.779] (-1500.623) * (-1503.676) (-1495.420) (-1498.071) [-1496.422] -- 0:00:00
996000 -- (-1494.182) (-1493.022) [-1500.236] (-1498.052) * (-1503.562) [-1498.436] (-1496.136) (-1500.863) -- 0:00:00
996500 -- (-1501.563) (-1494.636) (-1498.889) [-1491.232] * [-1493.822] (-1499.589) (-1503.242) (-1499.075) -- 0:00:00
997000 -- [-1493.951] (-1500.238) (-1494.841) (-1491.312) * (-1495.681) [-1495.071] (-1500.733) (-1490.440) -- 0:00:00
997500 -- [-1494.377] (-1503.336) (-1499.440) (-1495.351) * (-1492.592) (-1501.586) (-1496.967) [-1495.615] -- 0:00:00
998000 -- (-1496.932) (-1501.462) [-1493.968] (-1499.251) * (-1493.358) (-1490.274) (-1511.874) [-1493.896] -- 0:00:00
998500 -- [-1496.470] (-1500.348) (-1504.143) (-1493.462) * (-1497.919) [-1495.120] (-1499.640) (-1492.298) -- 0:00:00
999000 -- (-1494.673) (-1503.355) [-1493.074] (-1494.787) * (-1491.836) (-1498.306) (-1495.684) [-1498.214] -- 0:00:00
999500 -- (-1494.489) (-1498.686) (-1493.609) [-1499.688] * (-1492.526) (-1503.687) (-1496.085) [-1497.341] -- 0:00:00
1000000 -- (-1495.960) (-1499.953) (-1498.504) [-1498.602] * (-1494.733) (-1495.349) (-1498.507) [-1493.196] -- 0:00:00
Average standard deviation of split frequencies: 0.002355
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1495.959594 -- 14.189840
Chain 1 -- -1495.959594 -- 14.189840
Chain 2 -- -1499.952785 -- 13.406545
Chain 2 -- -1499.952786 -- 13.406545
Chain 3 -- -1498.504298 -- 12.664922
Chain 3 -- -1498.504297 -- 12.664922
Chain 4 -- -1498.601986 -- 15.069140
Chain 4 -- -1498.601986 -- 15.069140
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1494.732930 -- 12.888306
Chain 1 -- -1494.732930 -- 12.888306
Chain 2 -- -1495.349387 -- 12.539789
Chain 2 -- -1495.349387 -- 12.539789
Chain 3 -- -1498.506849 -- 10.135582
Chain 3 -- -1498.506866 -- 10.135582
Chain 4 -- -1493.195786 -- 12.599242
Chain 4 -- -1493.195785 -- 12.599242
Analysis completed in 3 mins 30 seconds
Analysis used 210.34 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1486.69
Likelihood of best state for "cold" chain of run 2 was -1486.73
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
41.3 % ( 25 %) Dirichlet(Revmat{all})
59.9 % ( 46 %) Slider(Revmat{all})
26.5 % ( 20 %) Dirichlet(Pi{all})
28.4 % ( 26 %) Slider(Pi{all})
66.8 % ( 33 %) Multiplier(Alpha{1,2})
47.9 % ( 24 %) Multiplier(Alpha{3})
60.3 % ( 30 %) Slider(Pinvar{all})
1.0 % ( 1 %) ExtSPR(Tau{all},V{all})
1.0 % ( 3 %) ExtTBR(Tau{all},V{all})
1.0 % ( 0 %) NNI(Tau{all},V{all})
1.3 % ( 1 %) ParsSPR(Tau{all},V{all})
26.3 % ( 19 %) Multiplier(V{all})
36.6 % ( 36 %) Nodeslider(V{all})
26.1 % ( 32 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
41.9 % ( 41 %) Dirichlet(Revmat{all})
59.2 % ( 48 %) Slider(Revmat{all})
26.7 % ( 34 %) Dirichlet(Pi{all})
28.4 % ( 20 %) Slider(Pi{all})
67.4 % ( 35 %) Multiplier(Alpha{1,2})
47.6 % ( 27 %) Multiplier(Alpha{3})
59.6 % ( 22 %) Slider(Pinvar{all})
1.1 % ( 0 %) ExtSPR(Tau{all},V{all})
1.0 % ( 0 %) ExtTBR(Tau{all},V{all})
1.1 % ( 0 %) NNI(Tau{all},V{all})
1.5 % ( 4 %) ParsSPR(Tau{all},V{all})
26.3 % ( 35 %) Multiplier(V{all})
36.3 % ( 46 %) Nodeslider(V{all})
26.0 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.55
2 | 166106 0.84 0.71
3 | 166632 166768 0.86
4 | 167212 166458 166824
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.55
2 | 166639 0.84 0.70
3 | 166503 167498 0.86
4 | 166321 166797 166242
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1494.41
| 2 1 1 1 1 |
| 1 2 2 2 |
| 1 2 2 2 11 1 1 1 |
| 2 21 1 1 2 1 21 * 1|
| 1 1 2 1 1 1 |
|1 1 12 2 2 2 2 12 12 * 2 |
| 11 2 2 2 1 2 2 2 1 1 1 |
| 2 2 2 1 1 2 12 1 21* 22 |
| 2 1 11 2 1 21 *2* 2 |
| 1 1 12 212 2 1 2 2 2 |
| 1 2 1 |
|2 |
| 2 2 2 1 2|
| 2 1 |
| 1 1 1 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1497.61
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1492.24 -1504.61
2 -1492.58 -1505.07
--------------------------------------
TOTAL -1492.39 -1504.87
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.309377 0.002926 0.215577 0.421155 0.303538 1210.11 1212.61 1.000
r(A<->C){all} 0.101518 0.001723 0.022318 0.183122 0.099089 587.56 638.47 1.000
r(A<->G){all} 0.052691 0.000316 0.022435 0.088833 0.050588 645.09 870.30 1.000
r(A<->T){all} 0.315167 0.004607 0.185090 0.448524 0.313794 452.39 494.16 1.001
r(C<->G){all} 0.013782 0.000067 0.000057 0.028812 0.012535 921.03 1066.81 1.000
r(C<->T){all} 0.508875 0.004850 0.380184 0.650879 0.507765 409.32 480.27 1.000
r(G<->T){all} 0.007968 0.000058 0.000004 0.023265 0.005723 543.13 823.11 1.000
pi(A){all} 0.210209 0.000194 0.183599 0.238704 0.210064 1324.15 1329.31 1.000
pi(C){all} 0.218220 0.000207 0.190257 0.246401 0.218073 1274.97 1319.89 1.000
pi(G){all} 0.396147 0.000310 0.361699 0.430659 0.396214 1201.06 1230.26 1.000
pi(T){all} 0.175424 0.000172 0.151527 0.202016 0.175200 1136.46 1238.19 1.000
alpha{1,2} 0.042421 0.000907 0.000116 0.096570 0.038097 1327.69 1364.39 1.000
alpha{3} 2.132023 0.685901 0.726705 3.719047 2.015897 1176.01 1338.51 1.000
pinvar{all} 0.465818 0.006771 0.286759 0.606787 0.473849 1025.03 1201.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 2968 0.988674 0.004711 0.985343 0.992005 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.061425 0.000360 0.027325 0.099209 0.059324 1.002 2
length{all}[2] 0.023675 0.000083 0.008076 0.042316 0.022469 1.000 2
length{all}[3] 0.015720 0.000060 0.002480 0.030858 0.014514 1.000 2
length{all}[4] 0.043761 0.000264 0.013738 0.074602 0.041823 1.000 2
length{all}[5] 0.060422 0.000360 0.027036 0.098232 0.057700 1.000 2
length{all}[6] 0.078132 0.000742 0.032540 0.133373 0.073513 1.000 2
length{all}[7] 0.026477 0.000186 0.003233 0.053450 0.024502 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.002355
Maximum standard deviation of split frequencies = 0.004711
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C4 (4)
|----------------100----------------+
+ \------------------------------------ C5 (5)
|
| /------------------------------------ C2 (2)
\-----------------99----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/--------------------------------- C1 (1)
|
| /----------------------- C4 (4)
|---------------------------------------+
+ \-------------------------------- C5 (5)
|
| /------------- C2 (2)
\------------+
\-------- C3 (3)
|---------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
99 % credible set contains 2 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 759
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sites with gaps or missing data are removed.
48 ambiguity characters in seq. 1
60 ambiguity characters in seq. 2
39 ambiguity characters in seq. 3
51 ambiguity characters in seq. 4
60 ambiguity characters in seq. 5
26 sites are removed. 16 23 24 179 180 204 205 213 222 223 224 235 236 237 238 239 240 241 242 247 248 249 250 251 252 253
Sequences read..
Counting site patterns.. 0:00
110 patterns at 227 / 227 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
107360 bytes for conP
14960 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, 5), (2, 3)); MP score: 88
161040 bytes for conP, adjusted
0.090968 0.074387 0.067381 0.091339 0.042012 0.033361 0.021857 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -1405.711189
Iterating by ming2
Initial: fx= 1405.711189
x= 0.09097 0.07439 0.06738 0.09134 0.04201 0.03336 0.02186 0.30000 1.30000
1 h-m-p 0.0000 0.0018 115.9559 +++YCYYCC 1394.776814 5 0.0014 25 | 0/9
2 h-m-p 0.0001 0.0006 2822.4899 YCYCCC 1382.617312 5 0.0001 45 | 0/9
3 h-m-p 0.0001 0.0007 367.3269 +YYCCCC 1374.233306 5 0.0005 66 | 0/9
4 h-m-p 0.0002 0.0008 370.1184 YCYCCC 1368.112220 5 0.0004 86 | 0/9
5 h-m-p 0.0002 0.0009 166.1939 CYCCC 1366.240447 4 0.0003 105 | 0/9
6 h-m-p 0.0007 0.0142 70.6768 ++YYYYYYCCCC 1345.935613 10 0.0119 132 | 0/9
7 h-m-p 0.0000 0.0001 1124.6971 CYCCC 1344.135242 4 0.0001 151 | 0/9
8 h-m-p 0.0044 0.0219 4.8941 CCC 1344.094590 2 0.0014 167 | 0/9
9 h-m-p 0.0060 0.1174 1.1406 +CYCCCC 1341.485200 5 0.0474 189 | 0/9
10 h-m-p 0.0016 0.0085 32.9688 +YYCCCC 1327.519304 5 0.0053 210 | 0/9
11 h-m-p 0.2387 1.1937 0.1609 CYCCCC 1324.077646 5 0.4472 231 | 0/9
12 h-m-p 0.1865 0.9323 0.2450 CYCCC 1321.174706 4 0.3170 259 | 0/9
13 h-m-p 0.9869 8.0000 0.0787 +YCCCC 1317.596765 4 2.5858 288 | 0/9
14 h-m-p 0.7460 3.7301 0.1081 CCCCC 1316.046476 4 1.2125 317 | 0/9
15 h-m-p 0.8343 4.1715 0.1348 YYC 1315.509437 2 0.6819 340 | 0/9
16 h-m-p 1.6000 8.0000 0.0559 YCCC 1315.119852 3 2.4655 366 | 0/9
17 h-m-p 1.3773 8.0000 0.1001 YCCC 1314.648438 3 2.3085 392 | 0/9
18 h-m-p 1.6000 8.0000 0.1281 CCCC 1314.231716 3 1.6380 419 | 0/9
19 h-m-p 1.6000 8.0000 0.0408 CCC 1314.197618 2 1.3807 444 | 0/9
20 h-m-p 1.6000 8.0000 0.0070 CY 1314.191519 1 1.5165 467 | 0/9
21 h-m-p 1.0209 8.0000 0.0104 YC 1314.189107 1 1.7656 489 | 0/9
22 h-m-p 1.6000 8.0000 0.0071 YC 1314.188855 1 1.1537 511 | 0/9
23 h-m-p 1.6000 8.0000 0.0001 Y 1314.188851 0 0.9948 532 | 0/9
24 h-m-p 1.6000 8.0000 0.0000 Y 1314.188851 0 0.9522 553 | 0/9
25 h-m-p 1.6000 8.0000 0.0000 C 1314.188851 0 1.5044 574 | 0/9
26 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/9
27 h-m-p 0.0160 8.0000 0.0005 ------------- | 0/9
28 h-m-p 0.0160 8.0000 0.0005 -------------
Out..
lnL = -1314.188851
674 lfun, 674 eigenQcodon, 4718 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, (4, 5), (2, 3)); MP score: 88
0.090968 0.074387 0.067381 0.091339 0.042012 0.033361 0.021857 2.275045 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 3.872662
np = 10
lnL0 = -1343.570027
Iterating by ming2
Initial: fx= 1343.570027
x= 0.09097 0.07439 0.06738 0.09134 0.04201 0.03336 0.02186 2.27505 0.57321 0.49224
1 h-m-p 0.0000 0.0014 47.4965 +++YYCCC 1342.912515 4 0.0005 34 | 0/10
2 h-m-p 0.0001 0.0009 252.9178 +CYCCCC 1340.217364 5 0.0005 67 | 0/10
3 h-m-p 0.0001 0.0005 1003.2893 +CCYCCC 1320.335025 5 0.0005 101 | 0/10
4 h-m-p 0.0000 0.0001 589.0215 YCCCC 1319.943932 4 0.0000 131 | 0/10
5 h-m-p 0.0010 0.0051 7.6144 YC 1319.926669 1 0.0005 155 | 0/10
6 h-m-p 0.0007 0.0074 4.8193 CYC 1319.908938 2 0.0008 181 | 0/10
7 h-m-p 0.0007 0.0054 5.5401 ++ 1319.673801 m 0.0054 204 | 1/10
8 h-m-p 0.0023 0.0297 11.3466 CYC 1319.229678 2 0.0027 230 | 1/10
9 h-m-p 0.0028 0.0248 11.2040 +YYYC 1314.039265 3 0.0103 256 | 1/10
10 h-m-p 0.0002 0.0008 140.6140 CCCCC 1312.627175 4 0.0003 286 | 1/10
11 h-m-p 0.0596 2.3396 0.6736 ++YYC 1309.627676 2 0.7191 312 | 1/10
12 h-m-p 0.5973 3.2649 0.8110 YYC 1308.775197 2 0.5102 336 | 1/10
13 h-m-p 0.9833 4.9166 0.1687 YCC 1308.584233 2 0.4350 361 | 1/10
14 h-m-p 0.3008 8.0000 0.2440 +YCCC 1308.433252 3 0.8601 389 | 1/10
15 h-m-p 1.3216 8.0000 0.1588 CCC 1308.370990 2 0.5033 415 | 1/10
16 h-m-p 1.6000 8.0000 0.0107 YC 1308.363506 1 0.9710 438 | 1/10
17 h-m-p 1.6000 8.0000 0.0037 CC 1308.363013 1 1.3101 462 | 1/10
18 h-m-p 1.6000 8.0000 0.0014 C 1308.362899 0 2.1416 484 | 1/10
19 h-m-p 1.6000 8.0000 0.0006 C 1308.362882 0 1.3873 506 | 1/10
20 h-m-p 1.6000 8.0000 0.0000 Y 1308.362881 0 0.9701 528 | 1/10
21 h-m-p 0.4475 8.0000 0.0001 Y 1308.362881 0 1.0762 550 | 1/10
22 h-m-p 1.6000 8.0000 0.0000 C 1308.362881 0 1.6000 572 | 1/10
23 h-m-p 1.6000 8.0000 0.0000 Y 1308.362881 0 1.6000 594 | 1/10
24 h-m-p 1.6000 8.0000 0.0000 ----------C 1308.362881 0 0.0000 626
Out..
lnL = -1308.362881
627 lfun, 1881 eigenQcodon, 8778 P(t)
Time used: 0:05
Model 2: PositiveSelection
TREE # 1
(1, (4, 5), (2, 3)); MP score: 88
initial w for M2:NSpselection reset.
0.090968 0.074387 0.067381 0.091339 0.042012 0.033361 0.021857 2.277182 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.167543
np = 12
lnL0 = -1352.978708
Iterating by ming2
Initial: fx= 1352.978708
x= 0.09097 0.07439 0.06738 0.09134 0.04201 0.03336 0.02186 2.27718 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0151 52.1648 +++CYC 1352.049855 2 0.0007 35 | 0/12
2 h-m-p 0.0005 0.0024 75.5853 YCYCCC 1350.376375 5 0.0010 70 | 0/12
3 h-m-p 0.0002 0.0011 381.1415 ++ 1336.665694 m 0.0011 97 | 1/12
4 h-m-p 0.0008 0.0041 171.9061 CCCC 1336.064402 3 0.0009 130 | 1/12
5 h-m-p 0.0021 0.0105 38.1744 YCC 1335.785015 2 0.0015 159 | 1/12
6 h-m-p 0.0026 0.0203 22.5043 CCCC 1335.003723 3 0.0040 191 | 1/12
7 h-m-p 0.0013 0.0072 66.0886 YCCC 1333.420335 3 0.0024 222 | 1/12
8 h-m-p 0.0002 0.0012 896.1260 YCCCC 1329.017475 4 0.0004 255 | 1/12
9 h-m-p 0.0004 0.0021 496.6826 YCCCCC 1323.534321 5 0.0009 290 | 1/12
10 h-m-p 0.0476 0.2378 3.6836 ++ 1318.666975 m 0.2378 316 | 2/12
11 h-m-p 0.1357 0.6785 0.3707 +YYYCCC 1312.064918 5 0.5018 350 | 2/12
12 h-m-p 0.1003 4.0767 1.8548 +CYC 1310.253853 2 0.3205 379 | 2/12
13 h-m-p 0.4904 2.4522 0.2879 CYCCC 1308.935006 4 0.7523 411 | 1/12
14 h-m-p 0.4470 8.0000 0.4845 +YCCC 1308.604255 3 1.1794 442 | 1/12
15 h-m-p 1.0130 8.0000 0.5641 CYC 1308.270828 2 0.8962 471 | 0/12
16 h-m-p 0.0061 0.0504 83.3454 -CYC 1308.262484 2 0.0004 501 | 0/12
17 h-m-p 0.1479 8.0000 0.2435 +YCC 1308.091872 2 0.9458 532 | 0/12
18 h-m-p 0.7826 4.4845 0.2943 YCC 1308.046951 2 0.4922 562 | 0/12
19 h-m-p 0.4521 8.0000 0.3204 YC 1308.007877 1 0.7618 590 | 0/12
20 h-m-p 1.6000 8.0000 0.1212 CC 1307.990066 1 1.4573 619 | 0/12
21 h-m-p 1.6000 8.0000 0.1081 +CC 1307.950105 1 5.7291 649 | 0/12
22 h-m-p 1.6000 8.0000 0.2828 YCC 1307.928681 2 1.2317 679 | 0/12
23 h-m-p 1.6000 8.0000 0.0534 YC 1307.920567 1 0.9269 707 | 0/12
24 h-m-p 0.9816 8.0000 0.0504 C 1307.919996 0 0.9273 734 | 0/12
25 h-m-p 1.6000 8.0000 0.0059 YC 1307.919865 1 1.1761 762 | 0/12
26 h-m-p 1.2674 8.0000 0.0055 Y 1307.919826 0 2.4366 789 | 0/12
27 h-m-p 1.6000 8.0000 0.0051 ++ 1307.919619 m 8.0000 816 | 0/12
28 h-m-p 0.4917 8.0000 0.0823 +C 1307.919199 0 1.9668 844 | 0/12
29 h-m-p 1.6000 8.0000 0.0715 +YY 1307.917886 1 5.5693 873 | 0/12
30 h-m-p 1.6000 8.0000 0.1417 CC 1307.916493 1 1.9653 902 | 0/12
31 h-m-p 1.6000 8.0000 0.1202 CC 1307.915495 1 2.2065 931 | 0/12
32 h-m-p 1.6000 8.0000 0.1106 +C 1307.914287 0 5.7466 959 | 0/12
33 h-m-p 1.6000 8.0000 0.2901 YY 1307.913843 1 1.1920 987 | 0/12
34 h-m-p 0.8096 8.0000 0.4271 C 1307.913582 0 0.2438 1014 | 0/12
35 h-m-p 0.3565 8.0000 0.2921 +CC 1307.913248 1 2.0160 1044 | 0/12
36 h-m-p 1.6000 8.0000 0.2198 YC 1307.912972 1 2.8463 1072 | 0/12
37 h-m-p 1.4839 8.0000 0.4216 Y 1307.912850 0 1.0966 1099 | 0/12
38 h-m-p 1.6000 8.0000 0.2219 Y 1307.912782 0 1.1871 1126 | 0/12
39 h-m-p 0.7907 8.0000 0.3331 +Y 1307.912714 0 2.5292 1154 | 0/12
40 h-m-p 1.6000 8.0000 0.2524 C 1307.912677 0 1.9937 1181 | 0/12
41 h-m-p 1.1469 8.0000 0.4388 Y 1307.912655 0 1.9022 1208 | 0/12
42 h-m-p 1.6000 8.0000 0.3201 Y 1307.912644 0 3.5642 1235 | 0/12
43 h-m-p 1.6000 8.0000 0.4200 C 1307.912641 0 1.5095 1262 | 0/12
44 h-m-p 1.6000 8.0000 0.3213 Y 1307.912639 0 3.8732 1289 | 0/12
45 h-m-p 1.6000 8.0000 0.3310 C 1307.912638 0 1.6000 1316 | 0/12
46 h-m-p 1.6000 8.0000 0.3212 +Y 1307.912638 0 5.0267 1344 | 0/12
47 h-m-p 1.6000 8.0000 0.2217 C 1307.912638 0 1.4180 1371 | 0/12
48 h-m-p 0.8431 8.0000 0.3729 ++ 1307.912638 m 8.0000 1398 | 0/12
49 h-m-p 1.6000 8.0000 0.5720 Y 1307.912638 0 1.1867 1425 | 0/12
50 h-m-p 1.6000 8.0000 0.0338 Y 1307.912638 0 1.0306 1452 | 0/12
51 h-m-p 1.6000 8.0000 0.0133 ++ 1307.912638 m 8.0000 1479 | 0/12
52 h-m-p 1.0193 8.0000 0.1048 C 1307.912638 0 0.2548 1506 | 0/12
53 h-m-p 1.6000 8.0000 0.0102 ------Y 1307.912638 0 0.0001 1539 | 0/12
54 h-m-p 0.0282 8.0000 0.0000 -------------Y 1307.912638 0 0.0000 1579
Out..
lnL = -1307.912638
1580 lfun, 6320 eigenQcodon, 33180 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1316.734685 S = -1276.962683 -32.272237
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 110 patterns 0:17
did 20 / 110 patterns 0:17
did 30 / 110 patterns 0:17
did 40 / 110 patterns 0:17
did 50 / 110 patterns 0:17
did 60 / 110 patterns 0:17
did 70 / 110 patterns 0:17
did 80 / 110 patterns 0:17
did 90 / 110 patterns 0:17
did 100 / 110 patterns 0:17
did 110 / 110 patterns 0:17
Time used: 0:18
Model 3: discrete
TREE # 1
(1, (4, 5), (2, 3)); MP score: 88
0.090968 0.074387 0.067381 0.091339 0.042012 0.033361 0.021857 2.290613 0.331355 0.382499 0.048500 0.121076 0.202727
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 7.168569
np = 13
lnL0 = -1313.895385
Iterating by ming2
Initial: fx= 1313.895385
x= 0.09097 0.07439 0.06738 0.09134 0.04201 0.03336 0.02186 2.29061 0.33136 0.38250 0.04850 0.12108 0.20273
1 h-m-p 0.0000 0.0007 50.7599 ++YYYYY 1313.675109 4 0.0002 37 | 0/13
2 h-m-p 0.0002 0.0017 43.6142 YCCC 1313.450771 3 0.0003 71 | 0/13
3 h-m-p 0.0002 0.0008 53.3645 ++ 1312.893419 m 0.0008 100 | 1/13
4 h-m-p 0.0011 0.0055 19.7960 CCC 1312.774125 2 0.0013 133 | 1/13
5 h-m-p 0.0001 0.0007 114.7919 ++ 1312.058420 m 0.0007 161 | 2/13
6 h-m-p 0.0001 0.0013 382.8664 CCC 1311.973852 2 0.0001 193 | 2/13
7 h-m-p 0.0099 0.0688 2.4155 YC 1311.935269 1 0.0042 221 | 2/13
8 h-m-p 0.0008 0.0129 12.0254 CYC 1311.902142 2 0.0008 251 | 2/13
9 h-m-p 0.0061 0.2714 1.5542 CC 1311.898509 1 0.0022 280 | 2/13
10 h-m-p 0.0027 1.3446 4.0191 +++CCCCC 1310.701485 4 0.2492 318 | 2/13
11 h-m-p 0.9254 4.6271 0.2375 CCCC 1310.341912 3 1.0605 351 | 2/13
12 h-m-p 0.7196 7.3398 0.3500 CCCC 1310.169837 3 0.7640 384 | 2/13
13 h-m-p 0.8249 8.0000 0.3242 YCCC 1309.847682 3 1.2831 416 | 2/13
14 h-m-p 1.2089 8.0000 0.3441 +YCCC 1309.150930 3 3.5321 449 | 2/13
15 h-m-p 0.6316 3.1582 1.8235 YCCC 1308.906717 3 0.3152 481 | 2/13
16 h-m-p 0.8413 8.0000 0.6831 YCC 1308.533568 2 1.4704 511 | 1/13
17 h-m-p 0.0103 0.1105 97.1410 -CC 1308.528611 1 0.0005 541 | 1/13
18 h-m-p 0.1351 0.7577 0.3791 ++ 1308.405934 m 0.7577 569 | 2/13
19 h-m-p 0.2877 8.0000 0.9983 +YC 1308.267165 1 0.7544 599 | 2/13
20 h-m-p 0.5153 8.0000 1.4614 CCC 1308.171235 2 0.7564 630 | 1/13
21 h-m-p 0.0013 0.0925 878.1929 YCCCC 1308.081668 4 0.0027 664 | 1/13
22 h-m-p 1.6000 8.0000 1.4499 YCCC 1308.025091 3 1.0838 697 | 1/13
23 h-m-p 0.7754 3.8769 0.1808 CCC 1307.995549 2 0.6838 729 | 1/13
24 h-m-p 0.1322 8.0000 0.9357 ++CCC 1307.957451 2 2.4371 763 | 1/13
25 h-m-p 1.6000 8.0000 0.5058 YCC 1307.923572 2 3.2380 794 | 1/13
26 h-m-p 1.3885 8.0000 1.1794 YCC 1307.915337 2 0.9492 825 | 1/13
27 h-m-p 1.6000 8.0000 0.2457 CC 1307.912843 1 1.2747 855 | 1/13
28 h-m-p 1.6000 8.0000 0.1692 YC 1307.912640 1 1.1975 884 | 1/13
29 h-m-p 1.6000 8.0000 0.0028 Y 1307.912638 0 1.1030 912 | 1/13
30 h-m-p 0.6532 8.0000 0.0048 Y 1307.912638 0 1.2239 940 | 1/13
31 h-m-p 1.6000 8.0000 0.0001 Y 1307.912638 0 1.1459 968 | 1/13
32 h-m-p 1.6000 8.0000 0.0000 C 1307.912638 0 1.6000 996 | 1/13
33 h-m-p 1.6000 8.0000 0.0000 ------C 1307.912638 0 0.0001 1030
Out..
lnL = -1307.912638
1031 lfun, 4124 eigenQcodon, 21651 P(t)
Time used: 0:25
Model 7: beta
TREE # 1
(1, (4, 5), (2, 3)); MP score: 88
0.090968 0.074387 0.067381 0.091339 0.042012 0.033361 0.021857 2.290613 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 5.669121
np = 10
lnL0 = -1320.293092
Iterating by ming2
Initial: fx= 1320.293092
x= 0.09097 0.07439 0.06738 0.09134 0.04201 0.03336 0.02186 2.29061 0.66567 1.54913
1 h-m-p 0.0000 0.0010 37.1986 ++CCCC 1320.136998 3 0.0002 33 | 0/10
2 h-m-p 0.0002 0.0029 49.2166 +YCC 1319.848022 2 0.0005 60 | 0/10
3 h-m-p 0.0003 0.0094 75.9592 +CYCC 1318.735168 3 0.0015 89 | 0/10
4 h-m-p 0.0004 0.0021 278.6032 +YYCYCCC 1313.250269 6 0.0013 122 | 0/10
5 h-m-p 0.0001 0.0004 562.0224 CCCCC 1312.714581 4 0.0001 153 | 0/10
6 h-m-p 0.0011 0.0054 30.7497 CCC 1312.630453 2 0.0004 180 | 0/10
7 h-m-p 0.0027 0.0894 4.1017 YC 1312.563860 1 0.0063 204 | 0/10
8 h-m-p 0.0007 0.0594 35.5156 ++YYC 1311.771356 2 0.0093 231 | 0/10
9 h-m-p 0.0074 0.0371 9.8403 -C 1311.762477 0 0.0005 255 | 0/10
10 h-m-p 0.0454 3.5039 0.0984 ++CCCCC 1310.791530 4 0.7859 288 | 0/10
11 h-m-p 0.2703 6.8785 0.2862 +CCC 1310.638782 2 1.1023 316 | 0/10
12 h-m-p 0.5947 3.4344 0.5305 CCC 1310.525481 2 0.6626 343 | 0/10
13 h-m-p 0.5296 2.6478 0.5797 ++ 1308.748650 m 2.6478 366 | 0/10
14 h-m-p 0.3056 1.5279 0.0859 YCCYC 1308.635429 4 0.2449 396 | 0/10
15 h-m-p 0.0175 1.5854 1.1989 +CC 1308.413719 1 0.1021 422 | 0/10
16 h-m-p 0.0140 0.0702 1.1452 ++ 1308.386834 m 0.0702 445 | 0/10
17 h-m-p 1.6000 8.0000 0.0273 YCC 1308.366465 2 1.0657 471 | 0/10
18 h-m-p 0.0323 0.1613 0.0046 ++ 1308.366221 m 0.1613 494 | 0/10
19 h-m-p -0.0000 -0.0000 0.0067
h-m-p: -0.00000000e+00 -0.00000000e+00 6.72487441e-03 1308.366221
.. | 0/10
20 h-m-p 0.0000 0.0164 2.6364 +CC 1308.365553 1 0.0002 540 | 0/10
21 h-m-p 0.0005 0.0975 0.9851 YC 1308.365426 1 0.0003 564 | 0/10
22 h-m-p 0.0004 0.0474 0.7931 Y 1308.365391 0 0.0002 587 | 0/10
23 h-m-p 0.0011 0.5534 0.5256 C 1308.365370 0 0.0003 610 | 0/10
24 h-m-p 0.0022 1.0966 0.1748 C 1308.365361 0 0.0007 633 | 0/10
25 h-m-p 0.0160 8.0000 0.0235 Y 1308.365360 0 0.0031 656 | 0/10
26 h-m-p 0.0005 0.1613 0.1362 ++Y 1308.365351 0 0.0060 681 | 0/10
27 h-m-p 0.0005 0.0122 1.5234 +C 1308.365298 0 0.0032 705 | 0/10
28 h-m-p 0.0052 0.0262 0.5067 -Y 1308.365295 0 0.0005 729 | 0/10
29 h-m-p 0.0515 0.8311 0.0053 +++ 1308.365272 m 0.8311 753 | 0/10
30 h-m-p -0.0000 -0.0000 0.0039
h-m-p: -0.00000000e+00 -0.00000000e+00 3.93566823e-03 1308.365272
.. | 0/10
31 h-m-p 0.0026 1.3212 0.0646 C 1308.365270 0 0.0006 796 | 0/10
32 h-m-p 0.0023 1.1532 0.0861 C 1308.365269 0 0.0005 819 | 0/10
33 h-m-p 0.0030 1.4951 0.1827 -C 1308.365269 0 0.0002 843 | 0/10
34 h-m-p 0.0033 1.6459 0.1572 Y 1308.365267 0 0.0005 866 | 0/10
35 h-m-p 0.0040 2.0206 0.0917 -Y 1308.365267 0 0.0002 890 | 0/10
36 h-m-p 0.0139 6.9663 0.0039 -C 1308.365267 0 0.0011 914 | 0/10
37 h-m-p 0.0008 0.3751 0.0050 ++C 1308.365267 0 0.0166 939 | 0/10
38 h-m-p 0.0004 0.0093 0.1867 +++ 1308.365265 m 0.0093 963 | 0/10
39 h-m-p -0.0000 -0.0000 2.2526
h-m-p: -0.00000000e+00 -0.00000000e+00 2.25259842e+00 1308.365265
.. | 0/10
40 h-m-p 0.0029 1.4373 0.0764 Y 1308.365263 0 0.0005 1006 | 0/10
41 h-m-p 0.0160 8.0000 0.0150 --C 1308.365263 0 0.0003 1031 | 0/10
42 h-m-p 0.0079 3.9405 0.0131 --C 1308.365263 0 0.0002 1056 | 0/10
43 h-m-p 0.0160 8.0000 0.0079 --C 1308.365263 0 0.0003 1081 | 0/10
44 h-m-p 0.0160 8.0000 0.0096 -C 1308.365263 0 0.0014 1105 | 0/10
45 h-m-p 0.0064 3.2052 0.0245 -C 1308.365263 0 0.0006 1129 | 0/10
46 h-m-p 0.0103 5.1494 0.0139 -C 1308.365263 0 0.0007 1153 | 0/10
47 h-m-p 0.0029 0.1106 0.0033 ++C 1308.365263 0 0.0410 1178 | 0/10
48 h-m-p 0.0002 0.0008 0.2535 ++ 1308.365263 m 0.0008 1201 | 1/10
49 h-m-p 0.0360 7.4645 0.0059 +C 1308.365262 0 0.1661 1225 | 1/10
50 h-m-p 1.6000 8.0000 0.0001 Y 1308.365262 0 1.0012 1247 | 1/10
51 h-m-p 1.6000 8.0000 0.0000 C 1308.365262 0 1.6000 1269 | 1/10
52 h-m-p 1.6000 8.0000 0.0000 ----------Y 1308.365262 0 0.0000 1301
Out..
lnL = -1308.365262
1302 lfun, 14322 eigenQcodon, 91140 P(t)
Time used: 0:56
Model 8: beta&w>1
TREE # 1
(1, (4, 5), (2, 3)); MP score: 88
initial w for M8:NSbetaw>1 reset.
0.090968 0.074387 0.067381 0.091339 0.042012 0.033361 0.021857 2.277067 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.095300
np = 12
lnL0 = -1321.747988
Iterating by ming2
Initial: fx= 1321.747988
x= 0.09097 0.07439 0.06738 0.09134 0.04201 0.03336 0.02186 2.27707 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0012 93.4352 ++++ 1316.696828 m 0.0012 31 | 1/12
2 h-m-p 0.0008 0.0042 58.2503 YCCC 1316.289350 3 0.0005 63 | 1/12
3 h-m-p 0.0002 0.0010 178.4131 CCCCC 1315.449079 4 0.0003 97 | 1/12
4 h-m-p 0.0002 0.0013 231.0406 YCYCCC 1313.155278 5 0.0006 131 | 1/12
5 h-m-p 0.0003 0.0014 118.7345 YYYC 1312.768480 3 0.0003 160 | 0/12
6 h-m-p 0.0001 0.0003 443.4966 YC 1310.751354 1 0.0002 187 | 0/12
7 h-m-p 0.0004 0.0018 50.7720 CCCC 1310.542863 3 0.0004 220 | 0/12
8 h-m-p 0.0025 0.0528 7.1549 YC 1310.515680 1 0.0011 248 | 0/12
9 h-m-p 0.0016 0.1426 4.7798 +YC 1310.382916 1 0.0123 277 | 0/12
10 h-m-p 0.0012 0.0278 47.3585 +CYC 1309.908116 2 0.0046 308 | 0/12
11 h-m-p 0.6067 3.0336 0.2410 CCCCC 1308.372164 4 0.7411 343 | 0/12
12 h-m-p 0.2794 5.9829 0.6392 YCCC 1308.096213 3 0.6297 375 | 0/12
13 h-m-p 1.2219 6.5385 0.3294 YC 1308.015635 1 0.4971 403 | 0/12
14 h-m-p 1.4409 8.0000 0.1137 CCC 1307.994049 2 0.5531 434 | 0/12
15 h-m-p 1.6000 8.0000 0.0288 CC 1307.989074 1 1.4287 463 | 0/12
16 h-m-p 1.6000 8.0000 0.0246 YC 1307.981697 1 3.4567 491 | 0/12
17 h-m-p 0.5413 8.0000 0.1569 +CCCCC 1307.950917 4 2.8590 527 | 0/12
18 h-m-p 1.6000 8.0000 0.2128 CCC 1307.931246 2 1.5297 558 | 0/12
19 h-m-p 1.6000 8.0000 0.1628 YYC 1307.927345 2 1.1729 587 | 0/12
20 h-m-p 1.6000 8.0000 0.0548 CC 1307.925755 1 0.5204 616 | 0/12
21 h-m-p 0.4686 8.0000 0.0609 +YC 1307.925246 1 1.4000 645 | 0/12
22 h-m-p 1.6000 8.0000 0.0043 Y 1307.925221 0 1.0573 672 | 0/12
23 h-m-p 1.6000 8.0000 0.0013 C 1307.925213 0 1.5411 699 | 0/12
24 h-m-p 1.3050 8.0000 0.0016 +Y 1307.925200 0 4.4349 727 | 0/12
25 h-m-p 1.6000 8.0000 0.0043 ++ 1307.925085 m 8.0000 754 | 0/12
26 h-m-p 0.2459 8.0000 0.1406 +YC 1307.924464 1 2.4206 783 | 0/12
27 h-m-p 1.6000 8.0000 0.1634 ++ 1307.921620 m 8.0000 810 | 0/12
28 h-m-p 1.6000 8.0000 0.3724 CC 1307.920625 1 2.3944 839 | 0/12
29 h-m-p 1.6000 8.0000 0.4876 YC 1307.919375 1 3.2852 867 | 0/12
30 h-m-p 1.6000 8.0000 0.8323 C 1307.918693 0 1.5065 894 | 0/12
31 h-m-p 1.3149 8.0000 0.9536 CC 1307.918117 1 1.0090 923 | 0/12
32 h-m-p 0.6948 8.0000 1.3849 +YC 1307.917206 1 2.0193 952 | 0/12
33 h-m-p 1.6000 8.0000 1.3816 YC 1307.916377 1 2.6997 980 | 0/12
34 h-m-p 1.6000 8.0000 1.6899 YC 1307.915557 1 3.0110 1008 | 0/12
35 h-m-p 1.6000 8.0000 2.5333 YC 1307.914898 1 3.5143 1036 | 0/12
36 h-m-p 1.6000 8.0000 3.5086 YC 1307.914404 1 2.9809 1064 | 0/12
37 h-m-p 1.6000 8.0000 5.8220 YC 1307.914072 1 2.7547 1092 | 0/12
38 h-m-p 1.2174 6.0871 7.1772 CC 1307.913872 1 1.7895 1121 | 0/12
39 h-m-p 0.4156 2.0781 14.8428 ++ 1307.913656 m 2.0781 1148 | 1/12
40 h-m-p 0.1865 0.9325 3.7535 -CC 1307.913309 1 0.0153 1178 | 1/12
41 h-m-p 1.6000 8.0000 0.0292 C 1307.913161 0 1.9726 1204 | 1/12
42 h-m-p 1.6000 8.0000 0.0015 Y 1307.913159 0 1.0216 1230 | 1/12
43 h-m-p 1.6000 8.0000 0.0003 Y 1307.913159 0 0.8447 1256 | 1/12
44 h-m-p 1.6000 8.0000 0.0000 Y 1307.913159 0 0.2597 1282 | 1/12
45 h-m-p 0.2973 8.0000 0.0000 ----C 1307.913159 0 0.0003 1312
Out..
lnL = -1307.913159
1313 lfun, 15756 eigenQcodon, 101101 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1317.437414 S = -1276.962613 -33.598383
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 110 patterns 1:31
did 20 / 110 patterns 1:31
did 30 / 110 patterns 1:31
did 40 / 110 patterns 1:32
did 50 / 110 patterns 1:32
did 60 / 110 patterns 1:32
did 70 / 110 patterns 1:32
did 80 / 110 patterns 1:32
did 90 / 110 patterns 1:33
did 100 / 110 patterns 1:33
did 110 / 110 patterns 1:33
Time used: 1:33
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=253
D_melanogaster_CG4038-PA MGFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRG
D_sechellia_CG4038-PA MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG
D_simulans_CG4038-PA MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG
D_yakuba_CG4038-PA MGFGKPRGGGGGGGR-FGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFNRG
D_erecta_CG4038-PA MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFNRG
*************** ****** ***********************.**
D_melanogaster_CG4038-PA GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
D_sechellia_CG4038-PA GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
D_simulans_CG4038-PA GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
D_yakuba_CG4038-PA GGGRGGGRGAFDSGPPERVIPLGNYVYACQNDLVCKVDIQDVPYFNAPIF
D_erecta_CG4038-PA GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
************:**********::**:**********************
D_melanogaster_CG4038-PA LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLFIDPGKLLP
D_sechellia_CG4038-PA LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
D_simulans_CG4038-PA LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
D_yakuba_CG4038-PA LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPDQKLYIDPGKLLP
D_erecta_CG4038-PA LENKEQVGKIDEIFGTVRDYSVSIKLSENVYANSFKPNQKLFIDPGKLLP
***************************:*********:***:********
D_melanogaster_CG4038-PA IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
D_sechellia_CG4038-PA IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
D_simulans_CG4038-PA IARFLPKPPQPKGAKKAFTNNRGGGGGGG-FGGRGGGRGGGGRGGGGGRG
D_yakuba_CG4038-PA IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG
D_erecta_CG4038-PA IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG
**************************** ********************
D_melanogaster_CG4038-PA GGG--FRGGAGRNGGGGGGGG---FNRGRGGGGGGGG----GRGRWooo-
D_sechellia_CG4038-PA GGG--FRGGAGR-GGGGGGGGGG-FNRGRGGGGGG-------RGRWoooo
D_simulans_CG4038-PA GGG--FRGGAGR-GGGGGGGGGGGFNRGRGGGGGGGGGGGGGRGRW----
D_yakuba_CG4038-PA GGGGGFRGGAGRNGGGGGGGGG--FNRGRGGSGGGG-----GRGRWoooo
D_erecta_CG4038-PA GGG--FRGGAGRNGGGGGGGGGGGFNRGRGGGGG-------GRGRWoooo
*** ******* ******** *******.** ****
D_melanogaster_CG4038-PA ---
D_sechellia_CG4038-PA ooo
D_simulans_CG4038-PA ---
D_yakuba_CG4038-PA ---
D_erecta_CG4038-PA ooo
>D_melanogaster_CG4038-PA ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGAGGCTT CGGTGGAGGCGGAGGCGGAGGAGGACGAGGATTTGGTGGAGGTGGAGGTG GACGAGGAGGTGGCGGAGGACGCGGAGGTGGCGGCGGATTCGGTCGAGGT GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACACTGGTCCACCAGA GAGAGTCATCCCCTTGGGCAACTATGTTTACTCCTGCCAAAACGACCTTG TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC CTTGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGAACAGT TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA GCTTCAAGCCAAATCAGAAACTGTTTATCGACCCTGGAAAGCTGTTACCC ATCGCCAGATTTCTGCCGAAACCTCCACAACCAAAAGGCGCCAAGAAAGC CTTCACAAATAACCGAGGTGGAGGCGGCGGTGGCGGTGGATTTGGAGGCC GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT GGAGGCGGA------TTCCGAGGAGGTGCTGGTCGCAATGGAGGAGGTGG CGGCGGCGGCGGT---------TTTAACAGAGGACGAGGAGGCGGTGGCG GCGGCGGCGGT------------GGTCGGGGTCGGTGG------------ --------- >D_sechellia_CG4038-PA ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGAGGCTT CGGAGGAGGCGGCGGC------GGACGAGGATTTGGAGGAGGTGGCGGCG GACGCGGTGGTGGCGGCGGACGCGGAGGTGGTGGCGGATTCGGCCGTGGA GGCGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACTCTGGTCCACCGGA GAGAGTCATCCCCTTGGGCGACTTCGTTTACTCCTGCCAAAACGACCTTG TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC CTTGAAAACAAGGAGCAAGTAGGCAAAATTGACGAGATCTTTGGAACAGT TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA GCTTCAAACCAAATCAGAAACTGTATATCGACCCTGGAAAACTGTTACCC ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCCAAGAAAGC CTTCACAAATAACCGAGGCGGAGGCGGCGGTGGCGGTGGATTTGGAGGCC GAGGTGGTGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGC GGAGGCGGA------TTCCGAGGAGGAGCTGGTCGA---GGAGGAGGTGG CGGCGGCGGCGGCGGCGGT---TTCAACAGAGGACGAGGAGGCGGCGGCG GTGGT---------------------CGGGGTCGGTGG------------ --------- >D_simulans_CG4038-PA ATGGGATTTGGTAAACCTCGTGGCGGCGGAGGCGGCGGCGGAAGAGGCTT CGGAGGAGGCGGCGGC------GGACGAGGATTTGGAGGAGGTGGCGGTG GACGCGGTGGTGGTGGCGGACGCGGAGGTGGCGGCGGATTCGGCCGTGGA GGCGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACTCTGGTCCACCGGA GAGAGTCATCCCATTGGGCGACTTCGTTTACTCCTGCCAAAACGACCTCG TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC CTTGAAAACAAGGAGCAAGTAGGCAAAATCGACGAGATCTTTGGAACAGT TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA GCTTCAAGCCAAATCAGAAACTGTATATCGACCCTGGAAAGCTGTTACCC ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCCAAGAAAGC CTTCACAAATAACCGAGGCGGAGGCGGCGGTGGCGGA---TTTGGAGGCC GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGC GGAGGCGGA------TTCCGAGGAGGAGCTGGTCGA---GGAGGAGGTGG CGGCGGCGGCGGCGGCGGCGGTTTTAACAGAGGACGAGGAGGCGGCGGCG GCGGCGGCGGCGGCGGCGGTGGTGGTCGGGGTCGGTGG------------ --------- >D_yakuba_CG4038-PA ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGA---TT CGGAGGAGGTGGCGGCGGCGGCGGACGTGGATTTGGAGGAGGTGGTGGTG GACGCGGTGGTGGCGGCGGACGTGGAGGTGGCGGCGGATTCAACCGAGGA GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGATTCTGGTCCACCGGA GAGAGTAATCCCCTTGGGCAACTACGTTTACGCCTGCCAAAATGACCTTG TGTGCAAAGTTGACATTCAGGATGTTCCGTATTTCAACGCGCCCATTTTC CTCGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGTACAGT TAGGGACTACAGCGTGTCCATTAAGCTGTCGGACAACGTCTACGCCAACA GCTTCAAACCAGATCAGAAACTCTATATCGACCCTGGAAAGCTGTTACCG ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCAAAGAAAGC CTTCACAAATAACCGCGGCGGTGGCGGCGGTGGA------TTTGGAGGCC GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT GGAGGCGGAGGCGGTTTCCGAGGAGGAGCTGGTCGCAATGGAGGAGGTGG CGGCGGCGGAGGCGGT------TTTAACAGAGGAAGAGGAGGCAGCGGTG GTGGTGGT---------------GGTCGGGGTCGGTGG------------ --------- >D_erecta_CG4038-PA ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGTAGAGGATT TGGAGGAGGCGGTGGC------GGACGAGGATTTGGAGGAGGTGGTGGTG GACGCGGTGGCGGCGGCGGACGCGGAGGTGGCGGCGGATTCAACCGAGGA GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGATACTGGACCACCGGA GAGAGTAATCCCCTTGGGCAACTATGTATACTCCTGCCAAAATGACCTTG TGTGCAAAGTTGATATTCAGGATGTTCCGTATTTCAACGCGCCCATTTTC CTCGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGTACAGT TCGGGACTACAGCGTGTCCATCAAGCTGTCGGAGAACGTCTACGCCAACA GCTTCAAGCCAAATCAGAAACTTTTTATCGACCCTGGAAAGCTGTTACCG ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCGAAGAAGGC CTTCACAAATAACCGTGGTGGAGGCGGCGGTGGA------TTTGGAGGTC GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT GGAGGCGGT------TTCCGAGGAGGAGCTGGTCGCAATGGTGGAGGAGG AGGTGGCGGCGGCGGAGGCGGTTTTAACAGAGGAAGAGGAGGCGGCGGTG GT---------------------GGTCGGGGTCGGTGG------------ ---------
>D_melanogaster_CG4038-PA MGFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRG GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLFIDPGKLLP IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG GGG--FRGGAGRNGGGGGGGG---FNRGRGGGGGGGG----GRGRW >D_sechellia_CG4038-PA MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG GGG--FRGGAGR-GGGGGGGGGG-FNRGRGGGGGG-------RGRW >D_simulans_CG4038-PA MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP IARFLPKPPQPKGAKKAFTNNRGGGGGGG-FGGRGGGRGGGGRGGGGGRG GGG--FRGGAGR-GGGGGGGGGGGFNRGRGGGGGGGGGGGGGRGRW >D_yakuba_CG4038-PA MGFGKPRGGGGGGGR-FGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFNRG GGGRGGGRGAFDSGPPERVIPLGNYVYACQNDLVCKVDIQDVPYFNAPIF LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPDQKLYIDPGKLLP IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG GGGGGFRGGAGRNGGGGGGGGG--FNRGRGGSGGGG-----GRGRW >D_erecta_CG4038-PA MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFNRG GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF LENKEQVGKIDEIFGTVRDYSVSIKLSENVYANSFKPNQKLFIDPGKLLP IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG GGG--FRGGAGRNGGGGGGGGGGGFNRGRGGGGG-------GRGRW
#NEXUS
[ID: 1997545459]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_CG4038-PA
D_sechellia_CG4038-PA
D_simulans_CG4038-PA
D_yakuba_CG4038-PA
D_erecta_CG4038-PA
;
end;
begin trees;
translate
1 D_melanogaster_CG4038-PA,
2 D_sechellia_CG4038-PA,
3 D_simulans_CG4038-PA,
4 D_yakuba_CG4038-PA,
5 D_erecta_CG4038-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05932376,(4:0.04182334,5:0.05769975)1.000:0.07351324,(2:0.02246933,3:0.01451385)0.989:0.02450169);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05932376,(4:0.04182334,5:0.05769975):0.07351324,(2:0.02246933,3:0.01451385):0.02450169);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1492.24 -1504.61
2 -1492.58 -1505.07
--------------------------------------
TOTAL -1492.39 -1504.87
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.309377 0.002926 0.215577 0.421155 0.303538 1210.11 1212.61 1.000
r(A<->C){all} 0.101518 0.001723 0.022318 0.183122 0.099089 587.56 638.47 1.000
r(A<->G){all} 0.052691 0.000316 0.022435 0.088833 0.050588 645.09 870.30 1.000
r(A<->T){all} 0.315167 0.004607 0.185090 0.448524 0.313794 452.39 494.16 1.001
r(C<->G){all} 0.013782 0.000067 0.000057 0.028812 0.012535 921.03 1066.81 1.000
r(C<->T){all} 0.508875 0.004850 0.380184 0.650879 0.507765 409.32 480.27 1.000
r(G<->T){all} 0.007968 0.000058 0.000004 0.023265 0.005723 543.13 823.11 1.000
pi(A){all} 0.210209 0.000194 0.183599 0.238704 0.210064 1324.15 1329.31 1.000
pi(C){all} 0.218220 0.000207 0.190257 0.246401 0.218073 1274.97 1319.89 1.000
pi(G){all} 0.396147 0.000310 0.361699 0.430659 0.396214 1201.06 1230.26 1.000
pi(T){all} 0.175424 0.000172 0.151527 0.202016 0.175200 1136.46 1238.19 1.000
alpha{1,2} 0.042421 0.000907 0.000116 0.096570 0.038097 1327.69 1364.39 1.000
alpha{3} 2.132023 0.685901 0.726705 3.719047 2.015897 1176.01 1338.51 1.000
pinvar{all} 0.465818 0.006771 0.286759 0.606787 0.473849 1025.03 1201.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/138/CG4038-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 227
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 7 4 5 5 7 | Ser TCT 0 1 1 1 0 | Tyr TAT 1 1 1 2 2 | Cys TGT 0 0 0 0 0
TTC 8 11 10 9 8 | TCC 2 2 2 1 2 | TAC 4 4 4 4 3 | TGC 2 2 2 2 2
Leu TTA 1 1 1 1 1 | TCA 0 0 0 0 0 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 1 1 1 1 1 | TCG 1 1 1 1 1 | TAG 0 0 0 0 0 | Trp TGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 1 1 2 | Pro CCT 3 2 2 2 2 | His CAT 0 0 0 0 0 | Arg CGT 3 4 4 5 4
CTC 0 0 1 2 1 | CCC 4 5 4 3 3 | CAC 0 0 0 0 0 | CGC 4 4 4 5 5
CTA 0 0 0 0 0 | CCA 5 4 5 4 4 | Gln CAA 3 3 3 3 3 | CGA 8 7 7 4 5
CTG 4 4 4 3 3 | CCG 1 2 2 4 4 | CAG 2 2 2 2 2 | CGG 3 3 3 2 3
----------------------------------------------------------------------------------------------------------------------
Ile ATT 2 3 2 3 2 | Thr ACT 1 0 0 0 1 | Asn AAT 2 2 2 2 3 | Ser AGT 0 0 0 0 0
ATC 6 5 6 5 6 | ACC 0 0 0 0 0 | AAC 8 7 7 8 8 | AGC 2 2 2 3 2
ATA 0 0 0 0 0 | ACA 2 2 2 2 2 | Lys AAA 7 9 7 8 6 | Arg AGA 4 3 3 4 4
Met ATG 1 1 1 1 1 | ACG 0 0 0 0 0 | AAG 5 3 5 4 6 | AGG 0 1 1 2 1
----------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 3 | Ala GCT 1 1 1 1 1 | Asp GAT 2 2 2 3 3 | Gly GGT 27 21 19 26 28
GTC 2 2 2 1 1 | GCC 5 5 5 5 4 | GAC 6 7 7 6 4 | GGC 31 38 39 30 29
GTA 1 1 1 2 3 | GCA 0 0 0 1 0 | Glu GAA 2 1 1 2 2 | GGA 31 30 31 31 31
GTG 2 2 2 2 2 | GCG 1 1 1 1 2 | GAG 2 3 3 2 3 | GGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG4038-PA
position 1: T:0.12335 C:0.18502 A:0.17621 G:0.51542
position 2: T:0.18062 C:0.11454 A:0.19383 G:0.51101
position 3: T:0.24229 C:0.37004 A:0.28194 G:0.10573
Average T:0.18209 C:0.22320 A:0.21733 G:0.37739
#2: D_sechellia_CG4038-PA
position 1: T:0.12775 C:0.18502 A:0.16740 G:0.51982
position 2: T:0.18062 C:0.11454 A:0.19383 G:0.51101
position 3: T:0.20705 C:0.41410 A:0.26872 G:0.11013
Average T:0.17181 C:0.23789 A:0.20999 G:0.38032
#3: D_simulans_CG4038-PA
position 1: T:0.12775 C:0.18502 A:0.16740 G:0.51982
position 2: T:0.18062 C:0.11454 A:0.19383 G:0.51101
position 3: T:0.19383 C:0.41850 A:0.26872 G:0.11894
Average T:0.16740 C:0.23935 A:0.20999 G:0.38326
#4: D_yakuba_CG4038-PA
position 1: T:0.12335 C:0.17621 A:0.18502 G:0.51542
position 2: T:0.17621 C:0.11454 A:0.20264 G:0.50661
position 3: T:0.24229 C:0.37004 A:0.27313 G:0.11454
Average T:0.18062 C:0.22026 A:0.22026 G:0.37885
#5: D_erecta_CG4038-PA
position 1: T:0.12335 C:0.18062 A:0.18502 G:0.51101
position 2: T:0.18062 C:0.11454 A:0.19824 G:0.50661
position 3: T:0.25551 C:0.34361 A:0.26872 G:0.13216
Average T:0.18649 C:0.21292 A:0.21733 G:0.38326
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 28 | Ser S TCT 3 | Tyr Y TAT 7 | Cys C TGT 0
TTC 46 | TCC 9 | TAC 19 | TGC 10
Leu L TTA 5 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 5 | TCG 5 | TAG 0 | Trp W TGG 5
------------------------------------------------------------------------------
Leu L CTT 8 | Pro P CCT 11 | His H CAT 0 | Arg R CGT 20
CTC 4 | CCC 19 | CAC 0 | CGC 22
CTA 0 | CCA 22 | Gln Q CAA 15 | CGA 31
CTG 18 | CCG 13 | CAG 10 | CGG 14
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 2 | Asn N AAT 11 | Ser S AGT 0
ATC 28 | ACC 0 | AAC 38 | AGC 11
ATA 0 | ACA 10 | Lys K AAA 37 | Arg R AGA 18
Met M ATG 5 | ACG 0 | AAG 23 | AGG 5
------------------------------------------------------------------------------
Val V GTT 19 | Ala A GCT 5 | Asp D GAT 12 | Gly G GGT 121
GTC 8 | GCC 24 | GAC 30 | GGC 167
GTA 8 | GCA 1 | Glu E GAA 8 | GGA 154
GTG 10 | GCG 6 | GAG 13 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12511 C:0.18238 A:0.17621 G:0.51630
position 2: T:0.17974 C:0.11454 A:0.19648 G:0.50925
position 3: T:0.22819 C:0.38326 A:0.27225 G:0.11630
Average T:0.17768 C:0.22673 A:0.21498 G:0.38062
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG4038-PA
D_sechellia_CG4038-PA 0.0448 (0.0082 0.1832)
D_simulans_CG4038-PA 0.0523 (0.0082 0.1569)-1.0000 (0.0000 0.0658)
D_yakuba_CG4038-PA 0.0544 (0.0144 0.2639) 0.0696 (0.0143 0.2063) 0.0696 (0.0144 0.2063)
D_erecta_CG4038-PA 0.0227 (0.0061 0.2699) 0.0547 (0.0144 0.2629) 0.0580 (0.0144 0.2480) 0.0767 (0.0123 0.1599)
Model 0: one-ratio
TREE # 1: (1, (4, 5), (2, 3)); MP score: 88
check convergence..
lnL(ntime: 7 np: 9): -1314.188851 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.086806 0.079662 0.065809 0.083465 0.037368 0.031366 0.018424 2.275045 0.096999
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.40290
(1: 0.086806, (4: 0.065809, 5: 0.083465): 0.079662, (2: 0.031366, 3: 0.018424): 0.037368);
(D_melanogaster_CG4038-PA: 0.086806, (D_yakuba_CG4038-PA: 0.065809, D_erecta_CG4038-PA: 0.083465): 0.079662, (D_sechellia_CG4038-PA: 0.031366, D_simulans_CG4038-PA: 0.018424): 0.037368);
Detailed output identifying parameters
kappa (ts/tv) = 2.27505
omega (dN/dS) = 0.09700
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.087 432.5 248.5 0.0970 0.0066 0.0678 2.8 16.9
6..7 0.080 432.5 248.5 0.0970 0.0060 0.0623 2.6 15.5
7..4 0.066 432.5 248.5 0.0970 0.0050 0.0514 2.2 12.8
7..5 0.083 432.5 248.5 0.0970 0.0063 0.0652 2.7 16.2
6..8 0.037 432.5 248.5 0.0970 0.0028 0.0292 1.2 7.3
8..2 0.031 432.5 248.5 0.0970 0.0024 0.0245 1.0 6.1
8..3 0.018 432.5 248.5 0.0970 0.0014 0.0144 0.6 3.6
tree length for dN: 0.0305
tree length for dS: 0.3148
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 88
lnL(ntime: 7 np: 10): -1308.362881 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.089196 0.081391 0.065234 0.086220 0.037548 0.031515 0.018514 2.277182 0.902287 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.40962
(1: 0.089196, (4: 0.065234, 5: 0.086220): 0.081391, (2: 0.031515, 3: 0.018514): 0.037548);
(D_melanogaster_CG4038-PA: 0.089196, (D_yakuba_CG4038-PA: 0.065234, D_erecta_CG4038-PA: 0.086220): 0.081391, (D_sechellia_CG4038-PA: 0.031515, D_simulans_CG4038-PA: 0.018514): 0.037548);
Detailed output identifying parameters
kappa (ts/tv) = 2.27718
dN/dS (w) for site classes (K=2)
p: 0.90229 0.09771
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.089 432.5 248.5 0.0977 0.0068 0.0696 2.9 17.3
6..7 0.081 432.5 248.5 0.0977 0.0062 0.0635 2.7 15.8
7..4 0.065 432.5 248.5 0.0977 0.0050 0.0509 2.2 12.7
7..5 0.086 432.5 248.5 0.0977 0.0066 0.0673 2.8 16.7
6..8 0.038 432.5 248.5 0.0977 0.0029 0.0293 1.2 7.3
8..2 0.032 432.5 248.5 0.0977 0.0024 0.0246 1.0 6.1
8..3 0.019 432.5 248.5 0.0977 0.0014 0.0145 0.6 3.6
Time used: 0:05
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 88
lnL(ntime: 7 np: 12): -1307.912638 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.092598 0.081471 0.067336 0.088161 0.039463 0.032342 0.019068 2.290613 0.970416 0.000000 0.032641 3.180078
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.42044
(1: 0.092598, (4: 0.067336, 5: 0.088161): 0.081471, (2: 0.032342, 3: 0.019068): 0.039463);
(D_melanogaster_CG4038-PA: 0.092598, (D_yakuba_CG4038-PA: 0.067336, D_erecta_CG4038-PA: 0.088161): 0.081471, (D_sechellia_CG4038-PA: 0.032342, D_simulans_CG4038-PA: 0.019068): 0.039463);
Detailed output identifying parameters
kappa (ts/tv) = 2.29061
dN/dS (w) for site classes (K=3)
p: 0.97042 0.00000 0.02958
w: 0.03264 1.00000 3.18008
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.093 432.4 248.6 0.1258 0.0087 0.0694 3.8 17.2
6..7 0.081 432.4 248.6 0.1258 0.0077 0.0610 3.3 15.2
7..4 0.067 432.4 248.6 0.1258 0.0063 0.0505 2.7 12.5
7..5 0.088 432.4 248.6 0.1258 0.0083 0.0661 3.6 16.4
6..8 0.039 432.4 248.6 0.1258 0.0037 0.0296 1.6 7.4
8..2 0.032 432.4 248.6 0.1258 0.0030 0.0242 1.3 6.0
8..3 0.019 432.4 248.6 0.1258 0.0018 0.0143 0.8 3.6
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG4038-PA)
Pr(w>1) post mean +- SE for w
45 G 0.977* 3.108
60 T 0.994** 3.161
75 S 0.511 1.639
139 F 0.993** 3.157
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG4038-PA)
Pr(w>1) post mean +- SE for w
45 G 0.640 3.053 +- 2.408
60 T 0.854 4.114 +- 2.580
139 F 0.836 4.034 +- 2.588
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.999 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.157 0.186 0.170 0.138 0.106 0.079 0.059 0.045 0.034 0.026
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.010
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.015 0.974
sum of density on p0-p1 = 1.000000
Time used: 0:18
Model 3: discrete (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 88
lnL(ntime: 7 np: 13): -1307.912638 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.092598 0.081471 0.067336 0.088161 0.039463 0.032342 0.019068 2.290613 0.000000 0.970416 0.000001 0.032641 3.180081
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.42044
(1: 0.092598, (4: 0.067336, 5: 0.088161): 0.081471, (2: 0.032342, 3: 0.019068): 0.039463);
(D_melanogaster_CG4038-PA: 0.092598, (D_yakuba_CG4038-PA: 0.067336, D_erecta_CG4038-PA: 0.088161): 0.081471, (D_sechellia_CG4038-PA: 0.032342, D_simulans_CG4038-PA: 0.019068): 0.039463);
Detailed output identifying parameters
kappa (ts/tv) = 2.29061
dN/dS (w) for site classes (K=3)
p: 0.00000 0.97042 0.02958
w: 0.00000 0.03264 3.18008
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.093 432.4 248.6 0.1258 0.0087 0.0694 3.8 17.2
6..7 0.081 432.4 248.6 0.1258 0.0077 0.0610 3.3 15.2
7..4 0.067 432.4 248.6 0.1258 0.0063 0.0505 2.7 12.5
7..5 0.088 432.4 248.6 0.1258 0.0083 0.0661 3.6 16.4
6..8 0.039 432.4 248.6 0.1258 0.0037 0.0296 1.6 7.4
8..2 0.032 432.4 248.6 0.1258 0.0030 0.0242 1.3 6.0
8..3 0.019 432.4 248.6 0.1258 0.0018 0.0143 0.8 3.6
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG4038-PA)
Pr(w>1) post mean +- SE for w
45 G 0.977* 3.108
60 T 0.994** 3.161
75 S 0.511 1.639
139 F 0.993** 3.157
Time used: 0:25
Model 7: beta (10 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 88
lnL(ntime: 7 np: 10): -1308.365262 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.089319 0.081492 0.065333 0.086342 0.037606 0.031564 0.018545 2.277067 0.005000 0.048413
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41020
(1: 0.089319, (4: 0.065333, 5: 0.086342): 0.081492, (2: 0.031564, 3: 0.018545): 0.037606);
(D_melanogaster_CG4038-PA: 0.089319, (D_yakuba_CG4038-PA: 0.065333, D_erecta_CG4038-PA: 0.086342): 0.081492, (D_sechellia_CG4038-PA: 0.031564, D_simulans_CG4038-PA: 0.018545): 0.037606);
Detailed output identifying parameters
kappa (ts/tv) = 2.27707
Parameters in M7 (beta):
p = 0.00500 q = 0.04841
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.089 432.5 248.5 0.1000 0.0069 0.0695 3.0 17.3
6..7 0.081 432.5 248.5 0.1000 0.0063 0.0634 2.7 15.8
7..4 0.065 432.5 248.5 0.1000 0.0051 0.0508 2.2 12.6
7..5 0.086 432.5 248.5 0.1000 0.0067 0.0672 2.9 16.7
6..8 0.038 432.5 248.5 0.1000 0.0029 0.0293 1.3 7.3
8..2 0.032 432.5 248.5 0.1000 0.0025 0.0246 1.1 6.1
8..3 0.019 432.5 248.5 0.1000 0.0014 0.0144 0.6 3.6
Time used: 0:56
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 88
lnL(ntime: 7 np: 12): -1307.913159 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.092594 0.081483 0.067332 0.088164 0.039456 0.032343 0.019069 2.290611 0.970588 3.407800 99.000000 3.189210
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.42044
(1: 0.092594, (4: 0.067332, 5: 0.088164): 0.081483, (2: 0.032343, 3: 0.019069): 0.039456);
(D_melanogaster_CG4038-PA: 0.092594, (D_yakuba_CG4038-PA: 0.067332, D_erecta_CG4038-PA: 0.088164): 0.081483, (D_sechellia_CG4038-PA: 0.032343, D_simulans_CG4038-PA: 0.019069): 0.039456);
Detailed output identifying parameters
kappa (ts/tv) = 2.29061
Parameters in M8 (beta&w>1):
p0 = 0.97059 p = 3.40780 q = 99.00000
(p1 = 0.02941) w = 3.18921
dN/dS (w) for site classes (K=11)
p: 0.09706 0.09706 0.09706 0.09706 0.09706 0.09706 0.09706 0.09706 0.09706 0.09706 0.02941
w: 0.01026 0.01598 0.02028 0.02424 0.02821 0.03244 0.03722 0.04305 0.05110 0.06654 3.18921
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.093 432.4 248.6 0.1258 0.0087 0.0694 3.8 17.2
6..7 0.081 432.4 248.6 0.1258 0.0077 0.0611 3.3 15.2
7..4 0.067 432.4 248.6 0.1258 0.0063 0.0504 2.7 12.5
7..5 0.088 432.4 248.6 0.1258 0.0083 0.0661 3.6 16.4
6..8 0.039 432.4 248.6 0.1258 0.0037 0.0296 1.6 7.3
8..2 0.032 432.4 248.6 0.1258 0.0030 0.0242 1.3 6.0
8..3 0.019 432.4 248.6 0.1258 0.0018 0.0143 0.8 3.6
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG4038-PA)
Pr(w>1) post mean +- SE for w
45 G 0.971* 3.099
60 T 0.992** 3.165
75 S 0.507 1.638
139 F 0.991** 3.160
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG4038-PA)
Pr(w>1) post mean +- SE for w
45 G 0.750 2.594 +- 2.036
60 T 0.884 3.110 +- 2.119
139 F 0.872 3.073 +- 2.124
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.999
p : 0.993 0.007 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.001 0.007 0.028 0.066 0.120 0.186 0.258 0.334
ws: 0.311 0.251 0.164 0.102 0.064 0.041 0.027 0.018 0.013 0.009
Time used: 1:33
Model 1: NearlyNeutral -1308.362881 Model 2: PositiveSelection -1307.912638 Model 0: one-ratio -1314.188851 Model 3: discrete -1307.912638 Model 7: beta -1308.365262 Model 8: beta&w>1 -1307.913159 Model 0 vs 1 11.651940000000195 Model 2 vs 1 0.9004860000000008 Model 8 vs 7 0.9042060000001584
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
