--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Wed Nov 02 15:47:08 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/138/CG4038-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1492.24         -1504.61
2      -1492.58         -1505.07
--------------------------------------
TOTAL    -1492.39         -1504.87
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.309377    0.002926    0.215577    0.421155    0.303538   1210.11   1212.61    1.000
r(A<->C){all}   0.101518    0.001723    0.022318    0.183122    0.099089    587.56    638.47    1.000
r(A<->G){all}   0.052691    0.000316    0.022435    0.088833    0.050588    645.09    870.30    1.000
r(A<->T){all}   0.315167    0.004607    0.185090    0.448524    0.313794    452.39    494.16    1.001
r(C<->G){all}   0.013782    0.000067    0.000057    0.028812    0.012535    921.03   1066.81    1.000
r(C<->T){all}   0.508875    0.004850    0.380184    0.650879    0.507765    409.32    480.27    1.000
r(G<->T){all}   0.007968    0.000058    0.000004    0.023265    0.005723    543.13    823.11    1.000
pi(A){all}      0.210209    0.000194    0.183599    0.238704    0.210064   1324.15   1329.31    1.000
pi(C){all}      0.218220    0.000207    0.190257    0.246401    0.218073   1274.97   1319.89    1.000
pi(G){all}      0.396147    0.000310    0.361699    0.430659    0.396214   1201.06   1230.26    1.000
pi(T){all}      0.175424    0.000172    0.151527    0.202016    0.175200   1136.46   1238.19    1.000
alpha{1,2}      0.042421    0.000907    0.000116    0.096570    0.038097   1327.69   1364.39    1.000
alpha{3}        2.132023    0.685901    0.726705    3.719047    2.015897   1176.01   1338.51    1.000
pinvar{all}     0.465818    0.006771    0.286759    0.606787    0.473849   1025.03   1201.05    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1308.362881
Model 2: PositiveSelection	-1307.912638
Model 0: one-ratio	-1314.188851
Model 3: discrete	-1307.912638
Model 7: beta	-1308.365262
Model 8: beta&w>1	-1307.913159


Model 0 vs 1	11.651940000000195

Model 2 vs 1	0.9004860000000008

Model 8 vs 7	0.9042060000001584
>C1
MGFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLFIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
GGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGGRGRWooo
>C2
MGFGKPRGGGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGG
GRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIFLE
NKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLPIA
RFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRGGG
GFRGGAGRGGGGGGGGGGFNRGRGGGGGGRGRWooooooo
>C3
MGFGKPRGGGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGG
GRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIFLE
NKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLPIA
RFLPKPPQPKGAKKAFTNNRGGGGGGGFGGRGGGRGGGGRGGGGGRGGGG
FRGGAGRGGGGGGGGGGGFNRGRGGGGGGGGGGGGGRGRW
>C4
MGFGKPRGGGGGGGRFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFNRGG
GGRGGGRGAFDSGPPERVIPLGNYVYACQNDLVCKVDIQDVPYFNAPIFL
ENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPDQKLYIDPGKLLPI
ARFLPKPPQPKGAKKAFTNNRGGGGGGFGGRGGGRGGGGRGGGGGRGGGG
GGFRGGAGRNGGGGGGGGGFNRGRGGSGGGGGRGRWoooo
>C5
MGFGKPRGGGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFNRGGG
GRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIFLE
NKEQVGKIDEIFGTVRDYSVSIKLSENVYANSFKPNQKLFIDPGKLLPIA
RFLPKPPQPKGAKKAFTNNRGGGGGGFGGRGGGRGGGGRGGGGGRGGGGF
RGGAGRNGGGGGGGGGGGFNRGRGGGGGGRGRWooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=253 

C1              MGFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRG
C2              MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG
C3              MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG
C4              MGFGKPRGGGGGGGR-FGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFNRG
C5              MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFNRG
                *************** ******  ***********************.**

C1              GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
C2              GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
C3              GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
C4              GGGRGGGRGAFDSGPPERVIPLGNYVYACQNDLVCKVDIQDVPYFNAPIF
C5              GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
                ************:**********::**:**********************

C1              LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLFIDPGKLLP
C2              LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
C3              LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
C4              LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPDQKLYIDPGKLLP
C5              LENKEQVGKIDEIFGTVRDYSVSIKLSENVYANSFKPNQKLFIDPGKLLP
                ***************************:*********:***:********

C1              IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
C2              IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
C3              IARFLPKPPQPKGAKKAFTNNRGGGGGGG-FGGRGGGRGGGGRGGGGGRG
C4              IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG
C5              IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG
                ****************************  ********************

C1              GGG--FRGGAGRNGGGGGGGG---FNRGRGGGGGGGG----GRGRWooo-
C2              GGG--FRGGAGR-GGGGGGGGGG-FNRGRGGGGGG-------RGRWoooo
C3              GGG--FRGGAGR-GGGGGGGGGGGFNRGRGGGGGGGGGGGGGRGRW----
C4              GGGGGFRGGAGRNGGGGGGGGG--FNRGRGGSGGGG-----GRGRWoooo
C5              GGG--FRGGAGRNGGGGGGGGGGGFNRGRGGGGG-------GRGRWoooo
                ***  ******* ********   *******.**        ****    

C1              ---
C2              ooo
C3              ---
C4              ---
C5              ooo
                   




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  240 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  240 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6004]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [6004]--->[5898]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/138/CG4038-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.282 Mb, Max= 30.572 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MGFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLFIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGRNGGGGGGGG---FNRGRGGGGGGGG----GRGRWooo-
---
>C2
MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGR-GGGGGGGGGG-FNRGRGGGGGG-------RGRWoooo
ooo
>C3
MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGG-FGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGR-GGGGGGGGGGGFNRGRGGGGGGGGGGGGGRGRW----
---
>C4
MGFGKPRGGGGGGGR-FGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFNRG
GGGRGGGRGAFDSGPPERVIPLGNYVYACQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPDQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG
GGGGGFRGGAGRNGGGGGGGGG--FNRGRGGSGGGG-----GRGRWoooo
---
>C5
MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFNRG
GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSENVYANSFKPNQKLFIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGRNGGGGGGGGGGGFNRGRGGGGG-------GRGRWoooo
ooo

FORMAT of file /tmp/tmp2632559164231475388aln Not Supported[FATAL:T-COFFEE]
>C1
MGFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLFIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGRNGGGGGGGG---FNRGRGGGGGGGG----GRGRWooo-
---
>C2
MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGR-GGGGGGGGGG-FNRGRGGGGGG-------RGRWoooo
ooo
>C3
MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGG-FGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGR-GGGGGGGGGGGFNRGRGGGGGGGGGGGGGRGRW----
---
>C4
MGFGKPRGGGGGGGR-FGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFNRG
GGGRGGGRGAFDSGPPERVIPLGNYVYACQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPDQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG
GGGGGFRGGAGRNGGGGGGGGG--FNRGRGGSGGGG-----GRGRWoooo
---
>C5
MGFGKPRGGGGGGGRGFGGGGG--GRGFGGGGGGRGGGGGRGGGGGFNRG
GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSENVYANSFKPNQKLFIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGG--FGGRGGGRGGGGRGGGGGRG
GGG--FRGGAGRNGGGGGGGGGGGFNRGRGGGGG-------GRGRWoooo
ooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:253 S:92 BS:253
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 98.29 C1	 C2	 98.29
TOP	    1    0	 98.29 C2	 C1	 98.29
BOT	    0    2	 98.28 C1	 C3	 98.28
TOP	    2    0	 98.28 C3	 C1	 98.28
BOT	    0    3	 97.46 C1	 C4	 97.46
TOP	    3    0	 97.46 C4	 C1	 97.46
BOT	    0    4	 99.14 C1	 C5	 99.14
TOP	    4    0	 99.14 C5	 C1	 99.14
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 97.42 C2	 C4	 97.42
TOP	    3    1	 97.42 C4	 C2	 97.42
BOT	    1    4	 97.47 C2	 C5	 97.47
TOP	    4    1	 97.47 C5	 C2	 97.47
BOT	    2    3	 97.40 C3	 C4	 97.40
TOP	    3    2	 97.40 C4	 C3	 97.40
BOT	    2    4	 97.41 C3	 C5	 97.41
TOP	    4    2	 97.41 C5	 C3	 97.41
BOT	    3    4	 97.44 C4	 C5	 97.44
TOP	    4    3	 97.44 C5	 C4	 97.44
AVG	 0	 C1	  *	 98.29
AVG	 1	 C2	  *	 98.30
AVG	 2	 C3	  *	 98.27
AVG	 3	 C4	  *	 97.43
AVG	 4	 C5	  *	 97.86
TOT	 TOT	  *	 98.03
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGAGGCTT
C2              ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGAGGCTT
C3              ATGGGATTTGGTAAACCTCGTGGCGGCGGAGGCGGCGGCGGAAGAGGCTT
C4              ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGA---TT
C5              ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGTAGAGGATT
                *****************************:***********:***   **

C1              CGGTGGAGGCGGAGGCGGAGGAGGACGAGGATTTGGTGGAGGTGGAGGTG
C2              CGGAGGAGGCGGCGGC------GGACGAGGATTTGGAGGAGGTGGCGGCG
C3              CGGAGGAGGCGGCGGC------GGACGAGGATTTGGAGGAGGTGGCGGTG
C4              CGGAGGAGGTGGCGGCGGCGGCGGACGTGGATTTGGAGGAGGTGGTGGTG
C5              TGGAGGAGGCGGTGGC------GGACGAGGATTTGGAGGAGGTGGTGGTG
                 **:***** ** ***      *****:********:******** ** *

C1              GACGAGGAGGTGGCGGAGGACGCGGAGGTGGCGGCGGATTCGGTCGAGGT
C2              GACGCGGTGGTGGCGGCGGACGCGGAGGTGGTGGCGGATTCGGCCGTGGA
C3              GACGCGGTGGTGGTGGCGGACGCGGAGGTGGCGGCGGATTCGGCCGTGGA
C4              GACGCGGTGGTGGCGGCGGACGTGGAGGTGGCGGCGGATTCAACCGAGGA
C5              GACGCGGTGGCGGCGGCGGACGCGGAGGTGGCGGCGGATTCAACCGAGGA
                ****.**:** ** **.***** ******** *********.. **:**:

C1              GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACACTGGTCCACCAGA
C2              GGCGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACTCTGGTCCACCGGA
C3              GGCGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACTCTGGTCCACCGGA
C4              GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGATTCTGGTCCACCGGA
C5              GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGATACTGGACCACCGGA
                **.******************************** :****:*****.**

C1              GAGAGTCATCCCCTTGGGCAACTATGTTTACTCCTGCCAAAACGACCTTG
C2              GAGAGTCATCCCCTTGGGCGACTTCGTTTACTCCTGCCAAAACGACCTTG
C3              GAGAGTCATCCCATTGGGCGACTTCGTTTACTCCTGCCAAAACGACCTCG
C4              GAGAGTAATCCCCTTGGGCAACTACGTTTACGCCTGCCAAAATGACCTTG
C5              GAGAGTAATCCCCTTGGGCAACTATGTATACTCCTGCCAAAATGACCTTG
                ******.*****.******.***: **:*** ********** ***** *

C1              TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC
C2              TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC
C3              TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC
C4              TGTGCAAAGTTGACATTCAGGATGTTCCGTATTTCAACGCGCCCATTTTC
C5              TGTGCAAAGTTGATATTCAGGATGTTCCGTATTTCAACGCGCCCATTTTC
                ************* ************** ** ******************

C1              CTTGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGAACAGT
C2              CTTGAAAACAAGGAGCAAGTAGGCAAAATTGACGAGATCTTTGGAACAGT
C3              CTTGAAAACAAGGAGCAAGTAGGCAAAATCGACGAGATCTTTGGAACAGT
C4              CTCGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGTACAGT
C5              CTCGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGTACAGT
                ** ************************** *****.********:*****

C1              TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA
C2              TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA
C3              TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA
C4              TAGGGACTACAGCGTGTCCATTAAGCTGTCGGACAACGTCTACGCCAACA
C5              TCGGGACTACAGCGTGTCCATCAAGCTGTCGGAGAACGTCTACGCCAACA
                *.******************* *********** ****************

C1              GCTTCAAGCCAAATCAGAAACTGTTTATCGACCCTGGAAAGCTGTTACCC
C2              GCTTCAAACCAAATCAGAAACTGTATATCGACCCTGGAAAACTGTTACCC
C3              GCTTCAAGCCAAATCAGAAACTGTATATCGACCCTGGAAAGCTGTTACCC
C4              GCTTCAAACCAGATCAGAAACTCTATATCGACCCTGGAAAGCTGTTACCG
C5              GCTTCAAGCCAAATCAGAAACTTTTTATCGACCCTGGAAAGCTGTTACCG
                *******.***.********** *:***************.******** 

C1              ATCGCCAGATTTCTGCCGAAACCTCCACAACCAAAAGGCGCCAAGAAAGC
C2              ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCCAAGAAAGC
C3              ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCCAAGAAAGC
C4              ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCAAAGAAAGC
C5              ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCGAAGAAGGC
                ********.** *********** ***************** *****.**

C1              CTTCACAAATAACCGAGGTGGAGGCGGCGGTGGCGGTGGATTTGGAGGCC
C2              CTTCACAAATAACCGAGGCGGAGGCGGCGGTGGCGGTGGATTTGGAGGCC
C3              CTTCACAAATAACCGAGGCGGAGGCGGCGGTGGCGGA---TTTGGAGGCC
C4              CTTCACAAATAACCGCGGCGGTGGCGGCGGTGGA------TTTGGAGGCC
C5              CTTCACAAATAACCGTGGTGGAGGCGGCGGTGGA------TTTGGAGGTC
                *************** ** **:***********.      ******** *

C1              GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT
C2              GAGGTGGTGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGC
C3              GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGC
C4              GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT
C5              GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT
                ******* ***************************************** 

C1              GGAGGCGGA------TTCCGAGGAGGTGCTGGTCGCAATGGAGGAGGTGG
C2              GGAGGCGGA------TTCCGAGGAGGAGCTGGTCGA---GGAGGAGGTGG
C3              GGAGGCGGA------TTCCGAGGAGGAGCTGGTCGA---GGAGGAGGTGG
C4              GGAGGCGGAGGCGGTTTCCGAGGAGGAGCTGGTCGCAATGGAGGAGGTGG
C5              GGAGGCGGT------TTCCGAGGAGGAGCTGGTCGCAATGGTGGAGGAGG
                ********:      ***********:********.   **:*****:**

C1              CGGCGGCGGCGGT---------TTTAACAGAGGACGAGGAGGCGGTGGCG
C2              CGGCGGCGGCGGCGGCGGT---TTCAACAGAGGACGAGGAGGCGGCGGCG
C3              CGGCGGCGGCGGCGGCGGCGGTTTTAACAGAGGACGAGGAGGCGGCGGCG
C4              CGGCGGCGGAGGCGGT------TTTAACAGAGGAAGAGGAGGCAGCGGTG
C5              AGGTGGCGGCGGCGGAGGCGGTTTTAACAGAGGAAGAGGAGGCGGCGGTG
                .** *****.**          ** *********.********.* ** *

C1              GCGGCGGCGGT------------GGTCGGGGTCGGTGG------------
C2              GTGGT---------------------CGGGGTCGGTGG------------
C3              GCGGCGGCGGCGGCGGCGGTGGTGGTCGGGGTCGGTGG------------
C4              GTGGTGGT---------------GGTCGGGGTCGGTGG------------
C5              GT---------------------GGTCGGGGTCGGTGG------------
                *                         ************            

C1              ---------
C2              ---------
C3              ---------
C4              ---------
C5              ---------
                         



>C1
ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGAGGCTT
CGGTGGAGGCGGAGGCGGAGGAGGACGAGGATTTGGTGGAGGTGGAGGTG
GACGAGGAGGTGGCGGAGGACGCGGAGGTGGCGGCGGATTCGGTCGAGGT
GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACACTGGTCCACCAGA
GAGAGTCATCCCCTTGGGCAACTATGTTTACTCCTGCCAAAACGACCTTG
TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC
CTTGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGAACAGT
TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA
GCTTCAAGCCAAATCAGAAACTGTTTATCGACCCTGGAAAGCTGTTACCC
ATCGCCAGATTTCTGCCGAAACCTCCACAACCAAAAGGCGCCAAGAAAGC
CTTCACAAATAACCGAGGTGGAGGCGGCGGTGGCGGTGGATTTGGAGGCC
GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT
GGAGGCGGA------TTCCGAGGAGGTGCTGGTCGCAATGGAGGAGGTGG
CGGCGGCGGCGGT---------TTTAACAGAGGACGAGGAGGCGGTGGCG
GCGGCGGCGGT------------GGTCGGGGTCGGTGG------------
---------
>C2
ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGAGGCTT
CGGAGGAGGCGGCGGC------GGACGAGGATTTGGAGGAGGTGGCGGCG
GACGCGGTGGTGGCGGCGGACGCGGAGGTGGTGGCGGATTCGGCCGTGGA
GGCGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACTCTGGTCCACCGGA
GAGAGTCATCCCCTTGGGCGACTTCGTTTACTCCTGCCAAAACGACCTTG
TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC
CTTGAAAACAAGGAGCAAGTAGGCAAAATTGACGAGATCTTTGGAACAGT
TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA
GCTTCAAACCAAATCAGAAACTGTATATCGACCCTGGAAAACTGTTACCC
ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCCAAGAAAGC
CTTCACAAATAACCGAGGCGGAGGCGGCGGTGGCGGTGGATTTGGAGGCC
GAGGTGGTGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGC
GGAGGCGGA------TTCCGAGGAGGAGCTGGTCGA---GGAGGAGGTGG
CGGCGGCGGCGGCGGCGGT---TTCAACAGAGGACGAGGAGGCGGCGGCG
GTGGT---------------------CGGGGTCGGTGG------------
---------
>C3
ATGGGATTTGGTAAACCTCGTGGCGGCGGAGGCGGCGGCGGAAGAGGCTT
CGGAGGAGGCGGCGGC------GGACGAGGATTTGGAGGAGGTGGCGGTG
GACGCGGTGGTGGTGGCGGACGCGGAGGTGGCGGCGGATTCGGCCGTGGA
GGCGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGACTCTGGTCCACCGGA
GAGAGTCATCCCATTGGGCGACTTCGTTTACTCCTGCCAAAACGACCTCG
TGTGCAAAGTTGATATTCAGGATGTTCCCTACTTCAACGCGCCCATTTTC
CTTGAAAACAAGGAGCAAGTAGGCAAAATCGACGAGATCTTTGGAACAGT
TCGGGACTACAGCGTGTCCATCAAGCTGTCGGACAACGTCTACGCCAACA
GCTTCAAGCCAAATCAGAAACTGTATATCGACCCTGGAAAGCTGTTACCC
ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCCAAGAAAGC
CTTCACAAATAACCGAGGCGGAGGCGGCGGTGGCGGA---TTTGGAGGCC
GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGC
GGAGGCGGA------TTCCGAGGAGGAGCTGGTCGA---GGAGGAGGTGG
CGGCGGCGGCGGCGGCGGCGGTTTTAACAGAGGACGAGGAGGCGGCGGCG
GCGGCGGCGGCGGCGGCGGTGGTGGTCGGGGTCGGTGG------------
---------
>C4
ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGAAGA---TT
CGGAGGAGGTGGCGGCGGCGGCGGACGTGGATTTGGAGGAGGTGGTGGTG
GACGCGGTGGTGGCGGCGGACGTGGAGGTGGCGGCGGATTCAACCGAGGA
GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGATTCTGGTCCACCGGA
GAGAGTAATCCCCTTGGGCAACTACGTTTACGCCTGCCAAAATGACCTTG
TGTGCAAAGTTGACATTCAGGATGTTCCGTATTTCAACGCGCCCATTTTC
CTCGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGTACAGT
TAGGGACTACAGCGTGTCCATTAAGCTGTCGGACAACGTCTACGCCAACA
GCTTCAAACCAGATCAGAAACTCTATATCGACCCTGGAAAGCTGTTACCG
ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCAAAGAAAGC
CTTCACAAATAACCGCGGCGGTGGCGGCGGTGGA------TTTGGAGGCC
GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT
GGAGGCGGAGGCGGTTTCCGAGGAGGAGCTGGTCGCAATGGAGGAGGTGG
CGGCGGCGGAGGCGGT------TTTAACAGAGGAAGAGGAGGCAGCGGTG
GTGGTGGT---------------GGTCGGGGTCGGTGG------------
---------
>C5
ATGGGATTTGGTAAACCTCGTGGCGGCGGTGGCGGCGGCGGTAGAGGATT
TGGAGGAGGCGGTGGC------GGACGAGGATTTGGAGGAGGTGGTGGTG
GACGCGGTGGCGGCGGCGGACGCGGAGGTGGCGGCGGATTCAACCGAGGA
GGAGGTGGACGTGGTGGCGGCCGTGGAGCCTTCGATACTGGACCACCGGA
GAGAGTAATCCCCTTGGGCAACTATGTATACTCCTGCCAAAATGACCTTG
TGTGCAAAGTTGATATTCAGGATGTTCCGTATTTCAACGCGCCCATTTTC
CTCGAAAACAAGGAGCAAGTAGGCAAAATCGACGAAATCTTTGGTACAGT
TCGGGACTACAGCGTGTCCATCAAGCTGTCGGAGAACGTCTACGCCAACA
GCTTCAAGCCAAATCAGAAACTTTTTATCGACCCTGGAAAGCTGTTACCG
ATCGCCAGGTTCCTGCCGAAACCCCCACAACCAAAAGGCGCGAAGAAGGC
CTTCACAAATAACCGTGGTGGAGGCGGCGGTGGA------TTTGGAGGTC
GAGGTGGCGGCCGCGGAGGAGGTGGTCGCGGTGGTGGCGGCGGACGAGGT
GGAGGCGGT------TTCCGAGGAGGAGCTGGTCGCAATGGTGGAGGAGG
AGGTGGCGGCGGCGGAGGCGGTTTTAACAGAGGAAGAGGAGGCGGCGGTG
GT---------------------GGTCGGGGTCGGTGG------------
---------
>C1
MGFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLFIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
GGGooFRGGAGRNGGGGGGGGoooFNRGRGGGGGGGGooooGRGRW
>C2
MGFGKPRGGGGGGGRGFGGGGGooGRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRG
GGGooFRGGAGRoGGGGGGGGGGoFNRGRGGGGGGoooooooRGRW
>C3
MGFGKPRGGGGGGGRGFGGGGGooGRGFGGGGGGRGGGGGRGGGGGFGRG
GGGRGGGRGAFDSGPPERVIPLGDFVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGGoFGGRGGGRGGGGRGGGGGRG
GGGooFRGGAGRoGGGGGGGGGGGFNRGRGGGGGGGGGGGGGRGRW
>C4
MGFGKPRGGGGGGGRoFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFNRG
GGGRGGGRGAFDSGPPERVIPLGNYVYACQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPDQKLYIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGooFGGRGGGRGGGGRGGGGGRG
GGGGGFRGGAGRNGGGGGGGGGooFNRGRGGSGGGGoooooGRGRW
>C5
MGFGKPRGGGGGGGRGFGGGGGooGRGFGGGGGGRGGGGGRGGGGGFNRG
GGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIF
LENKEQVGKIDEIFGTVRDYSVSIKLSENVYANSFKPNQKLFIDPGKLLP
IARFLPKPPQPKGAKKAFTNNRGGGGGGooFGGRGGGRGGGGRGGGGGRG
GGGooFRGGAGRNGGGGGGGGGGGFNRGRGGGGGoooooooGRGRW


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 759 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1478101325
      Setting output file names to "/opt/ADOPS/138/CG4038-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1334575096
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 1997545459
      Seed = 108233389
      Swapseed = 1478101325
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 27 unique site patterns
      Division 2 has 22 unique site patterns
      Division 3 has 62 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1874.550158 -- -25.624409
         Chain 2 -- -1847.028388 -- -25.624409
         Chain 3 -- -1883.701606 -- -25.624409
         Chain 4 -- -1818.625875 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1839.630018 -- -25.624409
         Chain 2 -- -1859.466733 -- -25.624409
         Chain 3 -- -1884.738168 -- -25.624409
         Chain 4 -- -1893.392025 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1874.550] (-1847.028) (-1883.702) (-1818.626) * [-1839.630] (-1859.467) (-1884.738) (-1893.392) 
        500 -- [-1571.860] (-1575.611) (-1564.902) (-1585.945) * (-1568.883) (-1589.780) [-1557.585] (-1579.284) -- 0:00:00
       1000 -- (-1559.618) (-1562.177) (-1554.698) [-1549.579] * (-1560.854) (-1554.665) [-1546.453] (-1566.698) -- 0:00:00
       1500 -- (-1562.353) (-1553.442) (-1546.958) [-1535.525] * [-1538.492] (-1540.062) (-1540.372) (-1558.371) -- 0:00:00
       2000 -- (-1556.247) (-1549.317) (-1538.477) [-1533.102] * (-1524.510) [-1535.298] (-1536.285) (-1552.257) -- 0:00:00
       2500 -- (-1535.335) (-1542.234) [-1523.162] (-1523.187) * (-1517.344) [-1517.231] (-1530.016) (-1532.167) -- 0:00:00
       3000 -- (-1521.009) [-1510.955] (-1515.714) (-1517.114) * (-1503.662) [-1510.672] (-1515.364) (-1531.871) -- 0:00:00
       3500 -- (-1513.238) [-1501.862] (-1515.776) (-1512.478) * (-1510.824) [-1500.477] (-1512.287) (-1516.920) -- 0:00:00
       4000 -- (-1507.979) [-1506.742] (-1512.293) (-1511.370) * (-1503.934) [-1499.249] (-1503.328) (-1505.310) -- 0:00:00
       4500 -- (-1508.538) (-1501.097) (-1506.777) [-1506.737] * (-1502.901) (-1499.210) (-1501.608) [-1501.279] -- 0:03:41
       5000 -- (-1506.524) (-1500.243) (-1509.828) [-1502.353] * (-1504.536) [-1491.828] (-1499.243) (-1499.859) -- 0:03:19

      Average standard deviation of split frequencies: 0.052378

       5500 -- (-1504.003) [-1500.613] (-1499.732) (-1512.496) * [-1502.801] (-1498.451) (-1496.908) (-1497.439) -- 0:03:00
       6000 -- (-1506.271) [-1494.648] (-1511.143) (-1501.034) * [-1496.049] (-1498.058) (-1507.451) (-1493.376) -- 0:02:45
       6500 -- [-1497.292] (-1492.920) (-1499.287) (-1504.537) * (-1497.344) (-1498.096) (-1504.065) [-1491.649] -- 0:02:32
       7000 -- (-1500.850) [-1489.556] (-1496.297) (-1498.000) * (-1498.448) (-1496.348) [-1496.209] (-1498.708) -- 0:02:21
       7500 -- (-1500.067) [-1494.671] (-1497.969) (-1497.910) * (-1500.262) (-1496.487) (-1502.077) [-1492.860] -- 0:02:12
       8000 -- (-1496.355) [-1490.580] (-1496.163) (-1492.465) * (-1497.537) [-1506.751] (-1494.707) (-1491.793) -- 0:02:04
       8500 -- [-1494.764] (-1498.421) (-1501.433) (-1501.492) * (-1503.165) (-1499.133) [-1495.126] (-1495.140) -- 0:01:56
       9000 -- (-1494.980) (-1491.354) (-1495.039) [-1496.786] * (-1495.869) (-1502.101) [-1497.926] (-1497.829) -- 0:01:50
       9500 -- (-1496.462) [-1490.451] (-1499.175) (-1500.021) * (-1498.462) (-1496.160) [-1504.065] (-1504.458) -- 0:03:28
      10000 -- (-1496.523) [-1498.296] (-1497.255) (-1495.053) * (-1503.236) (-1501.981) [-1500.386] (-1503.803) -- 0:03:18

      Average standard deviation of split frequencies: 0.022097

      10500 -- (-1492.917) (-1496.141) (-1491.434) [-1496.797] * (-1504.827) (-1503.318) [-1499.020] (-1493.575) -- 0:03:08
      11000 -- (-1494.215) [-1497.000] (-1495.701) (-1503.564) * (-1494.302) (-1501.188) [-1494.360] (-1499.287) -- 0:02:59
      11500 -- (-1503.575) (-1497.270) [-1493.001] (-1503.173) * (-1497.059) (-1492.245) [-1497.084] (-1494.423) -- 0:02:51
      12000 -- (-1502.871) (-1502.897) [-1492.937] (-1496.089) * (-1499.772) (-1495.828) (-1491.432) [-1496.163] -- 0:02:44
      12500 -- (-1498.825) [-1502.714] (-1493.946) (-1492.556) * (-1504.970) (-1494.985) (-1497.996) [-1496.468] -- 0:02:38
      13000 -- (-1497.590) [-1491.328] (-1496.911) (-1494.228) * (-1500.581) (-1496.635) [-1497.312] (-1503.083) -- 0:02:31
      13500 -- [-1496.963] (-1498.624) (-1500.652) (-1498.270) * (-1495.887) [-1499.851] (-1498.925) (-1506.909) -- 0:02:26
      14000 -- (-1498.674) (-1501.478) (-1499.290) [-1498.547] * (-1498.294) [-1498.642] (-1495.213) (-1504.307) -- 0:03:31
      14500 -- (-1494.608) [-1498.792] (-1497.772) (-1498.071) * (-1496.090) (-1499.029) [-1496.154] (-1492.843) -- 0:03:23
      15000 -- (-1500.409) (-1494.359) (-1498.754) [-1503.311] * (-1494.191) (-1497.429) [-1496.344] (-1491.894) -- 0:03:17

      Average standard deviation of split frequencies: 0.029463

      15500 -- (-1505.244) (-1495.506) (-1499.812) [-1495.389] * (-1498.285) (-1496.081) [-1495.876] (-1496.423) -- 0:03:10
      16000 -- [-1498.917] (-1493.708) (-1507.888) (-1496.840) * [-1495.594] (-1493.682) (-1492.784) (-1497.406) -- 0:03:04
      16500 -- (-1494.748) (-1501.752) [-1503.822] (-1499.055) * (-1495.531) (-1496.508) [-1489.695] (-1495.354) -- 0:02:58
      17000 -- (-1504.040) (-1496.366) [-1503.889] (-1497.400) * (-1499.230) (-1498.610) (-1499.201) [-1493.807] -- 0:02:53
      17500 -- (-1498.647) (-1499.340) (-1510.933) [-1504.355] * (-1496.672) (-1500.376) (-1499.949) [-1499.309] -- 0:02:48
      18000 -- (-1504.381) (-1498.606) (-1507.058) [-1494.253] * (-1489.097) [-1497.219] (-1495.691) (-1494.728) -- 0:02:43
      18500 -- [-1492.741] (-1502.640) (-1496.137) (-1497.393) * (-1493.836) (-1495.854) (-1494.629) [-1499.703] -- 0:02:39
      19000 -- [-1495.665] (-1497.320) (-1500.552) (-1491.749) * [-1494.457] (-1500.282) (-1494.434) (-1499.019) -- 0:03:26
      19500 -- (-1504.814) [-1498.884] (-1499.475) (-1496.818) * (-1494.090) (-1512.134) (-1493.869) [-1494.753] -- 0:03:21
      20000 -- [-1492.084] (-1497.986) (-1497.024) (-1495.940) * [-1492.457] (-1500.297) (-1495.631) (-1493.891) -- 0:03:16

      Average standard deviation of split frequencies: 0.011405

      20500 -- (-1497.094) (-1501.203) [-1502.658] (-1496.958) * (-1494.076) (-1492.950) (-1501.550) [-1496.358] -- 0:03:11
      21000 -- [-1494.569] (-1503.583) (-1491.947) (-1490.546) * (-1495.988) (-1496.111) (-1495.572) [-1492.869] -- 0:03:06
      21500 -- (-1498.320) (-1501.717) (-1497.665) [-1496.428] * (-1497.335) [-1496.778] (-1502.830) (-1499.988) -- 0:03:02
      22000 -- [-1495.586] (-1495.696) (-1498.515) (-1497.832) * (-1494.543) (-1500.734) [-1498.443] (-1495.949) -- 0:02:57
      22500 -- [-1498.338] (-1495.212) (-1494.298) (-1497.328) * (-1494.769) (-1498.852) [-1496.262] (-1501.848) -- 0:02:53
      23000 -- (-1494.449) [-1502.029] (-1496.916) (-1496.728) * [-1493.454] (-1495.087) (-1496.483) (-1493.460) -- 0:02:49
      23500 -- (-1496.818) [-1492.874] (-1499.444) (-1500.656) * (-1498.279) [-1495.416] (-1496.393) (-1492.858) -- 0:02:46
      24000 -- (-1494.205) (-1497.270) [-1499.939] (-1495.004) * (-1502.999) (-1500.036) (-1501.622) [-1491.646] -- 0:03:23
      24500 -- [-1496.846] (-1495.131) (-1493.343) (-1496.667) * (-1497.441) (-1505.129) [-1495.864] (-1497.706) -- 0:03:19
      25000 -- (-1497.967) (-1490.131) (-1498.856) [-1496.438] * (-1490.849) [-1496.868] (-1496.397) (-1495.521) -- 0:03:15

      Average standard deviation of split frequencies: 0.009065

      25500 -- (-1506.939) (-1494.037) [-1495.524] (-1501.017) * [-1495.016] (-1500.510) (-1497.186) (-1494.505) -- 0:03:11
      26000 -- [-1498.220] (-1494.047) (-1495.434) (-1500.445) * (-1501.896) (-1494.405) (-1500.365) [-1502.700] -- 0:03:07
      26500 -- (-1497.357) (-1499.865) (-1498.987) [-1495.821] * (-1505.880) [-1494.237] (-1498.955) (-1499.511) -- 0:03:03
      27000 -- (-1499.935) (-1496.712) (-1496.962) [-1496.316] * (-1501.415) [-1491.905] (-1494.054) (-1493.213) -- 0:03:00
      27500 -- (-1498.176) [-1494.140] (-1496.621) (-1497.450) * (-1491.304) (-1492.102) [-1492.478] (-1495.724) -- 0:02:56
      28000 -- (-1496.346) (-1496.528) (-1494.916) [-1493.845] * [-1493.168] (-1496.468) (-1498.770) (-1501.245) -- 0:02:53
      28500 -- [-1501.485] (-1495.185) (-1497.523) (-1497.902) * (-1493.981) (-1499.274) [-1490.036] (-1501.327) -- 0:02:50
      29000 -- (-1500.629) (-1493.078) [-1496.720] (-1494.336) * (-1502.353) [-1499.916] (-1494.068) (-1499.868) -- 0:03:20
      29500 -- (-1500.472) [-1497.126] (-1491.681) (-1493.699) * (-1500.162) (-1497.090) [-1493.805] (-1492.746) -- 0:03:17
      30000 -- (-1497.905) (-1503.401) [-1502.279] (-1504.324) * (-1497.367) (-1498.299) [-1491.018] (-1490.291) -- 0:03:14

      Average standard deviation of split frequencies: 0.007686

      30500 -- [-1500.488] (-1493.486) (-1499.328) (-1499.145) * (-1497.933) (-1499.619) [-1490.854] (-1497.070) -- 0:03:10
      31000 -- (-1492.953) (-1499.688) (-1495.109) [-1493.014] * (-1494.407) (-1498.346) (-1496.184) [-1497.538] -- 0:03:07
      31500 -- (-1496.781) (-1491.595) (-1500.841) [-1499.160] * (-1496.353) (-1494.590) (-1495.456) [-1492.389] -- 0:03:04
      32000 -- (-1498.994) [-1494.129] (-1500.099) (-1495.585) * (-1500.430) [-1495.781] (-1497.061) (-1498.668) -- 0:03:01
      32500 -- (-1489.770) (-1502.593) [-1498.024] (-1491.596) * [-1495.891] (-1491.531) (-1502.106) (-1496.049) -- 0:02:58
      33000 -- [-1504.234] (-1498.474) (-1494.656) (-1494.571) * (-1496.354) (-1490.590) (-1505.412) [-1495.524] -- 0:02:55
      33500 -- (-1500.378) (-1495.201) [-1492.944] (-1495.373) * [-1497.144] (-1497.427) (-1497.011) (-1495.471) -- 0:03:21
      34000 -- (-1501.982) (-1497.403) (-1496.997) [-1496.208] * (-1498.088) (-1491.088) (-1491.585) [-1499.769] -- 0:03:18
      34500 -- [-1494.141] (-1493.008) (-1497.072) (-1491.086) * [-1497.558] (-1499.397) (-1492.947) (-1497.061) -- 0:03:15
      35000 -- (-1496.091) (-1494.767) [-1492.707] (-1494.262) * (-1505.242) (-1499.177) (-1493.345) [-1494.838] -- 0:03:13

      Average standard deviation of split frequencies: 0.013095

      35500 -- (-1497.518) [-1496.346] (-1504.234) (-1496.890) * (-1503.776) [-1493.064] (-1499.730) (-1493.495) -- 0:03:10
      36000 -- [-1493.012] (-1494.975) (-1497.132) (-1496.935) * (-1506.233) (-1496.626) (-1496.553) [-1492.156] -- 0:03:07
      36500 -- [-1495.748] (-1499.112) (-1492.888) (-1494.099) * (-1500.349) (-1494.770) (-1498.501) [-1493.129] -- 0:03:04
      37000 -- (-1502.017) [-1493.695] (-1496.788) (-1502.482) * (-1503.765) (-1495.568) [-1498.649] (-1494.286) -- 0:03:02
      37500 -- (-1498.841) (-1488.265) [-1497.589] (-1494.201) * [-1501.443] (-1501.232) (-1502.110) (-1493.425) -- 0:02:59
      38000 -- (-1498.685) [-1495.995] (-1502.273) (-1498.691) * [-1499.894] (-1496.952) (-1495.940) (-1494.665) -- 0:02:57
      38500 -- (-1497.029) (-1491.071) (-1496.129) [-1496.560] * (-1508.657) (-1502.557) [-1495.187] (-1498.862) -- 0:03:19
      39000 -- (-1492.061) [-1489.396] (-1495.811) (-1495.393) * (-1502.521) (-1499.353) (-1491.407) [-1498.301] -- 0:03:17
      39500 -- (-1494.647) [-1494.548] (-1507.364) (-1501.589) * (-1503.116) (-1497.605) (-1500.297) [-1496.513] -- 0:03:14
      40000 -- (-1495.886) [-1494.573] (-1493.584) (-1499.891) * (-1502.051) (-1506.751) (-1496.752) [-1493.979] -- 0:03:12

      Average standard deviation of split frequencies: 0.011592

      40500 -- (-1500.165) (-1494.661) (-1494.047) [-1497.441] * (-1497.366) (-1500.791) (-1493.818) [-1502.839] -- 0:03:09
      41000 -- [-1495.878] (-1497.732) (-1494.630) (-1498.237) * (-1491.645) (-1494.775) (-1493.038) [-1499.973] -- 0:03:07
      41500 -- (-1493.575) [-1491.722] (-1492.133) (-1497.591) * [-1491.689] (-1499.778) (-1497.516) (-1495.310) -- 0:03:04
      42000 -- [-1497.107] (-1500.717) (-1494.018) (-1499.048) * (-1493.215) (-1501.970) (-1499.561) [-1496.517] -- 0:03:02
      42500 -- [-1496.620] (-1497.872) (-1497.035) (-1502.126) * (-1497.032) (-1498.548) (-1497.990) [-1492.642] -- 0:03:00
      43000 -- (-1494.311) [-1494.103] (-1493.552) (-1503.744) * [-1495.713] (-1494.391) (-1509.444) (-1501.285) -- 0:03:20
      43500 -- (-1492.329) (-1499.813) [-1496.587] (-1503.553) * (-1503.388) (-1495.680) [-1497.043] (-1496.905) -- 0:03:17
      44000 -- (-1498.659) (-1498.391) (-1493.447) [-1495.386] * (-1498.472) (-1493.570) (-1506.261) [-1496.277] -- 0:03:15
      44500 -- (-1494.803) (-1498.030) [-1494.622] (-1498.468) * (-1496.564) [-1493.282] (-1499.197) (-1499.105) -- 0:03:13
      45000 -- (-1499.098) [-1493.781] (-1506.417) (-1496.542) * (-1493.522) (-1491.583) [-1496.572] (-1498.888) -- 0:03:11

      Average standard deviation of split frequencies: 0.010248

      45500 -- (-1498.954) (-1500.785) (-1490.772) [-1496.594] * [-1493.782] (-1492.817) (-1502.713) (-1493.320) -- 0:03:08
      46000 -- (-1499.220) (-1493.795) [-1494.242] (-1495.156) * (-1499.747) (-1494.640) (-1494.182) [-1499.397] -- 0:03:06
      46500 -- (-1498.167) (-1503.456) [-1496.326] (-1493.042) * [-1505.570] (-1495.545) (-1498.298) (-1499.172) -- 0:03:04
      47000 -- [-1494.864] (-1497.783) (-1493.896) (-1493.454) * (-1502.864) (-1502.697) (-1494.743) [-1496.742] -- 0:03:02
      47500 -- (-1494.899) (-1501.858) [-1491.230] (-1500.846) * (-1491.479) [-1496.536] (-1497.159) (-1500.771) -- 0:03:00
      48000 -- (-1501.695) (-1496.380) (-1496.051) [-1495.108] * (-1490.823) (-1499.411) [-1497.818] (-1496.569) -- 0:03:18
      48500 -- (-1496.687) (-1498.994) (-1494.425) [-1499.077] * (-1489.965) (-1501.298) [-1499.457] (-1494.736) -- 0:03:16
      49000 -- [-1494.581] (-1497.265) (-1494.309) (-1493.823) * [-1496.509] (-1498.216) (-1501.971) (-1497.657) -- 0:03:14
      49500 -- (-1496.696) (-1496.334) [-1495.971] (-1499.995) * [-1497.535] (-1490.472) (-1494.332) (-1499.945) -- 0:03:12
      50000 -- (-1492.966) (-1495.621) [-1500.408] (-1501.517) * (-1493.056) (-1500.910) (-1496.702) [-1493.428] -- 0:03:10

      Average standard deviation of split frequencies: 0.009304

      50500 -- (-1498.251) [-1493.320] (-1498.489) (-1501.108) * (-1493.750) (-1497.484) [-1498.964] (-1495.784) -- 0:03:08
      51000 -- (-1494.315) (-1495.916) [-1497.424] (-1505.301) * (-1494.186) [-1494.329] (-1499.661) (-1498.012) -- 0:03:06
      51500 -- (-1497.810) [-1496.326] (-1497.368) (-1498.767) * [-1500.274] (-1496.079) (-1495.533) (-1497.508) -- 0:03:04
      52000 -- (-1498.737) (-1496.287) [-1496.536] (-1497.868) * (-1504.039) (-1500.291) (-1492.846) [-1494.864] -- 0:03:02
      52500 -- (-1496.323) (-1495.861) (-1497.013) [-1495.956] * [-1499.145] (-1493.826) (-1498.223) (-1494.312) -- 0:03:00
      53000 -- (-1499.051) [-1493.764] (-1509.062) (-1494.062) * (-1494.423) [-1491.117] (-1494.318) (-1502.085) -- 0:03:16
      53500 -- [-1498.800] (-1493.276) (-1506.201) (-1501.103) * [-1500.949] (-1500.244) (-1500.151) (-1498.370) -- 0:03:14
      54000 -- (-1498.757) [-1490.596] (-1501.516) (-1491.542) * (-1496.382) [-1495.858] (-1498.349) (-1495.545) -- 0:03:12
      54500 -- (-1493.073) (-1502.063) (-1499.060) [-1496.045] * (-1499.344) (-1491.505) [-1490.617] (-1492.158) -- 0:03:10
      55000 -- (-1499.330) (-1496.794) (-1495.078) [-1492.513] * (-1493.166) (-1499.532) (-1495.454) [-1495.647] -- 0:03:09

      Average standard deviation of split frequencies: 0.008418

      55500 -- (-1495.760) [-1495.822] (-1496.030) (-1490.841) * (-1492.711) [-1493.147] (-1496.945) (-1496.078) -- 0:03:07
      56000 -- (-1503.280) (-1499.811) (-1494.639) [-1491.502] * [-1498.770] (-1494.685) (-1493.941) (-1496.451) -- 0:03:05
      56500 -- (-1502.718) (-1496.274) [-1495.568] (-1494.514) * (-1499.598) (-1493.867) (-1489.427) [-1499.251] -- 0:03:03
      57000 -- (-1496.453) (-1495.505) (-1498.689) [-1492.330] * (-1503.537) (-1496.885) [-1492.490] (-1501.271) -- 0:03:01
      57500 -- (-1498.625) (-1500.307) (-1499.166) [-1494.944] * (-1494.864) [-1493.032] (-1495.238) (-1505.187) -- 0:03:00
      58000 -- (-1495.548) (-1498.853) [-1492.041] (-1496.621) * [-1498.015] (-1490.193) (-1495.790) (-1504.953) -- 0:03:14
      58500 -- (-1504.003) (-1493.832) [-1498.084] (-1490.119) * [-1499.641] (-1496.165) (-1499.306) (-1496.539) -- 0:03:13
      59000 -- (-1496.607) (-1500.206) [-1502.631] (-1497.557) * [-1494.373] (-1497.946) (-1495.483) (-1501.909) -- 0:03:11
      59500 -- (-1499.020) (-1498.566) [-1493.004] (-1499.173) * (-1498.729) (-1499.292) [-1497.187] (-1498.573) -- 0:03:09
      60000 -- (-1508.880) [-1495.265] (-1496.379) (-1506.383) * (-1497.589) (-1492.871) (-1496.660) [-1499.306] -- 0:03:08

      Average standard deviation of split frequencies: 0.007770

      60500 -- (-1507.413) (-1492.402) (-1490.926) [-1499.237] * (-1501.431) [-1494.727] (-1497.697) (-1506.803) -- 0:03:06
      61000 -- (-1501.602) [-1495.308] (-1494.533) (-1494.928) * (-1496.743) [-1497.666] (-1498.587) (-1501.830) -- 0:03:04
      61500 -- (-1497.333) [-1492.914] (-1498.119) (-1506.152) * [-1498.324] (-1502.392) (-1496.212) (-1504.162) -- 0:03:03
      62000 -- [-1498.904] (-1494.421) (-1499.535) (-1494.118) * (-1500.422) (-1505.063) [-1495.740] (-1501.980) -- 0:03:01
      62500 -- (-1495.887) [-1495.321] (-1494.329) (-1496.979) * (-1500.925) (-1500.887) (-1490.757) [-1492.255] -- 0:03:15
      63000 -- (-1509.264) [-1491.948] (-1500.840) (-1496.397) * (-1493.407) (-1509.687) [-1490.842] (-1496.618) -- 0:03:13
      63500 -- (-1496.546) [-1494.697] (-1492.926) (-1503.898) * (-1502.843) (-1500.196) [-1499.693] (-1498.355) -- 0:03:11
      64000 -- (-1497.749) (-1496.390) (-1499.386) [-1493.885] * (-1492.745) (-1496.494) (-1497.378) [-1495.931] -- 0:03:10
      64500 -- (-1493.693) (-1494.777) [-1495.375] (-1498.269) * (-1497.679) (-1494.571) (-1499.877) [-1495.458] -- 0:03:08
      65000 -- (-1495.958) (-1499.119) [-1494.057] (-1499.954) * (-1497.515) (-1501.564) (-1507.560) [-1492.655] -- 0:03:07

      Average standard deviation of split frequencies: 0.007142

      65500 -- (-1495.279) (-1499.737) (-1498.546) [-1495.983] * [-1493.274] (-1501.911) (-1496.598) (-1491.993) -- 0:03:05
      66000 -- [-1493.159] (-1499.931) (-1497.303) (-1494.691) * (-1496.885) [-1491.484] (-1495.930) (-1495.894) -- 0:03:03
      66500 -- (-1497.616) (-1501.799) (-1502.906) [-1496.529] * (-1496.173) [-1492.046] (-1494.095) (-1495.741) -- 0:03:02
      67000 -- [-1504.331] (-1495.749) (-1498.519) (-1493.016) * (-1498.575) [-1499.828] (-1496.608) (-1498.522) -- 0:03:01
      67500 -- (-1495.686) (-1495.338) [-1504.284] (-1495.535) * (-1497.343) [-1496.682] (-1509.588) (-1502.769) -- 0:03:13
      68000 -- (-1504.022) (-1497.831) (-1507.505) [-1494.901] * (-1497.525) (-1494.984) (-1496.783) [-1496.443] -- 0:03:11
      68500 -- (-1495.023) (-1500.826) [-1500.535] (-1498.607) * (-1505.104) (-1495.601) [-1491.472] (-1498.378) -- 0:03:10
      69000 -- [-1503.985] (-1502.707) (-1500.538) (-1500.103) * (-1504.854) (-1503.362) [-1495.541] (-1497.615) -- 0:03:08
      69500 -- (-1494.404) (-1496.378) (-1508.645) [-1491.214] * (-1503.885) (-1499.290) [-1496.969] (-1501.994) -- 0:03:07
      70000 -- [-1494.569] (-1496.988) (-1512.243) (-1495.819) * (-1505.823) (-1499.200) [-1490.645] (-1503.771) -- 0:03:06

      Average standard deviation of split frequencies: 0.010006

      70500 -- [-1494.738] (-1498.379) (-1500.435) (-1493.165) * (-1495.700) (-1500.779) (-1496.210) [-1494.654] -- 0:03:04
      71000 -- (-1492.724) [-1496.221] (-1495.429) (-1497.521) * (-1491.562) (-1501.985) [-1498.627] (-1491.343) -- 0:03:03
      71500 -- [-1503.018] (-1502.822) (-1496.901) (-1490.977) * (-1496.324) (-1504.346) (-1502.483) [-1493.158] -- 0:03:01
      72000 -- [-1494.774] (-1500.501) (-1497.054) (-1500.694) * [-1493.016] (-1500.976) (-1505.560) (-1496.829) -- 0:03:00
      72500 -- [-1495.056] (-1499.301) (-1500.104) (-1493.321) * [-1491.098] (-1496.501) (-1501.368) (-1498.945) -- 0:03:11
      73000 -- [-1497.259] (-1497.700) (-1502.070) (-1493.068) * (-1493.994) [-1495.728] (-1502.062) (-1490.955) -- 0:03:10
      73500 -- (-1511.390) [-1499.770] (-1498.504) (-1496.717) * [-1495.656] (-1492.469) (-1500.114) (-1492.508) -- 0:03:09
      74000 -- [-1497.293] (-1502.279) (-1498.395) (-1498.058) * (-1490.455) [-1496.353] (-1496.537) (-1493.401) -- 0:03:07
      74500 -- (-1502.077) [-1496.749] (-1500.688) (-1495.486) * (-1501.729) (-1497.539) (-1496.896) [-1497.303] -- 0:03:06
      75000 -- (-1500.940) (-1505.016) (-1500.317) [-1494.680] * (-1498.511) [-1494.027] (-1497.297) (-1490.238) -- 0:03:05

      Average standard deviation of split frequencies: 0.009304

      75500 -- (-1496.904) (-1505.394) [-1497.026] (-1501.761) * (-1506.578) [-1492.140] (-1498.855) (-1500.490) -- 0:03:03
      76000 -- [-1493.502] (-1497.087) (-1498.544) (-1498.186) * [-1498.778] (-1495.162) (-1495.805) (-1501.371) -- 0:03:02
      76500 -- [-1496.775] (-1495.105) (-1495.568) (-1498.836) * [-1491.037] (-1500.717) (-1500.444) (-1492.634) -- 0:03:01
      77000 -- [-1493.325] (-1499.021) (-1494.911) (-1502.555) * [-1495.255] (-1502.263) (-1497.999) (-1494.740) -- 0:03:11
      77500 -- [-1493.925] (-1510.503) (-1494.752) (-1502.727) * (-1491.202) [-1493.107] (-1494.785) (-1500.780) -- 0:03:10
      78000 -- (-1492.414) [-1500.460] (-1493.670) (-1496.153) * (-1489.759) [-1492.428] (-1494.136) (-1497.161) -- 0:03:09
      78500 -- (-1496.784) (-1494.046) [-1492.509] (-1497.220) * (-1496.183) (-1491.200) (-1502.608) [-1494.389] -- 0:03:07
      79000 -- (-1502.989) (-1500.011) (-1497.801) [-1495.183] * [-1493.841] (-1495.298) (-1498.236) (-1495.918) -- 0:03:06
      79500 -- [-1495.314] (-1495.614) (-1499.691) (-1494.157) * (-1495.421) (-1496.212) [-1500.262] (-1497.154) -- 0:03:05
      80000 -- (-1496.129) [-1489.436] (-1499.760) (-1501.000) * (-1497.168) (-1494.575) [-1496.295] (-1496.316) -- 0:03:04

      Average standard deviation of split frequencies: 0.008766

      80500 -- (-1496.006) (-1494.896) (-1492.738) [-1492.509] * (-1496.985) (-1493.710) [-1497.486] (-1501.266) -- 0:03:02
      81000 -- (-1504.726) (-1497.369) (-1498.562) [-1494.139] * (-1504.808) (-1494.748) (-1492.988) [-1492.152] -- 0:03:01
      81500 -- [-1494.967] (-1501.311) (-1493.621) (-1496.961) * (-1498.863) [-1493.510] (-1502.465) (-1498.243) -- 0:03:00
      82000 -- (-1492.835) (-1495.507) (-1495.994) [-1496.862] * (-1501.079) (-1493.205) (-1493.535) [-1492.571] -- 0:03:10
      82500 -- [-1494.112] (-1498.497) (-1501.096) (-1493.926) * (-1499.876) [-1501.932] (-1492.657) (-1493.671) -- 0:03:09
      83000 -- (-1500.259) (-1500.704) (-1504.235) [-1494.991] * (-1495.685) (-1498.128) [-1494.818] (-1496.767) -- 0:03:07
      83500 -- (-1492.123) [-1502.665] (-1504.513) (-1494.721) * [-1499.108] (-1500.005) (-1499.963) (-1493.683) -- 0:03:06
      84000 -- (-1503.871) (-1493.886) [-1495.284] (-1497.334) * (-1503.143) [-1497.748] (-1496.377) (-1494.892) -- 0:03:05
      84500 -- (-1496.474) (-1492.045) (-1496.222) [-1492.564] * (-1507.387) (-1503.153) (-1503.104) [-1495.865] -- 0:03:04
      85000 -- (-1501.371) [-1490.884] (-1499.153) (-1501.540) * (-1496.942) (-1497.228) [-1492.376] (-1495.569) -- 0:03:03

      Average standard deviation of split frequencies: 0.008222

      85500 -- (-1497.020) (-1498.068) [-1497.435] (-1494.380) * [-1496.457] (-1499.189) (-1497.109) (-1494.080) -- 0:03:01
      86000 -- (-1492.355) [-1502.792] (-1501.978) (-1499.169) * [-1497.000] (-1501.765) (-1498.055) (-1504.528) -- 0:03:00
      86500 -- [-1489.587] (-1499.819) (-1501.245) (-1498.825) * (-1495.953) (-1495.657) (-1504.840) [-1496.745] -- 0:03:10
      87000 -- [-1498.042] (-1495.820) (-1498.416) (-1494.830) * (-1496.093) (-1500.492) (-1502.446) [-1501.131] -- 0:03:08
      87500 -- (-1497.409) [-1494.714] (-1498.935) (-1500.534) * [-1495.344] (-1498.479) (-1500.064) (-1499.444) -- 0:03:07
      88000 -- [-1490.660] (-1500.645) (-1497.848) (-1497.034) * [-1501.991] (-1495.982) (-1495.321) (-1507.099) -- 0:03:06
      88500 -- (-1494.541) [-1495.652] (-1504.671) (-1503.041) * (-1505.545) (-1495.739) [-1497.917] (-1495.462) -- 0:03:05
      89000 -- (-1492.880) (-1494.795) [-1495.170] (-1498.960) * (-1494.608) (-1498.177) (-1495.094) [-1492.977] -- 0:03:04
      89500 -- (-1500.591) (-1497.470) (-1502.375) [-1494.390] * [-1493.688] (-1501.461) (-1493.857) (-1495.754) -- 0:03:03
      90000 -- [-1492.643] (-1491.372) (-1509.056) (-1498.465) * (-1490.366) (-1501.171) [-1497.784] (-1496.145) -- 0:03:02

      Average standard deviation of split frequencies: 0.007799

      90500 -- (-1501.266) (-1493.886) (-1503.249) [-1494.011] * (-1496.252) (-1500.071) (-1504.712) [-1499.734] -- 0:03:00
      91000 -- (-1494.652) (-1496.357) [-1498.386] (-1497.022) * (-1498.063) (-1502.125) [-1495.177] (-1498.814) -- 0:02:59
      91500 -- (-1503.619) (-1500.483) [-1497.825] (-1499.304) * (-1501.139) [-1493.478] (-1494.522) (-1501.974) -- 0:03:08
      92000 -- [-1496.000] (-1497.870) (-1503.915) (-1498.642) * [-1497.829] (-1498.215) (-1496.311) (-1495.814) -- 0:03:07
      92500 -- (-1499.270) (-1498.758) (-1501.911) [-1496.538] * (-1494.306) [-1494.872] (-1492.331) (-1498.796) -- 0:03:06
      93000 -- (-1501.383) [-1498.039] (-1498.192) (-1506.635) * (-1493.575) (-1495.981) [-1491.886] (-1501.817) -- 0:03:05
      93500 -- (-1494.916) (-1495.165) [-1496.336] (-1498.987) * (-1496.249) [-1498.129] (-1495.454) (-1502.870) -- 0:03:04
      94000 -- (-1496.663) (-1498.698) [-1495.302] (-1498.484) * (-1501.231) (-1496.379) [-1492.439] (-1502.710) -- 0:03:03
      94500 -- (-1496.424) (-1493.160) (-1495.355) [-1494.182] * (-1496.478) [-1493.151] (-1492.715) (-1499.570) -- 0:03:02
      95000 -- (-1494.061) (-1501.132) (-1502.826) [-1496.927] * [-1497.503] (-1506.148) (-1497.468) (-1504.650) -- 0:03:01

      Average standard deviation of split frequencies: 0.007366

      95500 -- (-1498.506) (-1499.902) (-1500.870) [-1491.345] * (-1495.862) (-1505.260) [-1495.678] (-1502.074) -- 0:02:59
      96000 -- (-1496.539) (-1497.916) (-1497.872) [-1492.369] * (-1500.986) (-1502.779) [-1493.126] (-1494.258) -- 0:02:58
      96500 -- (-1495.202) (-1493.681) (-1501.413) [-1493.382] * (-1499.504) (-1502.989) (-1499.934) [-1495.784] -- 0:03:07
      97000 -- (-1496.342) [-1498.239] (-1494.502) (-1498.882) * (-1496.889) (-1501.353) (-1492.631) [-1494.371] -- 0:03:06
      97500 -- [-1495.538] (-1490.548) (-1495.822) (-1490.760) * (-1498.044) (-1509.020) (-1499.952) [-1502.750] -- 0:03:05
      98000 -- (-1497.419) [-1494.490] (-1495.959) (-1493.287) * (-1497.526) (-1508.730) (-1494.721) [-1494.864] -- 0:03:04
      98500 -- (-1499.091) (-1490.476) [-1490.350] (-1498.744) * [-1496.914] (-1498.083) (-1491.524) (-1499.362) -- 0:03:03
      99000 -- [-1496.548] (-1491.140) (-1491.341) (-1496.332) * (-1502.168) (-1496.331) (-1491.688) [-1493.676] -- 0:03:02
      99500 -- [-1501.803] (-1492.672) (-1492.668) (-1495.141) * [-1492.282] (-1499.714) (-1496.415) (-1493.646) -- 0:03:01
      100000 -- [-1494.049] (-1492.719) (-1496.315) (-1494.391) * (-1499.584) [-1498.691] (-1498.977) (-1495.941) -- 0:03:00

      Average standard deviation of split frequencies: 0.007024

      100500 -- (-1496.812) (-1498.025) [-1498.202] (-1502.917) * (-1495.986) (-1493.979) (-1499.666) [-1498.160] -- 0:02:59
      101000 -- (-1501.636) (-1494.887) [-1496.529] (-1498.535) * [-1497.235] (-1510.437) (-1499.437) (-1497.667) -- 0:03:06
      101500 -- [-1494.256] (-1502.075) (-1513.289) (-1507.754) * (-1493.118) (-1503.110) [-1495.959] (-1494.232) -- 0:03:05
      102000 -- [-1492.130] (-1508.430) (-1496.565) (-1496.078) * (-1493.244) (-1511.936) [-1492.010] (-1497.120) -- 0:03:04
      102500 -- [-1490.155] (-1497.317) (-1493.953) (-1504.568) * (-1495.773) [-1504.686] (-1495.630) (-1499.706) -- 0:03:03
      103000 -- (-1493.103) (-1498.129) (-1498.671) [-1497.990] * (-1495.500) (-1495.021) [-1494.100] (-1500.816) -- 0:03:02
      103500 -- (-1494.205) [-1494.783] (-1496.942) (-1490.998) * (-1495.929) (-1498.903) [-1500.522] (-1504.515) -- 0:03:01
      104000 -- (-1501.856) (-1491.848) (-1495.853) [-1500.155] * [-1494.113] (-1505.829) (-1498.399) (-1498.985) -- 0:03:00
      104500 -- (-1495.761) [-1491.886] (-1499.120) (-1500.489) * (-1497.015) (-1496.039) [-1492.363] (-1495.538) -- 0:02:59
      105000 -- (-1497.726) [-1496.611] (-1501.399) (-1502.935) * (-1497.172) (-1495.819) [-1493.144] (-1499.606) -- 0:02:59

      Average standard deviation of split frequencies: 0.008894

      105500 -- (-1497.154) [-1499.204] (-1499.002) (-1506.011) * (-1497.838) (-1510.717) [-1495.844] (-1496.489) -- 0:02:58
      106000 -- [-1494.991] (-1505.531) (-1496.820) (-1505.642) * (-1497.762) (-1498.061) (-1498.439) [-1495.858] -- 0:03:05
      106500 -- [-1496.857] (-1496.506) (-1501.147) (-1500.521) * (-1494.782) (-1498.061) (-1496.973) [-1495.615] -- 0:03:04
      107000 -- (-1502.939) (-1497.489) (-1497.562) [-1498.684] * (-1503.843) (-1497.534) (-1500.123) [-1501.757] -- 0:03:03
      107500 -- [-1501.363] (-1504.842) (-1505.584) (-1497.193) * [-1494.488] (-1493.370) (-1490.608) (-1503.839) -- 0:03:02
      108000 -- (-1491.595) (-1500.647) (-1498.311) [-1494.509] * [-1497.030] (-1493.800) (-1493.591) (-1496.779) -- 0:03:01
      108500 -- [-1494.216] (-1499.282) (-1504.791) (-1492.818) * (-1497.914) [-1498.753] (-1491.626) (-1498.312) -- 0:03:00
      109000 -- [-1497.150] (-1500.527) (-1497.789) (-1494.545) * (-1492.789) (-1498.543) [-1497.122] (-1493.317) -- 0:02:59
      109500 -- (-1498.201) (-1501.276) [-1495.463] (-1490.858) * (-1501.080) (-1499.835) [-1495.100] (-1494.694) -- 0:02:58
      110000 -- (-1503.686) (-1500.125) (-1499.484) [-1493.284] * (-1500.842) (-1503.449) (-1496.674) [-1492.322] -- 0:02:58

      Average standard deviation of split frequencies: 0.012779

      110500 -- (-1507.548) (-1493.958) (-1501.700) [-1496.604] * (-1497.433) (-1492.995) (-1499.116) [-1492.728] -- 0:02:57
      111000 -- (-1506.030) [-1495.112] (-1498.790) (-1493.629) * [-1495.697] (-1492.906) (-1501.645) (-1495.512) -- 0:03:04
      111500 -- [-1497.917] (-1497.119) (-1501.647) (-1493.662) * (-1500.265) (-1500.034) (-1491.583) [-1490.272] -- 0:03:03
      112000 -- (-1498.413) (-1496.350) (-1497.894) [-1493.907] * (-1496.288) (-1492.028) [-1495.455] (-1499.558) -- 0:03:02
      112500 -- (-1496.260) (-1494.590) [-1496.903] (-1497.357) * [-1492.675] (-1502.932) (-1490.698) (-1500.670) -- 0:03:01
      113000 -- (-1501.856) (-1495.898) (-1496.016) [-1491.701] * (-1497.028) (-1495.590) (-1497.692) [-1497.971] -- 0:03:00
      113500 -- (-1496.086) (-1494.808) (-1494.887) [-1492.920] * (-1498.370) (-1493.226) [-1491.944] (-1502.104) -- 0:02:59
      114000 -- (-1492.530) (-1493.186) (-1492.448) [-1497.477] * (-1494.923) (-1491.079) [-1492.060] (-1503.802) -- 0:02:58
      114500 -- [-1495.562] (-1497.350) (-1493.149) (-1503.109) * (-1500.415) (-1495.324) (-1494.514) [-1494.969] -- 0:02:57
      115000 -- (-1504.206) [-1491.606] (-1492.170) (-1503.061) * (-1506.177) (-1496.762) [-1490.833] (-1493.638) -- 0:02:57

      Average standard deviation of split frequencies: 0.012191

      115500 -- (-1501.010) (-1496.727) [-1496.262] (-1511.198) * (-1501.323) (-1498.358) [-1495.140] (-1496.793) -- 0:03:03
      116000 -- (-1500.162) (-1497.347) [-1492.897] (-1501.113) * (-1501.418) [-1491.325] (-1491.715) (-1497.199) -- 0:03:02
      116500 -- (-1495.146) (-1496.016) [-1496.943] (-1505.208) * (-1500.448) (-1498.390) [-1496.147] (-1493.010) -- 0:03:02
      117000 -- [-1501.337] (-1493.002) (-1506.964) (-1499.426) * (-1496.987) [-1489.352] (-1492.413) (-1494.704) -- 0:03:01
      117500 -- (-1497.908) (-1496.675) [-1500.664] (-1495.459) * (-1492.579) (-1492.565) [-1501.828] (-1493.869) -- 0:03:00
      118000 -- [-1499.985] (-1506.060) (-1502.028) (-1492.653) * (-1499.986) [-1496.231] (-1493.855) (-1493.212) -- 0:02:59
      118500 -- (-1495.183) (-1496.138) [-1497.613] (-1500.639) * [-1499.583] (-1493.402) (-1494.765) (-1498.020) -- 0:02:58
      119000 -- (-1497.445) (-1498.069) [-1496.566] (-1497.308) * [-1494.188] (-1502.033) (-1491.000) (-1494.480) -- 0:02:57
      119500 -- (-1494.994) [-1491.609] (-1492.525) (-1497.148) * [-1493.534] (-1496.351) (-1493.395) (-1502.574) -- 0:02:56
      120000 -- (-1499.867) (-1497.452) (-1496.256) [-1495.789] * [-1500.197] (-1493.555) (-1494.634) (-1499.254) -- 0:02:56

      Average standard deviation of split frequencies: 0.011720

      120500 -- (-1506.981) [-1492.446] (-1502.111) (-1495.054) * (-1491.992) [-1491.731] (-1497.219) (-1498.316) -- 0:03:02
      121000 -- (-1497.644) (-1497.651) (-1496.254) [-1495.311] * [-1495.298] (-1493.759) (-1502.189) (-1495.301) -- 0:03:01
      121500 -- (-1496.648) [-1496.046] (-1497.635) (-1498.702) * (-1494.995) (-1492.811) (-1490.628) [-1494.801] -- 0:03:00
      122000 -- [-1494.518] (-1495.173) (-1497.963) (-1500.055) * (-1495.187) (-1492.971) (-1510.467) [-1497.542] -- 0:02:59
      122500 -- (-1490.673) [-1492.632] (-1499.126) (-1502.698) * (-1506.510) (-1496.359) [-1497.149] (-1499.332) -- 0:02:59
      123000 -- (-1493.459) [-1498.428] (-1496.926) (-1495.646) * [-1503.415] (-1496.824) (-1502.411) (-1504.654) -- 0:02:58
      123500 -- (-1495.825) (-1503.226) (-1500.758) [-1498.684] * (-1496.220) [-1492.464] (-1497.362) (-1500.305) -- 0:02:57
      124000 -- (-1502.941) (-1503.530) (-1499.498) [-1493.999] * [-1497.291] (-1494.347) (-1499.483) (-1501.654) -- 0:02:56
      124500 -- (-1491.359) (-1497.693) (-1494.198) [-1505.567] * (-1497.071) (-1496.461) (-1503.116) [-1493.997] -- 0:02:55
      125000 -- (-1498.078) (-1493.322) [-1493.253] (-1509.895) * [-1494.099] (-1493.893) (-1501.331) (-1495.725) -- 0:02:55

      Average standard deviation of split frequencies: 0.011224

      125500 -- (-1505.102) [-1497.698] (-1494.656) (-1502.488) * (-1490.475) (-1498.147) (-1493.189) [-1494.206] -- 0:03:01
      126000 -- (-1495.011) (-1497.213) [-1489.327] (-1492.661) * (-1490.542) (-1500.907) (-1499.878) [-1499.975] -- 0:03:00
      126500 -- (-1506.065) (-1492.505) [-1492.516] (-1494.357) * (-1495.565) (-1501.500) [-1494.288] (-1495.637) -- 0:02:59
      127000 -- [-1496.753] (-1492.774) (-1502.057) (-1494.989) * (-1501.734) (-1496.805) (-1499.003) [-1494.721] -- 0:02:58
      127500 -- (-1493.201) (-1497.165) (-1503.670) [-1491.282] * (-1498.456) [-1493.914] (-1499.802) (-1499.465) -- 0:02:57
      128000 -- (-1498.722) (-1500.413) [-1498.518] (-1495.991) * (-1498.314) (-1494.324) [-1496.629] (-1495.296) -- 0:02:57
      128500 -- [-1496.358] (-1499.483) (-1498.343) (-1492.431) * [-1495.091] (-1498.387) (-1498.006) (-1498.473) -- 0:02:56
      129000 -- (-1498.057) (-1500.818) [-1492.925] (-1492.773) * (-1502.475) [-1496.797] (-1495.787) (-1497.861) -- 0:02:55
      129500 -- [-1495.261] (-1498.689) (-1492.628) (-1499.382) * (-1501.499) (-1495.080) (-1496.267) [-1503.848] -- 0:02:54
      130000 -- [-1490.793] (-1502.138) (-1494.708) (-1501.544) * [-1499.348] (-1501.725) (-1491.700) (-1495.861) -- 0:02:54

      Average standard deviation of split frequencies: 0.010823

      130500 -- [-1493.368] (-1494.059) (-1492.064) (-1498.187) * (-1502.000) (-1494.653) [-1493.921] (-1494.298) -- 0:02:59
      131000 -- (-1493.627) (-1497.717) [-1489.905] (-1493.252) * [-1496.367] (-1496.811) (-1501.478) (-1502.485) -- 0:02:59
      131500 -- [-1497.265] (-1496.436) (-1496.218) (-1497.917) * [-1491.783] (-1496.927) (-1492.752) (-1502.045) -- 0:02:58
      132000 -- [-1493.485] (-1505.749) (-1494.929) (-1497.109) * (-1495.619) (-1494.830) [-1496.366] (-1496.385) -- 0:02:57
      132500 -- [-1491.872] (-1502.174) (-1493.588) (-1495.287) * (-1496.172) (-1494.445) [-1499.006] (-1495.958) -- 0:02:56
      133000 -- (-1495.095) (-1498.840) [-1491.317] (-1495.476) * (-1498.691) [-1495.355] (-1495.988) (-1492.464) -- 0:02:56
      133500 -- (-1498.286) [-1496.502] (-1508.362) (-1492.573) * (-1499.456) (-1499.781) (-1500.129) [-1502.468] -- 0:02:55
      134000 -- (-1500.617) (-1493.914) [-1496.216] (-1496.783) * (-1493.550) (-1504.996) (-1498.467) [-1495.365] -- 0:02:54
      134500 -- (-1497.107) (-1505.407) (-1496.859) [-1494.920] * (-1502.802) (-1511.103) [-1492.967] (-1490.320) -- 0:02:53
      135000 -- (-1490.399) (-1501.616) [-1495.568] (-1496.169) * (-1499.301) (-1498.493) (-1492.628) [-1493.324] -- 0:02:59

      Average standard deviation of split frequencies: 0.008666

      135500 -- [-1494.295] (-1501.340) (-1498.032) (-1496.117) * (-1500.942) (-1498.029) [-1494.644] (-1500.617) -- 0:02:58
      136000 -- (-1496.476) (-1504.129) (-1500.298) [-1492.166] * (-1498.841) [-1496.857] (-1499.368) (-1500.264) -- 0:02:57
      136500 -- [-1501.454] (-1496.805) (-1495.827) (-1496.522) * [-1497.518] (-1494.638) (-1494.396) (-1505.153) -- 0:02:57
      137000 -- (-1498.357) (-1493.116) (-1493.995) [-1499.139] * (-1496.628) [-1498.256] (-1495.662) (-1504.032) -- 0:02:56
      137500 -- [-1490.579] (-1502.014) (-1496.079) (-1495.714) * (-1503.539) (-1499.443) (-1496.245) [-1505.083] -- 0:02:55
      138000 -- (-1491.377) (-1502.172) [-1500.133] (-1493.645) * (-1503.294) (-1497.138) (-1495.629) [-1500.232] -- 0:02:54
      138500 -- (-1496.725) (-1500.151) [-1494.071] (-1492.362) * (-1498.846) [-1490.135] (-1492.318) (-1498.380) -- 0:02:54
      139000 -- (-1497.468) (-1498.171) (-1495.692) [-1492.000] * (-1498.478) (-1506.730) [-1490.990] (-1497.412) -- 0:02:53
      139500 -- (-1498.712) (-1497.899) (-1496.780) [-1494.933] * (-1495.293) [-1494.460] (-1495.225) (-1509.002) -- 0:02:52
      140000 -- (-1500.380) (-1502.309) (-1494.288) [-1499.657] * [-1491.528] (-1494.143) (-1495.589) (-1500.981) -- 0:02:58

      Average standard deviation of split frequencies: 0.006702

      140500 -- [-1496.107] (-1495.454) (-1493.908) (-1496.229) * (-1495.813) (-1491.562) [-1495.985] (-1507.943) -- 0:02:57
      141000 -- (-1500.158) (-1493.465) [-1495.247] (-1492.159) * (-1496.902) (-1499.029) [-1492.923] (-1496.611) -- 0:02:56
      141500 -- (-1497.064) (-1493.538) (-1492.420) [-1492.982] * (-1494.989) (-1495.839) (-1494.312) [-1495.532] -- 0:02:55
      142000 -- (-1498.555) (-1498.477) [-1496.796] (-1493.441) * (-1494.543) [-1498.504] (-1497.420) (-1495.972) -- 0:02:55
      142500 -- (-1494.497) (-1492.388) [-1494.631] (-1493.082) * [-1489.294] (-1501.574) (-1500.700) (-1493.596) -- 0:02:54
      143000 -- [-1495.760] (-1491.351) (-1494.549) (-1492.943) * (-1492.353) (-1495.645) [-1504.672] (-1495.398) -- 0:02:53
      143500 -- (-1495.105) [-1492.498] (-1492.708) (-1498.259) * (-1495.199) (-1495.835) [-1496.776] (-1496.110) -- 0:02:53
      144000 -- (-1498.706) (-1497.396) [-1491.699] (-1489.663) * (-1495.545) [-1494.742] (-1497.418) (-1499.041) -- 0:02:52
      144500 -- (-1496.101) [-1500.347] (-1502.273) (-1491.904) * (-1493.929) [-1493.603] (-1499.861) (-1496.733) -- 0:02:51
      145000 -- (-1499.184) (-1505.613) (-1502.854) [-1494.087] * (-1491.903) (-1500.360) [-1500.810] (-1500.219) -- 0:02:56

      Average standard deviation of split frequencies: 0.006458

      145500 -- (-1504.389) [-1493.816] (-1493.728) (-1496.107) * (-1500.525) (-1497.759) (-1497.832) [-1500.369] -- 0:02:56
      146000 -- (-1502.862) (-1492.291) [-1492.154] (-1509.720) * (-1496.461) [-1493.932] (-1496.790) (-1499.902) -- 0:02:55
      146500 -- (-1504.683) (-1499.774) [-1495.492] (-1501.553) * [-1495.039] (-1502.286) (-1502.673) (-1501.481) -- 0:02:54
      147000 -- (-1497.538) (-1497.059) [-1494.200] (-1496.447) * (-1495.266) (-1500.555) [-1493.732] (-1497.943) -- 0:02:54
      147500 -- [-1498.062] (-1498.813) (-1501.995) (-1496.904) * (-1497.323) [-1500.604] (-1495.159) (-1494.312) -- 0:02:53
      148000 -- (-1496.452) (-1495.630) (-1495.611) [-1494.279] * (-1492.960) (-1498.669) [-1493.517] (-1502.171) -- 0:02:52
      148500 -- (-1495.229) (-1500.492) (-1493.322) [-1493.039] * (-1496.854) (-1496.930) (-1498.103) [-1492.499] -- 0:02:52
      149000 -- (-1502.860) (-1500.406) (-1503.286) [-1491.318] * (-1497.552) (-1496.305) [-1495.751] (-1496.868) -- 0:02:51
      149500 -- (-1499.612) (-1499.160) [-1503.472] (-1493.060) * (-1493.727) (-1494.262) [-1489.558] (-1496.400) -- 0:02:56
      150000 -- (-1500.701) (-1505.982) (-1496.322) [-1496.527] * (-1496.606) (-1494.497) [-1492.640] (-1492.289) -- 0:02:55

      Average standard deviation of split frequencies: 0.006258

      150500 -- [-1500.857] (-1501.731) (-1499.959) (-1495.776) * (-1499.423) [-1494.607] (-1490.096) (-1491.642) -- 0:02:54
      151000 -- (-1497.650) (-1502.438) (-1497.447) [-1497.594] * [-1499.627] (-1495.565) (-1500.832) (-1499.328) -- 0:02:54
      151500 -- (-1500.252) (-1493.186) [-1498.437] (-1495.110) * (-1496.309) (-1494.153) (-1498.250) [-1490.984] -- 0:02:53
      152000 -- (-1498.211) [-1494.910] (-1504.938) (-1493.808) * [-1499.104] (-1495.012) (-1496.256) (-1495.614) -- 0:02:52
      152500 -- [-1492.924] (-1503.142) (-1490.695) (-1495.195) * (-1498.186) (-1498.300) [-1496.894] (-1490.270) -- 0:02:52
      153000 -- (-1499.427) [-1497.629] (-1493.833) (-1499.430) * (-1495.515) (-1490.948) [-1501.194] (-1494.192) -- 0:02:51
      153500 -- (-1499.023) [-1494.365] (-1500.589) (-1495.226) * (-1494.394) (-1503.214) (-1491.897) [-1497.548] -- 0:02:50
      154000 -- (-1497.251) [-1490.787] (-1498.178) (-1500.613) * (-1498.924) (-1502.033) [-1497.580] (-1492.200) -- 0:02:50
      154500 -- [-1495.939] (-1494.092) (-1498.482) (-1501.137) * (-1496.554) (-1493.359) [-1500.937] (-1499.580) -- 0:02:55
      155000 -- (-1497.264) [-1498.710] (-1492.601) (-1496.099) * (-1500.098) [-1496.463] (-1498.616) (-1497.706) -- 0:02:54

      Average standard deviation of split frequencies: 0.006044

      155500 -- (-1499.127) [-1493.843] (-1494.682) (-1491.247) * (-1499.830) [-1500.683] (-1493.586) (-1495.685) -- 0:02:53
      156000 -- [-1500.400] (-1495.361) (-1503.658) (-1501.121) * (-1502.439) [-1491.202] (-1489.529) (-1494.201) -- 0:02:53
      156500 -- (-1497.336) (-1499.186) (-1495.892) [-1493.484] * [-1494.928] (-1499.655) (-1494.028) (-1501.661) -- 0:02:52
      157000 -- (-1506.331) [-1495.456] (-1499.093) (-1492.526) * (-1495.088) (-1504.630) [-1497.025] (-1498.086) -- 0:02:51
      157500 -- (-1496.465) (-1494.356) (-1499.978) [-1492.271] * (-1500.928) (-1498.309) [-1496.180] (-1500.617) -- 0:02:51
      158000 -- (-1492.017) (-1505.776) [-1496.784] (-1490.001) * (-1496.349) [-1495.061] (-1500.447) (-1494.009) -- 0:02:50
      158500 -- (-1502.230) [-1496.177] (-1496.064) (-1494.597) * (-1499.820) (-1496.881) (-1499.645) [-1492.368] -- 0:02:49
      159000 -- [-1503.392] (-1509.183) (-1497.492) (-1493.763) * (-1503.766) [-1497.406] (-1500.223) (-1497.329) -- 0:02:49
      159500 -- (-1503.257) [-1493.030] (-1498.925) (-1496.293) * (-1498.913) (-1500.431) (-1500.245) [-1501.221] -- 0:02:53
      160000 -- (-1494.588) (-1492.599) [-1495.872] (-1496.892) * (-1495.160) [-1493.965] (-1490.450) (-1498.192) -- 0:02:53

      Average standard deviation of split frequencies: 0.005868

      160500 -- (-1497.695) (-1493.393) (-1492.696) [-1493.011] * (-1492.798) (-1502.338) [-1496.555] (-1493.579) -- 0:02:52
      161000 -- (-1501.561) [-1492.355] (-1494.660) (-1499.028) * (-1491.564) (-1501.731) [-1497.650] (-1499.326) -- 0:02:51
      161500 -- [-1495.464] (-1497.431) (-1497.791) (-1500.707) * (-1494.319) [-1499.638] (-1494.176) (-1495.728) -- 0:02:51
      162000 -- [-1491.931] (-1497.640) (-1496.358) (-1503.335) * [-1495.239] (-1501.931) (-1497.189) (-1502.912) -- 0:02:50
      162500 -- (-1491.546) (-1495.415) [-1495.898] (-1500.087) * [-1493.774] (-1500.399) (-1498.123) (-1494.810) -- 0:02:50
      163000 -- [-1491.462] (-1494.357) (-1507.429) (-1496.987) * [-1498.978] (-1496.083) (-1500.543) (-1497.994) -- 0:02:49
      163500 -- (-1494.120) [-1499.037] (-1506.751) (-1506.278) * (-1503.025) (-1499.543) [-1498.469] (-1495.890) -- 0:02:48
      164000 -- (-1497.217) (-1500.670) [-1498.440] (-1497.623) * (-1499.601) (-1497.350) [-1495.856] (-1495.343) -- 0:02:53
      164500 -- (-1497.526) (-1490.416) [-1493.426] (-1500.950) * (-1500.715) [-1495.901] (-1498.854) (-1493.555) -- 0:02:52
      165000 -- [-1496.672] (-1493.752) (-1502.047) (-1503.677) * (-1495.352) (-1492.163) (-1495.953) [-1492.793] -- 0:02:52

      Average standard deviation of split frequencies: 0.007099

      165500 -- (-1492.947) (-1491.791) [-1499.201] (-1502.672) * (-1493.344) (-1495.363) (-1499.292) [-1499.083] -- 0:02:51
      166000 -- (-1501.370) (-1503.233) (-1498.313) [-1497.406] * (-1494.460) [-1492.383] (-1497.276) (-1496.520) -- 0:02:50
      166500 -- [-1499.198] (-1501.815) (-1496.855) (-1502.584) * (-1495.018) (-1492.646) [-1494.291] (-1498.360) -- 0:02:50
      167000 -- (-1501.967) [-1497.502] (-1493.674) (-1505.700) * [-1495.434] (-1496.519) (-1501.801) (-1496.993) -- 0:02:49
      167500 -- (-1499.604) (-1502.499) [-1494.954] (-1502.086) * [-1494.231] (-1498.991) (-1498.461) (-1501.058) -- 0:02:48
      168000 -- (-1502.416) (-1497.793) [-1492.622] (-1500.090) * (-1495.243) (-1493.360) (-1498.610) [-1493.799] -- 0:02:48
      168500 -- [-1493.827] (-1493.063) (-1495.339) (-1503.408) * (-1496.788) (-1499.990) (-1499.396) [-1499.624] -- 0:02:47
      169000 -- [-1496.011] (-1497.563) (-1492.783) (-1501.064) * (-1500.778) [-1494.594] (-1496.412) (-1494.773) -- 0:02:52
      169500 -- (-1496.777) (-1492.320) [-1490.945] (-1501.947) * (-1496.182) (-1501.201) [-1500.027] (-1493.313) -- 0:02:51
      170000 -- (-1496.913) [-1505.097] (-1490.170) (-1500.197) * (-1494.987) (-1498.449) [-1497.627] (-1502.751) -- 0:02:50

      Average standard deviation of split frequencies: 0.006905

      170500 -- (-1496.835) (-1497.524) (-1497.768) [-1499.176] * (-1494.660) (-1493.656) (-1501.737) [-1492.561] -- 0:02:50
      171000 -- [-1497.487] (-1501.214) (-1504.479) (-1504.217) * (-1496.374) (-1502.064) (-1501.359) [-1491.571] -- 0:02:49
      171500 -- (-1495.358) (-1490.969) (-1499.571) [-1499.037] * (-1502.474) [-1499.799] (-1497.462) (-1492.233) -- 0:02:49
      172000 -- (-1494.948) (-1492.506) [-1497.690] (-1493.562) * (-1499.731) (-1502.956) [-1497.842] (-1495.697) -- 0:02:48
      172500 -- (-1493.759) (-1499.853) [-1494.471] (-1495.674) * (-1504.749) (-1502.135) (-1496.910) [-1495.435] -- 0:02:47
      173000 -- (-1494.873) [-1500.988] (-1495.945) (-1494.753) * (-1502.601) (-1496.254) (-1496.873) [-1491.773] -- 0:02:47
      173500 -- (-1495.471) (-1505.381) (-1501.191) [-1501.451] * (-1496.572) (-1493.317) (-1497.488) [-1494.893] -- 0:02:51
      174000 -- [-1488.629] (-1507.681) (-1493.342) (-1494.556) * (-1503.079) [-1493.327] (-1496.483) (-1494.285) -- 0:02:50
      174500 -- (-1499.862) [-1492.075] (-1495.227) (-1496.739) * (-1496.261) (-1498.691) (-1494.709) [-1494.724] -- 0:02:50
      175000 -- (-1498.629) (-1491.344) [-1495.495] (-1501.483) * (-1497.159) [-1491.586] (-1498.454) (-1497.284) -- 0:02:49

      Average standard deviation of split frequencies: 0.006696

      175500 -- (-1497.333) (-1490.644) (-1500.086) [-1500.687] * (-1492.540) (-1498.787) [-1498.269] (-1500.570) -- 0:02:49
      176000 -- (-1496.270) (-1497.806) [-1494.451] (-1496.106) * (-1491.938) [-1494.325] (-1497.669) (-1498.480) -- 0:02:48
      176500 -- (-1489.944) (-1501.302) [-1494.288] (-1504.967) * (-1496.048) [-1493.918] (-1499.631) (-1490.556) -- 0:02:47
      177000 -- (-1501.143) (-1498.068) [-1493.913] (-1508.947) * [-1490.323] (-1493.282) (-1498.817) (-1496.559) -- 0:02:47
      177500 -- (-1496.507) (-1496.679) [-1495.348] (-1501.521) * (-1494.578) [-1494.872] (-1500.236) (-1496.708) -- 0:02:46
      178000 -- (-1494.469) (-1494.717) [-1494.609] (-1497.059) * (-1491.286) [-1491.176] (-1498.017) (-1492.893) -- 0:02:46
      178500 -- (-1496.694) (-1492.728) [-1494.149] (-1505.748) * (-1511.475) (-1493.843) (-1492.444) [-1496.615] -- 0:02:50
      179000 -- (-1497.970) (-1497.205) [-1489.378] (-1493.727) * (-1496.738) (-1497.818) (-1500.064) [-1498.297] -- 0:02:49
      179500 -- (-1497.629) (-1496.618) (-1490.096) [-1495.615] * (-1497.167) [-1493.423] (-1496.456) (-1505.312) -- 0:02:49
      180000 -- (-1495.508) (-1496.530) (-1493.148) [-1489.509] * [-1495.119] (-1494.498) (-1492.035) (-1499.969) -- 0:02:48

      Average standard deviation of split frequencies: 0.006523

      180500 -- [-1496.346] (-1495.066) (-1493.744) (-1497.684) * (-1490.732) [-1497.601] (-1497.526) (-1505.021) -- 0:02:47
      181000 -- (-1506.152) [-1495.135] (-1501.048) (-1498.874) * (-1495.679) (-1499.937) (-1493.082) [-1495.905] -- 0:02:47
      181500 -- (-1504.851) [-1491.796] (-1501.950) (-1504.955) * (-1499.352) (-1497.569) [-1494.921] (-1502.611) -- 0:02:46
      182000 -- (-1503.403) [-1497.438] (-1499.428) (-1496.286) * (-1496.844) [-1495.895] (-1500.352) (-1507.974) -- 0:02:46
      182500 -- [-1502.697] (-1492.061) (-1496.645) (-1498.065) * (-1495.183) (-1501.137) [-1496.126] (-1499.821) -- 0:02:45
      183000 -- (-1496.774) (-1494.453) [-1500.074] (-1498.230) * (-1494.508) (-1497.370) [-1489.790] (-1502.312) -- 0:02:45
      183500 -- (-1506.145) [-1499.307] (-1498.826) (-1495.898) * [-1495.351] (-1499.391) (-1501.647) (-1504.551) -- 0:02:49
      184000 -- (-1506.734) (-1496.886) (-1498.990) [-1493.443] * (-1497.794) (-1493.768) [-1495.515] (-1500.107) -- 0:02:48
      184500 -- [-1492.187] (-1504.590) (-1494.161) (-1497.614) * (-1495.016) [-1494.395] (-1495.410) (-1495.437) -- 0:02:47
      185000 -- (-1495.368) [-1499.025] (-1494.461) (-1498.447) * [-1499.810] (-1499.176) (-1495.045) (-1497.621) -- 0:02:47

      Average standard deviation of split frequencies: 0.006336

      185500 -- (-1493.915) (-1500.402) [-1496.078] (-1495.427) * (-1492.417) (-1497.646) (-1494.749) [-1491.610] -- 0:02:46
      186000 -- [-1490.923] (-1496.242) (-1496.442) (-1499.849) * (-1493.086) [-1493.259] (-1496.497) (-1494.739) -- 0:02:46
      186500 -- (-1495.795) (-1497.216) (-1493.146) [-1502.164] * (-1494.449) [-1493.674] (-1501.480) (-1491.833) -- 0:02:45
      187000 -- (-1498.166) (-1492.697) (-1496.984) [-1494.698] * (-1497.416) (-1498.440) (-1494.479) [-1493.756] -- 0:02:45
      187500 -- (-1498.848) (-1493.549) [-1492.766] (-1500.835) * (-1492.264) (-1491.587) [-1497.850] (-1493.829) -- 0:02:44
      188000 -- (-1499.223) [-1498.041] (-1503.172) (-1497.164) * [-1496.724] (-1500.353) (-1504.819) (-1499.068) -- 0:02:48
      188500 -- (-1499.391) [-1492.340] (-1499.385) (-1499.193) * (-1495.005) (-1496.589) [-1499.387] (-1499.980) -- 0:02:47
      189000 -- (-1494.100) (-1497.909) (-1500.543) [-1493.643] * (-1497.188) (-1499.191) [-1500.438] (-1497.801) -- 0:02:47
      189500 -- (-1493.587) [-1498.753] (-1497.613) (-1500.256) * (-1495.173) (-1500.200) (-1504.313) [-1496.065] -- 0:02:46
      190000 -- [-1491.749] (-1495.510) (-1493.203) (-1491.449) * (-1498.362) (-1504.246) [-1496.529] (-1494.385) -- 0:02:46

      Average standard deviation of split frequencies: 0.006181

      190500 -- (-1497.958) (-1505.604) (-1498.549) [-1502.640] * (-1500.096) (-1499.516) (-1497.583) [-1497.984] -- 0:02:45
      191000 -- (-1491.772) (-1502.439) (-1501.311) [-1490.964] * [-1494.453] (-1496.250) (-1495.363) (-1493.058) -- 0:02:45
      191500 -- (-1499.315) (-1497.073) [-1492.947] (-1490.743) * (-1493.589) (-1495.695) [-1493.726] (-1497.507) -- 0:02:44
      192000 -- (-1500.357) [-1495.524] (-1497.803) (-1496.771) * (-1500.200) (-1498.836) [-1495.373] (-1494.239) -- 0:02:44
      192500 -- [-1491.681] (-1498.368) (-1498.563) (-1497.433) * (-1495.615) [-1494.555] (-1507.618) (-1494.777) -- 0:02:43
      193000 -- (-1495.418) (-1497.818) (-1496.741) [-1494.713] * (-1492.836) (-1494.485) [-1498.283] (-1491.531) -- 0:02:47
      193500 -- [-1498.335] (-1496.608) (-1498.853) (-1497.858) * (-1495.586) [-1491.194] (-1495.536) (-1495.187) -- 0:02:46
      194000 -- [-1496.612] (-1504.216) (-1500.331) (-1495.122) * (-1497.818) [-1494.607] (-1500.855) (-1494.782) -- 0:02:46
      194500 -- (-1501.184) [-1497.848] (-1497.843) (-1498.655) * (-1496.168) [-1499.875] (-1500.865) (-1502.591) -- 0:02:45
      195000 -- (-1498.839) (-1501.459) [-1494.786] (-1503.181) * (-1500.839) (-1497.870) [-1494.170] (-1503.352) -- 0:02:45

      Average standard deviation of split frequencies: 0.008418

      195500 -- (-1507.569) (-1499.052) [-1500.533] (-1498.465) * (-1512.561) [-1493.509] (-1500.937) (-1495.883) -- 0:02:44
      196000 -- (-1497.133) (-1497.503) [-1499.434] (-1498.540) * [-1499.587] (-1495.702) (-1499.707) (-1499.587) -- 0:02:44
      196500 -- (-1501.843) [-1500.511] (-1502.037) (-1497.020) * (-1496.686) [-1498.281] (-1503.628) (-1499.481) -- 0:02:43
      197000 -- (-1496.564) (-1500.966) [-1491.512] (-1496.846) * (-1495.532) [-1494.871] (-1504.006) (-1500.918) -- 0:02:43
      197500 -- (-1499.449) (-1497.299) (-1497.542) [-1495.405] * (-1493.911) [-1496.651] (-1504.608) (-1500.002) -- 0:02:42
      198000 -- (-1493.887) [-1491.792] (-1499.641) (-1496.013) * (-1501.268) [-1488.888] (-1500.735) (-1506.632) -- 0:02:46
      198500 -- [-1495.365] (-1495.183) (-1495.506) (-1494.065) * (-1494.640) (-1497.124) (-1499.575) [-1493.581] -- 0:02:45
      199000 -- (-1490.820) (-1498.680) [-1494.667] (-1492.855) * (-1502.877) (-1492.959) [-1493.080] (-1493.396) -- 0:02:45
      199500 -- [-1497.198] (-1499.405) (-1498.418) (-1498.734) * [-1500.960] (-1492.974) (-1496.008) (-1493.494) -- 0:02:44
      200000 -- (-1507.637) [-1493.263] (-1501.386) (-1497.535) * [-1490.842] (-1493.178) (-1495.746) (-1500.614) -- 0:02:44

      Average standard deviation of split frequencies: 0.009397

      200500 -- (-1498.061) (-1493.753) [-1499.309] (-1498.608) * (-1495.556) [-1494.870] (-1498.585) (-1496.395) -- 0:02:43
      201000 -- (-1495.028) [-1498.618] (-1490.062) (-1497.588) * (-1499.411) (-1496.091) (-1501.675) [-1492.645] -- 0:02:42
      201500 -- (-1503.372) [-1500.970] (-1494.773) (-1496.938) * [-1497.597] (-1502.366) (-1498.578) (-1495.370) -- 0:02:42
      202000 -- (-1503.944) (-1504.933) [-1493.420] (-1495.218) * (-1494.243) (-1494.159) (-1499.408) [-1491.843] -- 0:02:41
      202500 -- [-1502.365] (-1498.961) (-1492.775) (-1494.051) * (-1501.085) (-1493.655) (-1494.554) [-1491.460] -- 0:02:45
      203000 -- [-1498.138] (-1499.628) (-1502.712) (-1493.409) * (-1498.678) (-1501.243) (-1494.704) [-1493.612] -- 0:02:44
      203500 -- [-1498.098] (-1496.365) (-1506.489) (-1495.844) * [-1498.450] (-1500.786) (-1497.517) (-1490.877) -- 0:02:44
      204000 -- [-1498.945] (-1501.922) (-1497.225) (-1500.244) * (-1491.548) [-1493.036] (-1492.061) (-1492.028) -- 0:02:43
      204500 -- (-1497.117) [-1498.189] (-1491.698) (-1499.592) * [-1499.239] (-1496.440) (-1497.391) (-1503.676) -- 0:02:43
      205000 -- [-1495.821] (-1504.185) (-1495.553) (-1504.681) * (-1494.203) [-1494.576] (-1493.000) (-1496.242) -- 0:02:42

      Average standard deviation of split frequencies: 0.008009

      205500 -- (-1491.981) (-1497.672) (-1492.930) [-1502.140] * [-1496.774] (-1494.730) (-1497.629) (-1495.878) -- 0:02:42
      206000 -- [-1492.876] (-1498.710) (-1497.988) (-1498.585) * (-1503.657) [-1494.116] (-1496.421) (-1494.712) -- 0:02:41
      206500 -- (-1495.403) [-1497.216] (-1496.979) (-1497.835) * (-1497.408) (-1496.661) [-1502.408] (-1496.584) -- 0:02:41
      207000 -- (-1496.349) (-1495.853) (-1503.123) [-1490.292] * (-1497.902) (-1492.645) [-1495.634] (-1500.448) -- 0:02:40
      207500 -- (-1498.436) [-1504.472] (-1497.475) (-1492.795) * (-1496.455) (-1494.655) [-1499.034] (-1494.993) -- 0:02:44
      208000 -- (-1500.101) [-1495.316] (-1491.714) (-1493.579) * (-1497.357) [-1493.277] (-1504.809) (-1497.294) -- 0:02:43
      208500 -- (-1494.428) [-1493.656] (-1496.237) (-1494.121) * (-1496.413) (-1511.849) (-1500.684) [-1498.151] -- 0:02:43
      209000 -- (-1495.686) (-1494.415) [-1494.911] (-1494.250) * (-1500.687) (-1492.847) (-1499.281) [-1498.432] -- 0:02:42
      209500 -- [-1494.650] (-1504.524) (-1500.687) (-1497.663) * (-1493.772) [-1499.294] (-1496.737) (-1499.540) -- 0:02:42
      210000 -- [-1497.306] (-1497.509) (-1503.217) (-1500.958) * (-1493.382) (-1498.134) (-1500.194) [-1495.975] -- 0:02:41

      Average standard deviation of split frequencies: 0.007832

      210500 -- (-1493.836) (-1498.981) [-1498.872] (-1499.364) * (-1498.582) (-1502.170) [-1503.577] (-1497.287) -- 0:02:41
      211000 -- (-1498.338) [-1503.186] (-1494.712) (-1494.568) * (-1500.666) (-1494.307) [-1499.786] (-1493.276) -- 0:02:40
      211500 -- (-1504.855) (-1502.987) [-1492.561] (-1497.474) * (-1494.485) [-1498.110] (-1493.644) (-1495.690) -- 0:02:40
      212000 -- (-1495.477) (-1501.333) (-1494.362) [-1501.264] * (-1495.001) (-1504.286) (-1493.365) [-1494.133] -- 0:02:43
      212500 -- [-1494.123] (-1498.943) (-1495.851) (-1498.223) * (-1492.229) (-1498.571) (-1492.583) [-1495.273] -- 0:02:43
      213000 -- (-1502.192) (-1497.045) [-1490.013] (-1501.862) * [-1495.605] (-1495.751) (-1499.859) (-1496.527) -- 0:02:42
      213500 -- (-1498.330) (-1499.010) [-1498.723] (-1501.071) * (-1497.895) [-1496.777] (-1494.700) (-1504.911) -- 0:02:42
      214000 -- [-1499.150] (-1500.128) (-1498.354) (-1496.547) * [-1501.270] (-1502.746) (-1492.868) (-1497.907) -- 0:02:41
      214500 -- (-1493.060) (-1495.432) [-1491.274] (-1495.596) * (-1499.976) [-1493.559] (-1492.338) (-1498.841) -- 0:02:41
      215000 -- [-1496.048] (-1496.034) (-1503.248) (-1492.788) * (-1498.780) (-1494.829) [-1493.758] (-1491.322) -- 0:02:40

      Average standard deviation of split frequencies: 0.007638

      215500 -- (-1501.545) [-1497.555] (-1495.119) (-1495.284) * (-1497.445) [-1501.170] (-1497.038) (-1495.256) -- 0:02:40
      216000 -- (-1494.280) (-1500.829) [-1499.416] (-1501.044) * (-1511.629) [-1495.036] (-1503.152) (-1499.503) -- 0:02:39
      216500 -- [-1499.063] (-1500.008) (-1499.420) (-1495.758) * (-1497.404) [-1493.884] (-1495.842) (-1496.179) -- 0:02:39
      217000 -- (-1499.058) [-1499.119] (-1494.338) (-1501.710) * (-1503.697) (-1497.424) (-1497.687) [-1499.422] -- 0:02:42
      217500 -- (-1504.087) (-1497.155) (-1494.368) [-1495.593] * (-1500.637) (-1498.103) (-1502.784) [-1496.992] -- 0:02:41
      218000 -- [-1498.025] (-1500.325) (-1495.591) (-1502.385) * (-1500.233) (-1493.215) [-1500.087] (-1496.397) -- 0:02:41
      218500 -- [-1494.799] (-1496.547) (-1500.073) (-1500.133) * (-1503.898) (-1492.393) [-1493.347] (-1499.337) -- 0:02:40
      219000 -- (-1492.479) [-1498.377] (-1497.601) (-1506.380) * (-1498.808) (-1495.295) [-1498.460] (-1501.510) -- 0:02:40
      219500 -- [-1494.109] (-1497.127) (-1497.081) (-1498.948) * [-1498.921] (-1494.788) (-1506.388) (-1493.896) -- 0:02:40
      220000 -- [-1496.988] (-1493.965) (-1497.108) (-1503.318) * (-1498.329) (-1498.692) (-1499.892) [-1497.507] -- 0:02:39

      Average standard deviation of split frequencies: 0.007477

      220500 -- (-1496.597) (-1491.931) (-1498.674) [-1494.718] * [-1493.528] (-1505.648) (-1501.655) (-1496.725) -- 0:02:39
      221000 -- (-1500.381) (-1496.334) [-1495.526] (-1497.531) * [-1494.021] (-1498.993) (-1497.057) (-1498.562) -- 0:02:38
      221500 -- [-1493.782] (-1494.298) (-1497.613) (-1493.762) * (-1495.880) (-1496.739) (-1500.023) [-1492.218] -- 0:02:38
      222000 -- [-1492.899] (-1493.206) (-1496.972) (-1496.393) * [-1497.463] (-1502.764) (-1493.186) (-1492.676) -- 0:02:41
      222500 -- [-1494.266] (-1503.958) (-1495.123) (-1495.921) * (-1495.958) (-1495.723) (-1492.811) [-1494.900] -- 0:02:40
      223000 -- (-1496.964) (-1505.349) (-1493.286) [-1495.639] * [-1498.454] (-1497.200) (-1494.870) (-1499.237) -- 0:02:40
      223500 -- (-1491.899) (-1495.328) [-1491.924] (-1495.815) * (-1490.030) (-1495.411) (-1494.584) [-1496.888] -- 0:02:39
      224000 -- (-1498.218) [-1494.797] (-1494.075) (-1495.378) * [-1499.294] (-1494.282) (-1497.423) (-1496.381) -- 0:02:39
      224500 -- (-1499.273) (-1494.383) [-1496.791] (-1496.741) * (-1493.127) (-1496.585) [-1495.202] (-1495.728) -- 0:02:38
      225000 -- [-1493.189] (-1500.838) (-1499.290) (-1494.400) * [-1502.895] (-1501.561) (-1492.522) (-1505.724) -- 0:02:38

      Average standard deviation of split frequencies: 0.007301

      225500 -- (-1500.296) [-1493.860] (-1498.851) (-1496.234) * [-1493.243] (-1494.521) (-1495.672) (-1503.140) -- 0:02:37
      226000 -- [-1504.811] (-1496.659) (-1495.363) (-1497.942) * (-1500.592) (-1496.230) (-1494.689) [-1498.676] -- 0:02:37
      226500 -- (-1498.738) (-1498.522) (-1493.647) [-1498.768] * (-1500.178) (-1491.604) [-1493.778] (-1501.484) -- 0:02:40
      227000 -- (-1497.822) [-1494.803] (-1497.029) (-1501.685) * (-1493.234) (-1494.871) [-1493.809] (-1499.292) -- 0:02:40
      227500 -- (-1499.888) (-1493.188) (-1499.290) [-1498.105] * (-1494.362) [-1492.725] (-1500.234) (-1502.707) -- 0:02:39
      228000 -- [-1492.843] (-1495.243) (-1498.714) (-1493.455) * (-1493.583) [-1495.747] (-1502.927) (-1491.300) -- 0:02:39
      228500 -- (-1492.994) (-1498.773) [-1496.637] (-1494.315) * (-1494.784) (-1499.701) [-1499.664] (-1492.965) -- 0:02:38
      229000 -- (-1494.431) (-1500.617) (-1491.384) [-1493.123] * [-1494.040] (-1493.570) (-1495.881) (-1500.914) -- 0:02:38
      229500 -- [-1493.954] (-1498.897) (-1496.367) (-1496.090) * (-1498.786) (-1500.392) (-1502.141) [-1496.887] -- 0:02:37
      230000 -- (-1491.865) (-1499.200) (-1492.792) [-1496.848] * (-1498.342) (-1503.913) [-1498.351] (-1493.553) -- 0:02:37

      Average standard deviation of split frequencies: 0.007153

      230500 -- (-1494.325) [-1498.234] (-1497.573) (-1500.218) * (-1492.799) (-1496.761) (-1500.198) [-1492.738] -- 0:02:36
      231000 -- [-1495.415] (-1500.296) (-1493.120) (-1501.857) * (-1496.320) [-1499.037] (-1492.830) (-1494.754) -- 0:02:36
      231500 -- (-1501.359) (-1492.766) (-1490.582) [-1498.678] * (-1492.043) (-1502.101) [-1494.396] (-1497.124) -- 0:02:39
      232000 -- (-1499.462) (-1498.049) [-1494.704] (-1498.001) * (-1491.604) [-1493.336] (-1501.703) (-1497.712) -- 0:02:38
      232500 -- (-1498.665) [-1495.289] (-1496.400) (-1500.909) * [-1494.254] (-1493.508) (-1500.070) (-1494.717) -- 0:02:38
      233000 -- (-1499.468) (-1497.551) (-1496.493) [-1494.233] * (-1502.414) [-1492.385] (-1500.607) (-1497.105) -- 0:02:38
      233500 -- [-1502.199] (-1501.624) (-1497.655) (-1499.533) * (-1493.581) [-1493.558] (-1498.420) (-1494.938) -- 0:02:37
      234000 -- (-1500.497) [-1490.978] (-1495.744) (-1497.194) * [-1499.285] (-1503.750) (-1495.487) (-1497.480) -- 0:02:37
      234500 -- (-1497.134) (-1499.443) [-1496.755] (-1498.368) * [-1501.155] (-1501.745) (-1497.803) (-1494.725) -- 0:02:36
      235000 -- [-1493.755] (-1502.879) (-1497.894) (-1498.237) * [-1497.422] (-1505.203) (-1493.459) (-1495.028) -- 0:02:36

      Average standard deviation of split frequencies: 0.005992

      235500 -- (-1494.642) (-1498.540) (-1508.163) [-1501.036] * [-1499.309] (-1498.730) (-1495.398) (-1500.217) -- 0:02:35
      236000 -- (-1504.476) [-1497.284] (-1501.039) (-1492.844) * (-1497.490) (-1496.958) (-1507.418) [-1502.581] -- 0:02:35
      236500 -- (-1495.277) (-1499.272) [-1496.918] (-1496.039) * (-1498.535) [-1492.928] (-1498.574) (-1496.200) -- 0:02:38
      237000 -- (-1489.741) [-1494.818] (-1508.731) (-1498.287) * (-1511.986) [-1493.264] (-1497.913) (-1491.299) -- 0:02:37
      237500 -- (-1504.702) [-1494.914] (-1501.699) (-1494.553) * (-1499.997) [-1493.310] (-1502.904) (-1499.425) -- 0:02:37
      238000 -- [-1493.346] (-1495.526) (-1497.676) (-1495.909) * [-1499.675] (-1498.305) (-1505.387) (-1493.837) -- 0:02:36
      238500 -- (-1497.505) [-1495.752] (-1499.267) (-1501.030) * [-1495.592] (-1502.491) (-1498.690) (-1493.313) -- 0:02:36
      239000 -- (-1500.678) [-1496.694] (-1495.779) (-1498.029) * (-1496.064) [-1496.604] (-1497.002) (-1495.410) -- 0:02:36
      239500 -- (-1492.189) [-1496.570] (-1500.022) (-1496.927) * [-1489.579] (-1496.974) (-1500.962) (-1499.624) -- 0:02:35
      240000 -- (-1493.911) [-1498.588] (-1497.601) (-1496.857) * [-1491.495] (-1500.491) (-1500.665) (-1495.735) -- 0:02:35

      Average standard deviation of split frequencies: 0.005876

      240500 -- [-1496.290] (-1497.200) (-1498.251) (-1493.851) * (-1492.938) (-1495.870) (-1506.348) [-1493.208] -- 0:02:34
      241000 -- (-1497.711) (-1501.695) (-1499.646) [-1493.603] * [-1497.504] (-1494.376) (-1498.266) (-1494.480) -- 0:02:37
      241500 -- (-1503.750) [-1493.954] (-1496.401) (-1495.998) * [-1496.368] (-1490.983) (-1496.739) (-1501.648) -- 0:02:37
      242000 -- [-1497.343] (-1493.873) (-1502.182) (-1493.664) * [-1492.156] (-1495.936) (-1496.762) (-1498.869) -- 0:02:36
      242500 -- (-1500.654) (-1491.936) [-1500.631] (-1496.827) * (-1498.872) (-1495.734) [-1502.257] (-1513.429) -- 0:02:36
      243000 -- [-1499.091] (-1494.832) (-1497.683) (-1491.260) * [-1501.287] (-1491.279) (-1493.916) (-1500.674) -- 0:02:35
      243500 -- (-1495.481) (-1500.804) [-1496.118] (-1489.570) * [-1491.978] (-1495.879) (-1497.009) (-1501.608) -- 0:02:35
      244000 -- (-1495.999) (-1492.551) [-1496.716] (-1500.613) * (-1497.298) (-1493.368) (-1496.451) [-1501.842] -- 0:02:34
      244500 -- (-1500.624) (-1490.898) (-1493.326) [-1491.055] * [-1499.356] (-1493.839) (-1499.503) (-1498.207) -- 0:02:34
      245000 -- (-1494.866) (-1488.616) (-1496.537) [-1492.741] * (-1492.406) [-1494.254] (-1495.636) (-1499.696) -- 0:02:34

      Average standard deviation of split frequencies: 0.005749

      245500 -- [-1501.727] (-1496.950) (-1494.444) (-1493.448) * (-1497.861) (-1493.938) (-1492.424) [-1499.029] -- 0:02:33
      246000 -- (-1496.488) (-1500.657) (-1492.688) [-1494.490] * (-1497.259) (-1495.980) [-1493.284] (-1494.144) -- 0:02:36
      246500 -- (-1496.094) (-1493.918) [-1494.470] (-1496.730) * (-1494.278) (-1497.015) [-1498.382] (-1492.237) -- 0:02:35
      247000 -- (-1498.686) (-1497.830) (-1494.997) [-1497.377] * (-1498.596) [-1492.180] (-1498.519) (-1498.056) -- 0:02:35
      247500 -- (-1498.427) (-1500.121) (-1493.076) [-1494.238] * (-1498.359) (-1496.650) [-1496.868] (-1491.871) -- 0:02:35
      248000 -- [-1496.884] (-1502.016) (-1497.364) (-1495.569) * (-1502.268) [-1496.336] (-1494.237) (-1493.247) -- 0:02:34
      248500 -- (-1492.099) (-1503.983) [-1496.805] (-1495.659) * (-1505.927) [-1491.333] (-1492.710) (-1504.118) -- 0:02:34
      249000 -- [-1494.003] (-1499.621) (-1493.686) (-1496.329) * (-1499.478) [-1495.613] (-1494.231) (-1496.306) -- 0:02:33
      249500 -- (-1491.973) (-1510.466) [-1501.395] (-1498.609) * (-1495.598) (-1495.511) (-1496.528) [-1497.901] -- 0:02:33
      250000 -- [-1496.507] (-1501.387) (-1500.049) (-1504.447) * (-1494.196) [-1494.944] (-1498.378) (-1504.699) -- 0:02:33

      Average standard deviation of split frequencies: 0.005642

      250500 -- (-1501.072) [-1497.947] (-1504.107) (-1500.484) * (-1494.213) (-1495.172) [-1500.771] (-1492.480) -- 0:02:32
      251000 -- (-1495.654) (-1500.017) (-1495.656) [-1497.349] * (-1496.418) (-1492.260) [-1500.117] (-1498.993) -- 0:02:35
      251500 -- [-1501.576] (-1494.894) (-1494.189) (-1500.362) * (-1496.089) (-1496.706) (-1499.745) [-1494.833] -- 0:02:34
      252000 -- [-1493.562] (-1494.414) (-1496.717) (-1494.803) * (-1494.187) (-1497.177) [-1499.084] (-1498.096) -- 0:02:34
      252500 -- (-1490.839) (-1505.151) [-1497.991] (-1498.139) * (-1503.229) [-1494.646] (-1497.890) (-1501.847) -- 0:02:33
      253000 -- (-1495.204) (-1494.644) [-1501.050] (-1495.493) * [-1494.229] (-1500.395) (-1490.529) (-1496.336) -- 0:02:33
      253500 -- (-1498.975) (-1493.680) (-1496.660) [-1501.879] * (-1498.536) (-1497.935) [-1501.325] (-1497.908) -- 0:02:33
      254000 -- (-1491.306) [-1495.792] (-1507.733) (-1499.568) * (-1501.008) (-1500.209) [-1498.035] (-1495.235) -- 0:02:32
      254500 -- (-1492.621) (-1498.475) [-1494.668] (-1501.441) * (-1496.394) (-1492.949) (-1501.197) [-1496.760] -- 0:02:32
      255000 -- (-1500.337) (-1495.345) [-1498.286] (-1496.102) * (-1492.693) (-1494.239) (-1493.269) [-1499.550] -- 0:02:31

      Average standard deviation of split frequencies: 0.005524

      255500 -- (-1490.934) (-1500.032) [-1495.258] (-1498.879) * (-1494.565) (-1499.319) [-1495.154] (-1493.718) -- 0:02:34
      256000 -- [-1494.981] (-1494.582) (-1494.566) (-1493.972) * (-1492.038) [-1498.113] (-1493.092) (-1501.285) -- 0:02:34
      256500 -- (-1499.119) (-1495.250) [-1493.558] (-1496.388) * (-1500.269) (-1499.554) [-1494.732] (-1491.896) -- 0:02:33
      257000 -- (-1499.279) (-1496.206) [-1493.315] (-1495.995) * (-1500.486) (-1500.661) [-1500.243] (-1495.739) -- 0:02:33
      257500 -- (-1504.124) [-1495.933] (-1493.065) (-1499.765) * [-1498.675] (-1497.122) (-1499.076) (-1494.987) -- 0:02:32
      258000 -- [-1490.020] (-1502.206) (-1495.972) (-1498.215) * [-1496.305] (-1503.616) (-1499.353) (-1501.741) -- 0:02:32
      258500 -- [-1495.961] (-1497.938) (-1498.063) (-1499.537) * (-1504.604) (-1494.624) [-1492.286] (-1493.777) -- 0:02:32
      259000 -- (-1498.896) (-1492.993) [-1494.337] (-1496.855) * (-1498.082) (-1497.894) [-1495.800] (-1495.086) -- 0:02:31
      259500 -- (-1499.103) [-1494.800] (-1494.816) (-1501.080) * [-1493.562] (-1507.883) (-1497.862) (-1498.325) -- 0:02:31
      260000 -- (-1496.126) (-1500.435) (-1496.970) [-1492.802] * (-1498.527) (-1498.254) (-1497.860) [-1495.552] -- 0:02:30

      Average standard deviation of split frequencies: 0.005425

      260500 -- [-1488.823] (-1496.501) (-1497.181) (-1498.787) * (-1499.526) (-1503.369) [-1492.813] (-1499.082) -- 0:02:33
      261000 -- (-1495.691) (-1497.431) [-1496.246] (-1495.261) * (-1501.112) (-1500.078) [-1496.778] (-1495.692) -- 0:02:32
      261500 -- (-1501.167) (-1499.104) [-1495.437] (-1503.229) * (-1502.341) (-1508.503) [-1495.402] (-1497.074) -- 0:02:32
      262000 -- (-1506.445) (-1501.384) (-1495.921) [-1490.572] * (-1496.277) (-1502.125) (-1501.620) [-1502.476] -- 0:02:32
      262500 -- [-1496.220] (-1494.332) (-1496.284) (-1498.701) * [-1491.396] (-1511.335) (-1496.543) (-1497.806) -- 0:02:31
      263000 -- (-1495.579) (-1494.758) (-1497.039) [-1492.744] * (-1493.561) (-1497.565) [-1493.975] (-1496.929) -- 0:02:31
      263500 -- [-1494.171] (-1500.092) (-1501.346) (-1498.048) * (-1495.536) [-1493.199] (-1503.621) (-1496.808) -- 0:02:30
      264000 -- (-1502.448) (-1495.967) (-1498.592) [-1493.790] * (-1494.776) (-1501.364) (-1500.110) [-1497.275] -- 0:02:30
      264500 -- (-1497.786) (-1494.869) (-1504.363) [-1490.863] * (-1499.201) [-1497.183] (-1496.828) (-1504.088) -- 0:02:30
      265000 -- (-1498.308) (-1490.989) (-1500.090) [-1495.212] * [-1495.144] (-1493.414) (-1503.391) (-1494.938) -- 0:02:32

      Average standard deviation of split frequencies: 0.004430

      265500 -- [-1492.688] (-1498.742) (-1497.215) (-1491.182) * (-1497.929) [-1491.729] (-1505.640) (-1497.907) -- 0:02:32
      266000 -- (-1497.243) [-1492.892] (-1492.257) (-1497.175) * (-1501.284) [-1494.608] (-1499.055) (-1494.873) -- 0:02:31
      266500 -- [-1504.032] (-1496.770) (-1506.161) (-1497.202) * (-1507.859) [-1491.948] (-1496.184) (-1494.130) -- 0:02:31
      267000 -- (-1505.093) (-1506.500) [-1496.845] (-1495.055) * (-1500.306) (-1501.898) (-1506.169) [-1496.490] -- 0:02:30
      267500 -- (-1504.620) (-1504.682) [-1497.667] (-1496.034) * (-1497.505) (-1493.252) (-1492.725) [-1493.560] -- 0:02:30
      268000 -- (-1497.856) (-1499.729) (-1495.955) [-1497.176] * (-1494.039) (-1492.654) [-1496.636] (-1492.531) -- 0:02:30
      268500 -- [-1496.060] (-1504.392) (-1494.657) (-1498.512) * (-1495.910) (-1496.211) [-1494.091] (-1501.788) -- 0:02:29
      269000 -- (-1493.363) [-1500.169] (-1497.003) (-1495.869) * (-1496.678) (-1506.543) [-1497.250] (-1506.441) -- 0:02:29
      269500 -- (-1493.751) (-1500.146) [-1500.454] (-1499.153) * (-1501.263) (-1503.922) [-1495.228] (-1508.725) -- 0:02:29
      270000 -- (-1500.972) [-1496.183] (-1500.192) (-1498.479) * (-1500.248) (-1501.962) (-1506.118) [-1495.726] -- 0:02:31

      Average standard deviation of split frequencies: 0.004354

      270500 -- [-1496.895] (-1495.487) (-1493.373) (-1501.942) * (-1496.940) (-1499.135) [-1502.014] (-1500.120) -- 0:02:31
      271000 -- (-1496.864) (-1499.873) (-1491.475) [-1495.340] * [-1494.168] (-1508.336) (-1493.982) (-1500.087) -- 0:02:30
      271500 -- (-1509.737) (-1497.390) [-1493.119] (-1492.598) * (-1493.104) (-1492.176) [-1498.329] (-1507.436) -- 0:02:30
      272000 -- (-1504.129) (-1496.522) [-1502.780] (-1497.730) * (-1496.886) [-1491.554] (-1497.166) (-1494.141) -- 0:02:29
      272500 -- (-1501.983) (-1493.215) [-1495.281] (-1496.868) * (-1500.409) [-1492.426] (-1491.230) (-1498.934) -- 0:02:29
      273000 -- (-1502.304) [-1497.088] (-1500.625) (-1498.257) * (-1499.898) (-1499.360) (-1490.992) [-1498.895] -- 0:02:29
      273500 -- (-1505.331) (-1492.962) (-1494.826) [-1499.073] * (-1495.884) (-1496.345) (-1497.840) [-1499.509] -- 0:02:28
      274000 -- (-1497.104) [-1495.705] (-1499.808) (-1497.662) * [-1491.470] (-1496.060) (-1499.156) (-1500.184) -- 0:02:28
      274500 -- [-1499.545] (-1496.855) (-1495.606) (-1504.670) * (-1500.436) (-1495.562) [-1497.744] (-1497.830) -- 0:02:30
      275000 -- [-1499.712] (-1505.072) (-1493.519) (-1502.017) * [-1496.793] (-1495.241) (-1493.040) (-1496.773) -- 0:02:30

      Average standard deviation of split frequencies: 0.004270

      275500 -- (-1501.696) [-1489.403] (-1498.487) (-1497.068) * (-1493.878) (-1496.425) (-1495.831) [-1490.604] -- 0:02:29
      276000 -- [-1497.219] (-1497.410) (-1493.964) (-1495.533) * [-1495.773] (-1495.290) (-1492.641) (-1490.870) -- 0:02:29
      276500 -- (-1497.851) (-1513.625) [-1493.857] (-1502.162) * (-1497.731) (-1495.072) [-1499.868] (-1500.875) -- 0:02:29
      277000 -- (-1492.836) (-1498.026) (-1494.305) [-1495.798] * (-1495.690) [-1494.835] (-1500.977) (-1503.687) -- 0:02:28
      277500 -- (-1490.620) (-1497.891) [-1494.122] (-1495.378) * (-1500.320) (-1495.177) (-1505.026) [-1491.393] -- 0:02:28
      278000 -- (-1497.296) (-1495.279) [-1489.142] (-1493.192) * (-1505.938) (-1493.652) (-1492.763) [-1490.431] -- 0:02:28
      278500 -- (-1495.211) (-1512.224) [-1496.464] (-1501.466) * (-1499.983) [-1492.796] (-1494.391) (-1499.603) -- 0:02:27
      279000 -- (-1494.722) (-1504.239) [-1493.396] (-1502.267) * [-1496.444] (-1499.922) (-1494.449) (-1497.451) -- 0:02:27
      279500 -- [-1491.849] (-1505.345) (-1493.678) (-1499.002) * [-1491.415] (-1496.228) (-1494.931) (-1502.633) -- 0:02:29
      280000 -- (-1500.343) [-1494.097] (-1490.202) (-1502.835) * (-1493.557) [-1491.698] (-1501.156) (-1497.259) -- 0:02:29

      Average standard deviation of split frequencies: 0.004199

      280500 -- (-1500.789) (-1494.945) [-1492.064] (-1496.100) * (-1491.240) (-1492.551) (-1496.010) [-1502.803] -- 0:02:28
      281000 -- (-1495.650) (-1503.334) (-1501.211) [-1495.065] * [-1498.296] (-1501.314) (-1497.766) (-1497.163) -- 0:02:28
      281500 -- (-1499.536) [-1491.091] (-1504.215) (-1502.483) * (-1492.067) [-1496.456] (-1499.019) (-1498.951) -- 0:02:28
      282000 -- (-1496.287) (-1495.221) [-1497.737] (-1496.283) * (-1496.094) (-1505.790) (-1501.202) [-1492.678] -- 0:02:27
      282500 -- (-1498.310) [-1491.902] (-1506.950) (-1504.300) * (-1500.353) (-1497.318) (-1498.258) [-1498.352] -- 0:02:27
      283000 -- [-1495.760] (-1491.051) (-1495.643) (-1500.950) * (-1497.191) (-1494.980) [-1493.611] (-1503.579) -- 0:02:26
      283500 -- (-1498.575) (-1493.858) [-1496.743] (-1497.459) * [-1498.473] (-1498.181) (-1493.846) (-1496.138) -- 0:02:26
      284000 -- [-1498.441] (-1498.434) (-1498.712) (-1497.999) * (-1497.453) (-1500.628) (-1506.126) [-1497.379] -- 0:02:26
      284500 -- (-1496.244) [-1499.483] (-1498.666) (-1497.550) * (-1497.619) [-1501.688] (-1495.399) (-1498.391) -- 0:02:28
      285000 -- (-1499.490) (-1499.224) [-1492.007] (-1497.650) * (-1493.770) [-1495.988] (-1494.592) (-1502.102) -- 0:02:28

      Average standard deviation of split frequencies: 0.003297

      285500 -- (-1491.953) (-1497.854) [-1493.818] (-1495.720) * (-1499.991) (-1495.269) [-1494.888] (-1496.184) -- 0:02:27
      286000 -- (-1494.919) (-1495.124) (-1499.836) [-1501.135] * [-1498.766] (-1494.669) (-1496.062) (-1500.889) -- 0:02:27
      286500 -- (-1495.979) (-1501.216) [-1499.377] (-1493.299) * [-1496.872] (-1496.077) (-1495.951) (-1503.236) -- 0:02:26
      287000 -- (-1499.629) (-1497.417) (-1497.793) [-1494.296] * (-1505.645) (-1503.704) (-1494.325) [-1502.565] -- 0:02:26
      287500 -- (-1497.877) [-1497.219] (-1495.769) (-1494.510) * (-1491.986) [-1499.869] (-1492.306) (-1510.269) -- 0:02:26
      288000 -- [-1502.384] (-1499.910) (-1506.120) (-1496.670) * (-1497.551) (-1502.001) (-1494.246) [-1502.912] -- 0:02:25
      288500 -- (-1503.338) (-1496.170) (-1502.021) [-1491.845] * (-1496.797) (-1494.724) [-1493.692] (-1497.828) -- 0:02:25
      289000 -- [-1493.224] (-1499.224) (-1507.111) (-1494.287) * (-1498.702) (-1501.091) (-1494.445) [-1497.821] -- 0:02:27
      289500 -- (-1499.880) (-1494.913) [-1494.909] (-1498.098) * (-1494.728) [-1499.848] (-1494.646) (-1493.514) -- 0:02:27
      290000 -- (-1504.050) (-1494.613) (-1493.883) [-1496.780] * (-1495.258) [-1496.365] (-1492.119) (-1492.194) -- 0:02:26

      Average standard deviation of split frequencies: 0.004055

      290500 -- (-1500.231) (-1495.638) (-1495.839) [-1492.787] * (-1497.236) (-1501.116) [-1503.007] (-1493.355) -- 0:02:26
      291000 -- (-1492.376) (-1502.445) (-1498.327) [-1493.004] * (-1495.298) (-1496.869) [-1491.700] (-1498.664) -- 0:02:26
      291500 -- [-1498.046] (-1505.021) (-1504.102) (-1498.595) * (-1498.291) (-1493.133) [-1491.357] (-1501.437) -- 0:02:25
      292000 -- (-1496.514) (-1497.610) (-1499.631) [-1494.869] * (-1507.181) (-1495.287) (-1490.031) [-1494.866] -- 0:02:25
      292500 -- [-1494.729] (-1504.027) (-1497.356) (-1501.009) * (-1497.074) [-1493.978] (-1493.173) (-1497.195) -- 0:02:25
      293000 -- (-1492.429) (-1493.251) [-1495.029] (-1491.813) * (-1501.699) (-1499.186) (-1498.807) [-1501.816] -- 0:02:24
      293500 -- (-1497.682) (-1496.795) [-1495.311] (-1499.316) * (-1507.598) [-1493.893] (-1501.400) (-1493.693) -- 0:02:26
      294000 -- (-1501.068) (-1496.475) [-1492.597] (-1498.042) * [-1495.519] (-1504.605) (-1499.129) (-1495.622) -- 0:02:26
      294500 -- [-1497.551] (-1498.711) (-1493.148) (-1501.674) * (-1496.604) (-1498.343) (-1493.025) [-1490.892] -- 0:02:26
      295000 -- (-1501.624) (-1495.751) [-1491.765] (-1501.730) * (-1501.455) [-1490.798] (-1494.866) (-1496.614) -- 0:02:25

      Average standard deviation of split frequencies: 0.003185

      295500 -- (-1498.953) [-1503.272] (-1497.527) (-1494.106) * (-1493.708) [-1492.105] (-1498.572) (-1497.283) -- 0:02:25
      296000 -- (-1498.219) (-1493.573) (-1497.585) [-1491.840] * [-1493.402] (-1497.461) (-1504.466) (-1510.435) -- 0:02:25
      296500 -- (-1496.045) (-1495.138) (-1497.491) [-1493.151] * (-1513.569) (-1495.008) [-1493.875] (-1497.551) -- 0:02:24
      297000 -- (-1491.400) (-1495.595) (-1503.956) [-1495.577] * [-1498.482] (-1496.584) (-1492.269) (-1500.628) -- 0:02:24
      297500 -- (-1497.195) (-1494.952) (-1498.266) [-1494.899] * [-1497.320] (-1491.790) (-1492.817) (-1494.612) -- 0:02:24
      298000 -- (-1495.444) (-1502.515) (-1490.650) [-1494.812] * (-1495.086) (-1495.420) (-1494.060) [-1494.845] -- 0:02:26
      298500 -- (-1498.542) [-1497.339] (-1497.430) (-1497.896) * (-1494.027) (-1493.227) [-1495.477] (-1498.302) -- 0:02:25
      299000 -- (-1494.979) [-1496.582] (-1497.642) (-1492.824) * [-1498.371] (-1491.993) (-1493.118) (-1495.181) -- 0:02:25
      299500 -- (-1492.925) (-1504.476) (-1498.769) [-1498.026] * (-1494.837) (-1492.865) [-1501.552] (-1499.785) -- 0:02:25
      300000 -- (-1493.944) (-1499.795) [-1498.484] (-1498.606) * (-1495.820) [-1490.028] (-1498.153) (-1499.427) -- 0:02:24

      Average standard deviation of split frequencies: 0.003136

      300500 -- [-1495.472] (-1496.098) (-1496.321) (-1494.428) * (-1502.605) (-1496.600) [-1498.980] (-1503.794) -- 0:02:24
      301000 -- (-1494.091) (-1494.925) [-1495.720] (-1500.814) * (-1496.229) [-1491.277] (-1501.956) (-1493.028) -- 0:02:23
      301500 -- (-1494.055) (-1494.093) [-1495.069] (-1494.784) * (-1500.185) [-1494.821] (-1499.536) (-1494.320) -- 0:02:23
      302000 -- (-1498.795) [-1492.872] (-1501.664) (-1499.525) * (-1489.050) [-1494.190] (-1501.118) (-1498.113) -- 0:02:25
      302500 -- (-1496.990) (-1494.406) (-1499.466) [-1494.510] * (-1494.644) (-1495.352) (-1495.784) [-1494.674] -- 0:02:25
      303000 -- (-1492.699) (-1498.276) [-1496.302] (-1495.400) * [-1489.674] (-1500.008) (-1497.807) (-1491.609) -- 0:02:24
      303500 -- (-1500.848) [-1497.111] (-1494.820) (-1497.552) * [-1492.093] (-1505.102) (-1502.006) (-1497.273) -- 0:02:24
      304000 -- (-1499.641) (-1499.920) (-1493.109) [-1507.434] * (-1493.229) (-1502.327) (-1498.693) [-1494.801] -- 0:02:24
      304500 -- (-1498.058) (-1503.265) (-1501.018) [-1495.673] * (-1499.925) (-1497.804) (-1497.758) [-1496.173] -- 0:02:23
      305000 -- [-1495.367] (-1496.548) (-1497.471) (-1494.459) * [-1498.484] (-1494.449) (-1504.119) (-1498.530) -- 0:02:23

      Average standard deviation of split frequencies: 0.002311

      305500 -- (-1497.336) (-1494.412) (-1503.557) [-1492.966] * (-1492.749) [-1498.236] (-1497.628) (-1495.615) -- 0:02:23
      306000 -- (-1501.527) [-1493.502] (-1491.887) (-1501.510) * [-1491.765] (-1498.223) (-1501.680) (-1497.829) -- 0:02:22
      306500 -- [-1496.149] (-1503.059) (-1493.481) (-1506.732) * (-1498.180) [-1496.889] (-1501.564) (-1499.304) -- 0:02:22
      307000 -- (-1499.773) (-1499.090) [-1496.187] (-1501.346) * (-1496.757) [-1494.503] (-1492.153) (-1494.615) -- 0:02:24
      307500 -- (-1496.584) (-1491.911) (-1496.290) [-1496.942] * (-1494.254) (-1500.774) (-1493.521) [-1493.945] -- 0:02:24
      308000 -- [-1498.941] (-1494.253) (-1495.144) (-1504.121) * [-1493.331] (-1499.767) (-1500.235) (-1495.769) -- 0:02:23
      308500 -- (-1496.347) (-1499.432) (-1495.917) [-1495.211] * (-1498.626) (-1494.259) [-1497.995] (-1494.787) -- 0:02:23
      309000 -- [-1489.973] (-1491.518) (-1505.630) (-1493.359) * (-1498.004) (-1498.113) (-1498.275) [-1497.431] -- 0:02:23
      309500 -- (-1497.166) [-1496.920] (-1500.604) (-1497.784) * (-1496.924) (-1496.948) (-1498.229) [-1495.750] -- 0:02:22
      310000 -- (-1503.116) [-1496.240] (-1494.472) (-1506.709) * (-1495.311) (-1497.490) (-1492.826) [-1496.453] -- 0:02:22

      Average standard deviation of split frequencies: 0.002276

      310500 -- (-1498.640) [-1488.238] (-1499.737) (-1505.127) * (-1495.129) (-1497.598) [-1489.818] (-1498.238) -- 0:02:22
      311000 -- (-1497.396) [-1498.691] (-1497.178) (-1502.656) * (-1493.470) (-1500.110) [-1492.726] (-1496.904) -- 0:02:21
      311500 -- (-1495.005) (-1494.088) [-1492.710] (-1507.668) * (-1493.832) (-1494.241) (-1497.605) [-1494.833] -- 0:02:23
      312000 -- (-1493.162) [-1496.990] (-1505.161) (-1503.666) * (-1503.279) (-1502.082) [-1493.395] (-1499.521) -- 0:02:23
      312500 -- [-1495.199] (-1502.905) (-1496.360) (-1499.671) * (-1499.682) [-1495.595] (-1496.943) (-1498.700) -- 0:02:23
      313000 -- (-1493.684) [-1501.206] (-1493.768) (-1499.562) * (-1498.223) (-1494.026) (-1494.377) [-1491.220] -- 0:02:22
      313500 -- (-1492.771) (-1495.769) [-1500.212] (-1498.151) * (-1492.109) (-1495.902) [-1502.742] (-1504.727) -- 0:02:22
      314000 -- (-1495.395) [-1489.793] (-1497.496) (-1499.948) * (-1500.370) (-1500.116) (-1493.500) [-1498.396] -- 0:02:22
      314500 -- [-1492.714] (-1493.297) (-1496.468) (-1496.097) * (-1498.508) (-1499.065) [-1490.124] (-1504.102) -- 0:02:21
      315000 -- (-1497.920) [-1498.864] (-1500.131) (-1501.470) * (-1494.057) (-1495.193) (-1498.405) [-1494.047] -- 0:02:21

      Average standard deviation of split frequencies: 0.002238

      315500 -- (-1494.079) (-1497.268) (-1499.166) [-1494.738] * (-1507.715) (-1494.360) (-1492.059) [-1493.176] -- 0:02:21
      316000 -- (-1495.994) [-1493.345] (-1499.519) (-1498.148) * (-1506.369) (-1500.638) [-1496.905] (-1497.874) -- 0:02:20
      316500 -- (-1495.532) (-1491.101) [-1492.742] (-1503.601) * (-1498.629) (-1501.066) (-1498.423) [-1494.384] -- 0:02:22
      317000 -- [-1491.511] (-1492.494) (-1495.386) (-1493.331) * (-1500.401) (-1506.270) (-1496.386) [-1497.514] -- 0:02:22
      317500 -- (-1494.965) [-1495.951] (-1497.732) (-1496.651) * (-1506.040) (-1503.074) [-1493.172] (-1489.339) -- 0:02:21
      318000 -- [-1493.531] (-1497.579) (-1496.113) (-1496.541) * (-1501.957) (-1503.740) [-1492.853] (-1494.296) -- 0:02:21
      318500 -- (-1494.817) (-1500.690) [-1497.683] (-1494.318) * (-1498.411) [-1497.151] (-1493.641) (-1494.282) -- 0:02:21
      319000 -- [-1496.064] (-1496.834) (-1496.820) (-1496.586) * (-1500.066) [-1501.456] (-1494.432) (-1495.620) -- 0:02:20
      319500 -- [-1497.587] (-1499.516) (-1499.840) (-1494.287) * (-1497.564) (-1498.941) [-1490.645] (-1497.904) -- 0:02:20
      320000 -- (-1498.912) (-1504.177) [-1494.713] (-1495.446) * (-1500.185) (-1498.114) [-1499.125] (-1500.175) -- 0:02:20

      Average standard deviation of split frequencies: 0.002205

      320500 -- [-1498.021] (-1492.370) (-1501.188) (-1495.997) * (-1500.733) [-1489.730] (-1495.604) (-1495.137) -- 0:02:19
      321000 -- (-1494.563) (-1491.970) (-1496.237) [-1499.295] * (-1500.538) [-1493.704] (-1500.979) (-1498.591) -- 0:02:21
      321500 -- (-1504.547) (-1493.964) [-1500.502] (-1501.191) * (-1500.605) (-1502.424) (-1499.379) [-1495.555] -- 0:02:21
      322000 -- (-1498.565) [-1490.311] (-1501.689) (-1494.885) * (-1495.958) (-1494.702) [-1495.242] (-1500.043) -- 0:02:21
      322500 -- (-1495.820) (-1498.750) [-1500.541] (-1494.780) * (-1495.679) (-1496.486) [-1495.784] (-1500.240) -- 0:02:20
      323000 -- (-1498.010) [-1500.158] (-1498.504) (-1499.823) * (-1492.797) (-1503.495) [-1497.925] (-1496.146) -- 0:02:20
      323500 -- (-1496.657) (-1494.732) (-1503.864) [-1493.731] * (-1496.709) (-1514.080) (-1496.381) [-1499.265] -- 0:02:20
      324000 -- (-1501.755) (-1490.849) [-1493.109] (-1493.246) * (-1498.874) (-1500.042) [-1489.865] (-1497.635) -- 0:02:19
      324500 -- (-1492.149) [-1495.166] (-1494.978) (-1494.038) * [-1491.884] (-1495.453) (-1495.935) (-1501.171) -- 0:02:19
      325000 -- (-1494.813) (-1491.584) [-1498.573] (-1496.640) * (-1497.410) (-1500.009) [-1491.840] (-1500.447) -- 0:02:19

      Average standard deviation of split frequencies: 0.002169

      325500 -- (-1502.511) [-1491.698] (-1497.950) (-1493.540) * [-1493.673] (-1494.570) (-1501.853) (-1497.613) -- 0:02:18
      326000 -- (-1495.660) (-1497.423) (-1499.643) [-1498.589] * (-1493.155) (-1492.692) [-1491.117] (-1499.372) -- 0:02:20
      326500 -- (-1494.272) [-1496.992] (-1495.042) (-1498.748) * (-1490.943) (-1497.438) (-1499.534) [-1497.960] -- 0:02:20
      327000 -- [-1493.671] (-1498.003) (-1492.066) (-1490.690) * [-1495.672] (-1498.396) (-1495.881) (-1497.617) -- 0:02:19
      327500 -- (-1494.613) [-1496.683] (-1498.154) (-1492.324) * (-1499.679) [-1490.805] (-1491.112) (-1494.741) -- 0:02:19
      328000 -- (-1497.198) [-1493.205] (-1501.012) (-1497.181) * (-1492.730) (-1491.939) [-1496.694] (-1498.842) -- 0:02:19
      328500 -- [-1492.962] (-1495.447) (-1494.540) (-1494.903) * (-1497.168) [-1495.124] (-1492.200) (-1501.867) -- 0:02:19
      329000 -- (-1494.733) [-1495.971] (-1494.172) (-1493.628) * (-1492.041) (-1496.279) (-1492.385) [-1496.570] -- 0:02:18
      329500 -- (-1492.162) [-1495.182] (-1496.415) (-1493.358) * [-1490.936] (-1498.760) (-1501.236) (-1502.404) -- 0:02:18
      330000 -- (-1492.435) (-1495.389) [-1495.455] (-1500.611) * (-1494.629) (-1493.098) [-1496.658] (-1498.795) -- 0:02:18

      Average standard deviation of split frequencies: 0.002138

      330500 -- (-1499.626) [-1497.691] (-1495.094) (-1496.199) * (-1502.849) [-1495.331] (-1504.618) (-1501.692) -- 0:02:17
      331000 -- (-1500.111) [-1497.311] (-1499.516) (-1498.085) * (-1502.688) [-1493.902] (-1498.288) (-1495.697) -- 0:02:19
      331500 -- (-1495.319) (-1494.978) (-1494.889) [-1494.649] * (-1500.991) (-1494.896) (-1496.505) [-1497.376] -- 0:02:19
      332000 -- [-1493.918] (-1494.085) (-1501.038) (-1494.123) * (-1498.189) (-1496.369) [-1493.460] (-1494.682) -- 0:02:18
      332500 -- (-1495.290) (-1494.715) (-1495.604) [-1495.647] * [-1496.014] (-1497.427) (-1495.487) (-1496.408) -- 0:02:18
      333000 -- (-1496.852) (-1496.522) [-1492.349] (-1499.327) * [-1496.956] (-1499.255) (-1493.646) (-1496.107) -- 0:02:18
      333500 -- (-1500.282) [-1492.185] (-1495.748) (-1497.191) * (-1501.054) (-1497.160) [-1494.381] (-1500.903) -- 0:02:17
      334000 -- [-1493.548] (-1494.263) (-1495.074) (-1497.501) * (-1497.586) (-1497.606) [-1491.515] (-1499.152) -- 0:02:17
      334500 -- (-1494.155) [-1493.723] (-1497.120) (-1501.794) * [-1498.515] (-1497.765) (-1493.433) (-1503.585) -- 0:02:17
      335000 -- (-1497.610) [-1496.664] (-1496.382) (-1496.898) * (-1495.344) [-1495.574] (-1493.273) (-1499.326) -- 0:02:16

      Average standard deviation of split frequencies: 0.002104

      335500 -- (-1498.279) (-1496.265) (-1497.497) [-1493.217] * (-1494.851) (-1498.292) [-1494.581] (-1490.121) -- 0:02:18
      336000 -- [-1498.672] (-1502.300) (-1501.250) (-1499.321) * [-1498.986] (-1494.880) (-1496.575) (-1491.617) -- 0:02:18
      336500 -- (-1499.131) (-1503.938) [-1495.403] (-1496.317) * (-1494.822) [-1494.367] (-1500.972) (-1495.646) -- 0:02:18
      337000 -- [-1495.205] (-1496.757) (-1497.100) (-1502.172) * (-1492.761) (-1495.386) (-1494.248) [-1498.074] -- 0:02:17
      337500 -- (-1500.227) (-1502.205) [-1499.164] (-1493.956) * (-1490.996) (-1495.516) [-1493.004] (-1497.721) -- 0:02:17
      338000 -- (-1498.265) [-1497.032] (-1504.020) (-1500.717) * (-1497.336) (-1493.868) [-1495.384] (-1503.701) -- 0:02:17
      338500 -- (-1497.479) (-1495.524) (-1492.545) [-1496.472] * [-1494.805] (-1499.321) (-1493.229) (-1506.791) -- 0:02:16
      339000 -- [-1493.915] (-1495.223) (-1499.654) (-1494.091) * (-1496.154) (-1495.029) [-1497.182] (-1497.873) -- 0:02:16
      339500 -- (-1498.926) (-1499.719) [-1499.108] (-1492.388) * (-1496.400) [-1502.404] (-1497.485) (-1502.668) -- 0:02:16
      340000 -- [-1496.273] (-1495.388) (-1508.825) (-1498.816) * (-1498.204) (-1503.193) (-1503.967) [-1493.371] -- 0:02:15

      Average standard deviation of split frequencies: 0.001384

      340500 -- (-1501.146) (-1494.932) (-1496.570) [-1493.221] * (-1496.990) [-1492.524] (-1498.644) (-1493.649) -- 0:02:17
      341000 -- (-1500.365) (-1495.089) (-1501.638) [-1493.448] * (-1502.417) (-1495.880) (-1492.045) [-1493.520] -- 0:02:17
      341500 -- (-1497.980) (-1499.394) [-1500.192] (-1499.265) * (-1498.971) (-1496.516) [-1491.349] (-1501.591) -- 0:02:16
      342000 -- (-1496.156) (-1495.851) [-1498.121] (-1500.151) * (-1504.508) (-1494.358) [-1501.811] (-1497.722) -- 0:02:16
      342500 -- (-1504.115) [-1495.168] (-1500.084) (-1492.181) * (-1497.334) (-1495.036) [-1498.515] (-1498.421) -- 0:02:16
      343000 -- (-1498.261) (-1497.429) (-1497.618) [-1492.267] * (-1499.765) [-1493.762] (-1495.138) (-1498.024) -- 0:02:15
      343500 -- (-1497.451) (-1499.760) [-1496.233] (-1490.272) * [-1495.220] (-1495.308) (-1494.601) (-1498.123) -- 0:02:15
      344000 -- (-1497.483) (-1497.076) (-1496.771) [-1501.465] * (-1496.417) (-1493.290) (-1493.805) [-1495.661] -- 0:02:15
      344500 -- (-1504.816) (-1508.136) [-1499.748] (-1494.533) * (-1499.655) (-1495.729) [-1498.456] (-1495.150) -- 0:02:15
      345000 -- [-1501.241] (-1506.959) (-1494.839) (-1500.565) * (-1502.716) (-1496.700) (-1495.043) [-1497.402] -- 0:02:14

      Average standard deviation of split frequencies: 0.001362

      345500 -- (-1502.254) (-1507.466) (-1501.852) [-1496.231] * [-1505.246] (-1496.413) (-1495.326) (-1497.508) -- 0:02:16
      346000 -- (-1491.523) (-1500.213) (-1493.855) [-1494.165] * [-1493.494] (-1491.830) (-1498.888) (-1500.182) -- 0:02:16
      346500 -- (-1492.074) [-1493.173] (-1493.212) (-1498.517) * (-1498.617) [-1492.311] (-1497.967) (-1501.794) -- 0:02:15
      347000 -- (-1493.255) [-1497.733] (-1493.700) (-1505.358) * (-1497.717) (-1494.478) (-1506.968) [-1497.056] -- 0:02:15
      347500 -- (-1492.811) (-1502.668) [-1494.277] (-1503.217) * (-1502.146) [-1490.078] (-1493.181) (-1499.845) -- 0:02:15
      348000 -- (-1491.565) [-1498.290] (-1508.656) (-1496.489) * (-1503.996) (-1498.592) [-1496.149] (-1494.332) -- 0:02:14
      348500 -- (-1502.111) (-1490.181) [-1491.522] (-1493.077) * (-1502.828) (-1503.974) (-1493.456) [-1493.894] -- 0:02:14
      349000 -- (-1500.387) (-1493.645) (-1509.027) [-1498.725] * (-1497.428) [-1496.565] (-1493.843) (-1492.327) -- 0:02:14
      349500 -- (-1495.300) (-1491.565) (-1496.908) [-1494.441] * (-1493.110) (-1493.207) [-1496.874] (-1496.861) -- 0:02:14
      350000 -- (-1495.190) [-1500.763] (-1498.882) (-1496.599) * (-1498.346) (-1493.415) (-1493.472) [-1494.628] -- 0:02:15

      Average standard deviation of split frequencies: 0.001344

      350500 -- (-1495.104) (-1497.193) [-1494.917] (-1499.206) * (-1494.422) (-1495.890) [-1490.250] (-1499.168) -- 0:02:15
      351000 -- (-1497.913) (-1500.553) [-1500.091] (-1507.074) * [-1499.016] (-1497.615) (-1496.706) (-1501.701) -- 0:02:14
      351500 -- (-1500.526) (-1502.366) (-1493.806) [-1502.301] * (-1495.579) [-1499.301] (-1502.297) (-1508.389) -- 0:02:14
      352000 -- (-1498.833) (-1505.657) (-1495.724) [-1504.278] * (-1495.361) [-1496.971] (-1508.484) (-1497.640) -- 0:02:14
      352500 -- (-1495.555) [-1498.935] (-1494.655) (-1497.282) * (-1499.671) [-1496.200] (-1498.997) (-1493.430) -- 0:02:14
      353000 -- (-1495.386) [-1494.067] (-1497.733) (-1501.010) * (-1498.344) [-1496.626] (-1503.747) (-1498.725) -- 0:02:13
      353500 -- (-1499.856) (-1504.513) (-1499.380) [-1494.519] * (-1493.404) (-1502.573) (-1507.045) [-1501.887] -- 0:02:13
      354000 -- (-1503.572) [-1498.544] (-1496.906) (-1494.957) * (-1498.589) [-1498.914] (-1505.129) (-1498.908) -- 0:02:13
      354500 -- (-1505.807) (-1492.419) (-1499.985) [-1507.295] * (-1497.094) (-1500.289) (-1499.746) [-1499.601] -- 0:02:12
      355000 -- (-1496.078) (-1495.913) [-1495.612] (-1500.558) * (-1497.587) (-1498.527) [-1493.381] (-1492.285) -- 0:02:14

      Average standard deviation of split frequencies: 0.001324

      355500 -- (-1501.900) [-1494.010] (-1498.935) (-1497.740) * (-1496.269) [-1493.877] (-1502.520) (-1492.596) -- 0:02:14
      356000 -- (-1506.073) (-1503.439) [-1501.509] (-1496.986) * [-1493.591] (-1491.495) (-1496.611) (-1502.949) -- 0:02:13
      356500 -- (-1497.129) (-1493.222) [-1496.860] (-1499.562) * (-1493.512) (-1500.516) [-1492.084] (-1501.951) -- 0:02:13
      357000 -- (-1497.839) (-1497.991) (-1490.823) [-1491.738] * [-1492.862] (-1500.886) (-1500.301) (-1506.535) -- 0:02:13
      357500 -- (-1496.988) [-1500.146] (-1500.709) (-1494.663) * [-1495.081] (-1499.617) (-1495.505) (-1499.966) -- 0:02:12
      358000 -- (-1496.860) [-1493.458] (-1491.369) (-1495.148) * (-1497.899) (-1492.598) [-1491.526] (-1493.267) -- 0:02:12
      358500 -- (-1503.629) (-1504.140) (-1492.231) [-1495.359] * (-1499.509) (-1503.083) [-1496.891] (-1496.149) -- 0:02:12
      359000 -- (-1496.905) [-1495.637] (-1498.280) (-1492.839) * (-1500.754) (-1501.156) [-1493.382] (-1494.767) -- 0:02:12
      359500 -- (-1498.710) (-1493.586) [-1496.017] (-1497.347) * (-1510.707) (-1503.416) (-1494.031) [-1494.107] -- 0:02:11
      360000 -- (-1499.176) [-1493.374] (-1494.461) (-1492.701) * (-1502.736) (-1500.232) [-1506.555] (-1495.627) -- 0:02:13

      Average standard deviation of split frequencies: 0.001307

      360500 -- (-1497.965) (-1495.318) [-1501.838] (-1492.135) * [-1501.538] (-1496.966) (-1502.080) (-1496.270) -- 0:02:13
      361000 -- (-1500.805) [-1496.520] (-1499.072) (-1493.508) * (-1494.601) [-1499.255] (-1507.919) (-1491.868) -- 0:02:12
      361500 -- (-1496.697) (-1495.751) [-1499.235] (-1490.875) * (-1499.394) (-1503.759) (-1501.839) [-1492.848] -- 0:02:12
      362000 -- [-1493.169] (-1499.353) (-1499.737) (-1495.327) * [-1492.321] (-1494.859) (-1500.712) (-1495.837) -- 0:02:12
      362500 -- [-1495.908] (-1491.575) (-1493.972) (-1495.977) * (-1492.483) (-1496.317) (-1501.716) [-1497.973] -- 0:02:11
      363000 -- (-1496.525) (-1494.307) [-1495.601] (-1491.913) * (-1491.282) (-1493.006) [-1499.441] (-1500.257) -- 0:02:11
      363500 -- [-1491.491] (-1496.705) (-1497.363) (-1503.032) * (-1494.708) [-1497.174] (-1496.156) (-1503.557) -- 0:02:11
      364000 -- [-1490.810] (-1492.707) (-1502.354) (-1497.037) * [-1495.053] (-1498.286) (-1497.524) (-1506.660) -- 0:02:11
      364500 -- (-1501.698) [-1493.381] (-1501.540) (-1496.420) * [-1491.620] (-1504.009) (-1496.443) (-1503.729) -- 0:02:12
      365000 -- (-1491.934) (-1494.148) (-1502.971) [-1496.617] * [-1493.849] (-1499.898) (-1497.056) (-1493.915) -- 0:02:12

      Average standard deviation of split frequencies: 0.001288

      365500 -- (-1496.124) (-1500.768) (-1492.282) [-1494.880] * [-1508.242] (-1500.230) (-1497.671) (-1500.756) -- 0:02:11
      366000 -- (-1509.369) (-1497.603) (-1496.969) [-1502.057] * [-1492.604] (-1494.170) (-1496.456) (-1494.820) -- 0:02:11
      366500 -- (-1507.710) (-1499.635) [-1493.523] (-1499.404) * [-1498.218] (-1494.476) (-1495.482) (-1504.606) -- 0:02:11
      367000 -- (-1498.143) (-1499.332) [-1496.149] (-1495.980) * (-1497.384) [-1493.561] (-1491.141) (-1500.904) -- 0:02:11
      367500 -- (-1492.314) (-1493.544) [-1496.265] (-1490.403) * (-1499.520) (-1493.854) [-1490.289] (-1497.876) -- 0:02:10
      368000 -- [-1490.278] (-1498.811) (-1495.995) (-1499.092) * [-1498.095] (-1494.120) (-1498.453) (-1495.708) -- 0:02:10
      368500 -- (-1492.180) (-1496.672) [-1493.522] (-1496.513) * (-1497.826) (-1495.558) [-1501.655] (-1498.379) -- 0:02:10
      369000 -- (-1489.544) (-1495.832) (-1493.054) [-1495.949] * [-1494.622] (-1501.903) (-1497.144) (-1500.610) -- 0:02:09
      369500 -- (-1502.498) [-1493.296] (-1493.182) (-1496.370) * [-1494.049] (-1495.542) (-1490.930) (-1495.338) -- 0:02:11
      370000 -- [-1496.433] (-1494.707) (-1493.712) (-1506.097) * (-1494.082) (-1498.016) [-1495.283] (-1493.633) -- 0:02:11

      Average standard deviation of split frequencies: 0.001272

      370500 -- (-1493.541) [-1497.663] (-1496.968) (-1495.246) * (-1503.997) (-1499.229) [-1498.654] (-1496.341) -- 0:02:10
      371000 -- [-1494.321] (-1492.422) (-1490.965) (-1497.547) * (-1496.149) (-1498.255) (-1491.799) [-1500.968] -- 0:02:10
      371500 -- (-1491.116) (-1500.075) [-1495.031] (-1508.113) * (-1496.360) [-1500.264] (-1496.894) (-1501.342) -- 0:02:10
      372000 -- [-1495.541] (-1501.078) (-1496.896) (-1503.434) * (-1496.599) [-1494.476] (-1491.432) (-1501.661) -- 0:02:09
      372500 -- (-1496.750) (-1498.539) [-1494.924] (-1499.255) * (-1496.648) (-1497.869) (-1492.215) [-1496.904] -- 0:02:09
      373000 -- [-1492.849] (-1502.274) (-1513.020) (-1498.835) * (-1493.643) (-1495.105) (-1497.768) [-1493.938] -- 0:02:09
      373500 -- (-1494.380) (-1509.315) [-1495.081] (-1500.343) * [-1497.371] (-1496.404) (-1496.934) (-1494.456) -- 0:02:09
      374000 -- (-1493.968) (-1499.567) [-1491.712] (-1506.106) * (-1497.510) (-1496.153) [-1500.993] (-1493.240) -- 0:02:08
      374500 -- (-1502.717) (-1498.940) [-1488.874] (-1498.215) * (-1501.190) (-1495.410) [-1501.209] (-1495.263) -- 0:02:10
      375000 -- [-1493.296] (-1489.990) (-1494.482) (-1495.379) * (-1497.898) [-1499.449] (-1495.076) (-1494.572) -- 0:02:10

      Average standard deviation of split frequencies: 0.001254

      375500 -- (-1493.216) (-1492.823) [-1497.079] (-1498.292) * (-1493.645) (-1496.527) [-1495.007] (-1492.956) -- 0:02:09
      376000 -- (-1508.285) (-1494.219) (-1501.370) [-1497.076] * (-1491.521) (-1497.353) [-1494.496] (-1501.215) -- 0:02:09
      376500 -- (-1494.288) [-1490.438] (-1495.796) (-1497.848) * [-1495.163] (-1501.634) (-1499.363) (-1495.266) -- 0:02:09
      377000 -- (-1502.576) (-1500.659) [-1504.587] (-1496.460) * (-1496.718) (-1499.688) (-1497.743) [-1496.140] -- 0:02:08
      377500 -- (-1500.442) [-1500.286] (-1496.998) (-1496.067) * (-1503.188) (-1495.497) (-1496.600) [-1502.092] -- 0:02:08
      378000 -- [-1499.348] (-1500.299) (-1494.356) (-1492.990) * (-1495.890) [-1494.344] (-1493.516) (-1492.105) -- 0:02:08
      378500 -- [-1493.884] (-1503.300) (-1501.340) (-1493.654) * (-1494.609) (-1491.514) (-1494.289) [-1498.051] -- 0:02:08
      379000 -- (-1503.307) [-1497.115] (-1490.925) (-1498.269) * (-1503.398) (-1496.945) [-1496.856] (-1500.512) -- 0:02:09
      379500 -- (-1498.916) (-1491.879) (-1495.085) [-1499.514] * (-1494.390) (-1497.642) [-1493.325] (-1494.473) -- 0:02:09
      380000 -- (-1500.332) (-1494.403) [-1496.300] (-1496.882) * [-1496.432] (-1494.792) (-1498.784) (-1497.655) -- 0:02:08

      Average standard deviation of split frequencies: 0.001238

      380500 -- [-1496.171] (-1494.152) (-1496.874) (-1497.982) * (-1494.571) [-1494.940] (-1496.771) (-1505.757) -- 0:02:08
      381000 -- (-1499.050) (-1496.928) (-1497.996) [-1496.032] * [-1497.970] (-1498.845) (-1494.581) (-1498.402) -- 0:02:08
      381500 -- (-1498.242) (-1499.782) (-1494.283) [-1495.504] * (-1499.525) (-1498.435) (-1495.628) [-1494.906] -- 0:02:08
      382000 -- (-1494.201) [-1494.460] (-1495.224) (-1497.218) * (-1497.771) [-1490.615] (-1507.799) (-1493.124) -- 0:02:07
      382500 -- (-1491.586) (-1492.694) [-1497.566] (-1501.986) * (-1499.632) [-1494.061] (-1500.871) (-1493.402) -- 0:02:07
      383000 -- (-1495.965) [-1497.569] (-1497.385) (-1499.408) * (-1499.861) [-1494.420] (-1493.989) (-1497.846) -- 0:02:07
      383500 -- [-1494.622] (-1495.320) (-1496.058) (-1496.799) * (-1500.084) [-1498.581] (-1499.547) (-1499.579) -- 0:02:06
      384000 -- (-1494.180) (-1493.870) [-1493.232] (-1497.034) * (-1492.440) (-1497.500) (-1496.521) [-1494.221] -- 0:02:08
      384500 -- [-1491.638] (-1497.646) (-1505.771) (-1501.739) * (-1494.744) [-1492.990] (-1500.340) (-1497.372) -- 0:02:08
      385000 -- (-1501.179) [-1500.847] (-1501.462) (-1504.400) * (-1500.219) (-1494.540) (-1500.916) [-1495.777] -- 0:02:07

      Average standard deviation of split frequencies: 0.001221

      385500 -- (-1502.323) (-1495.214) [-1495.551] (-1498.643) * [-1502.829] (-1496.944) (-1497.867) (-1493.500) -- 0:02:07
      386000 -- (-1501.120) (-1492.891) [-1494.385] (-1500.417) * (-1506.133) [-1495.762] (-1495.821) (-1494.207) -- 0:02:07
      386500 -- (-1498.084) (-1495.629) (-1490.905) [-1497.508] * (-1497.604) (-1499.041) [-1493.778] (-1498.086) -- 0:02:06
      387000 -- (-1499.185) (-1497.618) (-1494.959) [-1495.071] * (-1492.981) (-1499.184) [-1498.173] (-1499.874) -- 0:02:06
      387500 -- (-1496.792) (-1494.155) [-1494.329] (-1500.254) * [-1494.406] (-1502.414) (-1499.039) (-1498.923) -- 0:02:06
      388000 -- (-1494.596) (-1492.729) (-1492.835) [-1498.390] * [-1492.630] (-1494.497) (-1500.054) (-1495.594) -- 0:02:06
      388500 -- (-1495.182) [-1497.458] (-1503.398) (-1495.513) * (-1494.447) (-1497.408) [-1498.782] (-1500.093) -- 0:02:05
      389000 -- (-1495.231) (-1499.351) [-1496.987] (-1493.715) * (-1499.537) [-1497.273] (-1497.454) (-1494.447) -- 0:02:07
      389500 -- (-1495.347) (-1494.354) [-1491.277] (-1492.751) * (-1498.221) (-1502.258) [-1497.006] (-1498.854) -- 0:02:06
      390000 -- [-1497.389] (-1495.940) (-1494.412) (-1496.798) * [-1501.258] (-1494.383) (-1495.682) (-1491.955) -- 0:02:06

      Average standard deviation of split frequencies: 0.001207

      390500 -- [-1496.551] (-1495.640) (-1495.735) (-1495.284) * (-1492.742) [-1493.579] (-1493.849) (-1497.696) -- 0:02:06
      391000 -- [-1497.952] (-1499.235) (-1493.958) (-1501.911) * (-1496.742) (-1495.141) [-1495.030] (-1500.386) -- 0:02:06
      391500 -- [-1496.916] (-1502.885) (-1495.975) (-1502.494) * (-1499.194) [-1495.018] (-1494.820) (-1504.779) -- 0:02:05
      392000 -- (-1497.937) [-1499.870] (-1493.244) (-1500.339) * (-1494.379) (-1496.885) [-1498.111] (-1496.237) -- 0:02:05
      392500 -- (-1490.479) (-1500.262) [-1493.974] (-1494.512) * (-1502.952) [-1494.005] (-1495.676) (-1496.008) -- 0:02:05
      393000 -- (-1496.061) [-1498.735] (-1494.827) (-1496.314) * [-1497.144] (-1494.036) (-1492.691) (-1499.789) -- 0:02:05
      393500 -- (-1495.554) [-1490.294] (-1498.408) (-1491.616) * (-1500.839) (-1496.611) [-1496.063] (-1497.230) -- 0:02:06
      394000 -- [-1497.242] (-1492.548) (-1498.314) (-1503.916) * (-1494.567) (-1494.119) [-1495.342] (-1496.701) -- 0:02:06
      394500 -- (-1498.374) (-1498.512) (-1491.339) [-1496.725] * (-1492.467) (-1501.935) (-1495.210) [-1491.425] -- 0:02:05
      395000 -- [-1499.228] (-1506.686) (-1491.702) (-1496.670) * (-1501.567) [-1498.622] (-1494.566) (-1500.175) -- 0:02:05

      Average standard deviation of split frequencies: 0.001190

      395500 -- [-1492.609] (-1499.673) (-1491.472) (-1497.774) * (-1498.502) (-1494.629) (-1497.803) [-1498.958] -- 0:02:05
      396000 -- (-1492.272) (-1496.365) [-1499.654] (-1496.611) * (-1494.157) (-1510.614) [-1492.207] (-1497.113) -- 0:02:05
      396500 -- (-1491.412) (-1496.515) (-1497.952) [-1500.489] * (-1500.123) [-1494.846] (-1491.385) (-1493.485) -- 0:02:04
      397000 -- [-1498.212] (-1497.514) (-1502.111) (-1506.049) * (-1492.515) (-1494.828) [-1498.445] (-1496.374) -- 0:02:04
      397500 -- (-1501.597) (-1498.371) (-1497.710) [-1495.120] * (-1493.017) [-1501.227] (-1497.140) (-1492.260) -- 0:02:04
      398000 -- [-1495.537] (-1497.713) (-1505.752) (-1495.516) * [-1503.625] (-1505.164) (-1494.772) (-1491.736) -- 0:02:04
      398500 -- [-1495.390] (-1498.702) (-1505.204) (-1498.585) * (-1497.562) (-1495.103) [-1491.160] (-1495.339) -- 0:02:05
      399000 -- (-1496.178) (-1498.158) (-1494.646) [-1501.382] * (-1494.117) (-1495.598) [-1500.747] (-1489.396) -- 0:02:05
      399500 -- (-1499.382) (-1491.802) [-1492.079] (-1497.831) * (-1495.444) (-1493.334) (-1493.987) [-1495.711] -- 0:02:04
      400000 -- [-1506.247] (-1497.391) (-1495.406) (-1498.519) * (-1494.201) (-1492.324) (-1496.299) [-1497.089] -- 0:02:04

      Average standard deviation of split frequencies: 0.001765

      400500 -- (-1496.627) (-1498.337) [-1496.076] (-1499.918) * (-1503.834) [-1493.196] (-1500.813) (-1496.361) -- 0:02:04
      401000 -- [-1500.994] (-1495.316) (-1495.176) (-1496.987) * (-1497.009) (-1492.988) (-1503.874) [-1496.036] -- 0:02:03
      401500 -- [-1498.571] (-1495.376) (-1508.766) (-1494.921) * (-1496.362) (-1492.139) [-1495.309] (-1492.517) -- 0:02:03
      402000 -- (-1497.941) [-1498.310] (-1493.419) (-1501.791) * (-1497.855) (-1492.347) [-1491.019] (-1500.548) -- 0:02:03
      402500 -- (-1506.134) (-1506.289) [-1496.738] (-1500.600) * (-1493.559) (-1488.271) (-1497.404) [-1495.533] -- 0:02:03
      403000 -- (-1496.201) [-1504.753] (-1503.108) (-1492.813) * (-1495.536) (-1490.580) [-1494.294] (-1492.321) -- 0:02:02
      403500 -- (-1498.099) (-1506.693) (-1494.236) [-1491.928] * (-1494.773) [-1491.242] (-1498.233) (-1495.541) -- 0:02:04
      404000 -- (-1497.245) [-1494.017] (-1501.871) (-1495.427) * (-1493.633) (-1492.172) (-1496.006) [-1495.923] -- 0:02:03
      404500 -- (-1491.697) [-1492.908] (-1494.954) (-1496.009) * [-1500.755] (-1493.907) (-1498.334) (-1498.095) -- 0:02:03
      405000 -- [-1499.850] (-1502.102) (-1499.227) (-1495.849) * (-1495.999) (-1497.899) [-1494.393] (-1497.084) -- 0:02:03

      Average standard deviation of split frequencies: 0.001742

      405500 -- (-1494.695) (-1492.932) (-1496.834) [-1495.017] * (-1493.702) [-1495.710] (-1499.915) (-1495.510) -- 0:02:03
      406000 -- (-1498.629) [-1495.585] (-1495.486) (-1495.128) * [-1494.628] (-1492.590) (-1495.999) (-1490.700) -- 0:02:02
      406500 -- (-1501.286) (-1494.120) [-1495.348] (-1493.391) * [-1496.541] (-1494.566) (-1498.844) (-1497.572) -- 0:02:02
      407000 -- [-1496.938] (-1493.311) (-1499.603) (-1495.884) * (-1499.851) [-1490.816] (-1498.708) (-1496.310) -- 0:02:02
      407500 -- (-1488.995) (-1493.877) (-1494.061) [-1491.433] * (-1500.142) (-1491.764) (-1501.964) [-1494.771] -- 0:02:02
      408000 -- [-1493.741] (-1493.208) (-1499.837) (-1491.733) * (-1497.602) (-1498.966) (-1498.994) [-1498.390] -- 0:02:03
      408500 -- (-1499.914) (-1498.955) [-1498.236] (-1492.830) * (-1524.165) [-1494.306] (-1495.977) (-1498.647) -- 0:02:03
      409000 -- (-1497.967) (-1502.362) [-1490.880] (-1500.266) * (-1500.719) [-1495.929] (-1501.259) (-1495.012) -- 0:02:02
      409500 -- [-1496.219] (-1494.692) (-1491.788) (-1496.081) * [-1493.032] (-1494.666) (-1496.606) (-1505.567) -- 0:02:02
      410000 -- (-1495.710) [-1492.165] (-1496.605) (-1490.647) * [-1495.820] (-1499.374) (-1500.249) (-1496.395) -- 0:02:02

      Average standard deviation of split frequencies: 0.001722

      410500 -- [-1491.999] (-1494.674) (-1494.396) (-1494.020) * (-1510.362) (-1498.208) (-1497.112) [-1493.603] -- 0:02:02
      411000 -- (-1500.067) (-1499.288) [-1492.051] (-1495.868) * [-1493.856] (-1494.452) (-1497.764) (-1496.345) -- 0:02:01
      411500 -- (-1494.721) (-1493.828) (-1493.233) [-1500.015] * (-1493.187) [-1495.076] (-1501.513) (-1497.904) -- 0:02:01
      412000 -- [-1494.532] (-1491.090) (-1498.702) (-1493.169) * (-1497.669) [-1496.324] (-1498.224) (-1497.085) -- 0:02:01
      412500 -- (-1502.877) (-1493.627) (-1496.785) [-1499.763] * (-1491.798) (-1493.816) (-1493.930) [-1494.302] -- 0:02:01
      413000 -- (-1502.070) [-1492.979] (-1497.488) (-1498.737) * (-1494.910) [-1504.292] (-1496.598) (-1495.234) -- 0:02:02
      413500 -- (-1498.928) (-1493.006) [-1502.698] (-1505.376) * (-1494.145) [-1496.711] (-1493.233) (-1496.911) -- 0:02:01
      414000 -- (-1496.026) (-1503.635) [-1492.396] (-1499.025) * (-1494.103) (-1499.339) [-1490.838] (-1493.948) -- 0:02:01
      414500 -- (-1493.009) [-1491.707] (-1495.953) (-1498.324) * (-1494.855) (-1495.450) [-1506.907] (-1500.463) -- 0:02:01
      415000 -- (-1499.227) [-1492.950] (-1494.984) (-1497.659) * (-1495.368) [-1495.005] (-1496.445) (-1497.885) -- 0:02:01

      Average standard deviation of split frequencies: 0.001700

      415500 -- (-1503.843) (-1499.641) [-1496.790] (-1494.292) * (-1494.071) [-1505.592] (-1492.640) (-1492.976) -- 0:02:00
      416000 -- [-1492.636] (-1504.686) (-1496.803) (-1490.277) * (-1501.057) (-1503.831) (-1498.467) [-1495.611] -- 0:02:00
      416500 -- (-1493.608) [-1493.346] (-1493.682) (-1491.003) * (-1495.370) (-1498.661) (-1489.445) [-1497.939] -- 0:02:00
      417000 -- [-1491.992] (-1496.564) (-1492.965) (-1498.044) * (-1503.887) (-1496.867) [-1493.193] (-1498.801) -- 0:02:00
      417500 -- (-1499.153) (-1503.458) (-1497.071) [-1494.202] * (-1497.515) (-1499.694) [-1493.851] (-1507.181) -- 0:01:59
      418000 -- (-1493.249) (-1493.624) (-1504.481) [-1499.637] * (-1506.834) [-1497.861] (-1492.695) (-1498.645) -- 0:02:01
      418500 -- (-1492.559) [-1495.537] (-1499.155) (-1500.315) * [-1503.367] (-1499.755) (-1497.228) (-1504.736) -- 0:02:00
      419000 -- [-1493.685] (-1503.279) (-1499.721) (-1501.054) * (-1505.463) (-1492.474) (-1501.056) [-1492.806] -- 0:02:00
      419500 -- [-1496.954] (-1498.249) (-1499.221) (-1498.532) * (-1498.834) (-1500.912) [-1495.198] (-1495.301) -- 0:02:00
      420000 -- [-1497.283] (-1496.146) (-1498.755) (-1491.362) * [-1497.642] (-1498.210) (-1499.837) (-1491.231) -- 0:02:00

      Average standard deviation of split frequencies: 0.001681

      420500 -- (-1500.972) [-1498.382] (-1497.944) (-1496.277) * (-1501.828) (-1497.390) [-1501.176] (-1497.496) -- 0:01:59
      421000 -- [-1496.151] (-1503.941) (-1504.118) (-1496.360) * [-1499.760] (-1495.478) (-1503.702) (-1503.244) -- 0:01:59
      421500 -- [-1497.193] (-1498.598) (-1498.614) (-1493.459) * (-1503.551) (-1493.544) (-1499.238) [-1497.412] -- 0:01:59
      422000 -- (-1496.551) (-1494.487) (-1497.869) [-1490.825] * [-1496.732] (-1505.390) (-1497.474) (-1501.803) -- 0:01:59
      422500 -- [-1497.923] (-1494.765) (-1497.498) (-1498.487) * [-1495.208] (-1501.846) (-1496.732) (-1496.651) -- 0:02:00
      423000 -- (-1495.182) (-1499.351) (-1499.983) [-1497.629] * (-1490.599) [-1499.132] (-1492.975) (-1494.491) -- 0:02:00
      423500 -- (-1492.558) (-1499.737) [-1494.395] (-1494.490) * (-1496.547) (-1497.787) (-1506.261) [-1492.894] -- 0:01:59
      424000 -- (-1506.674) [-1498.739] (-1495.357) (-1491.750) * (-1494.752) (-1492.471) [-1495.185] (-1496.921) -- 0:01:59
      424500 -- [-1494.998] (-1495.560) (-1490.932) (-1499.665) * (-1493.004) [-1492.766] (-1499.324) (-1493.095) -- 0:01:59
      425000 -- (-1496.470) (-1490.584) [-1495.829] (-1495.789) * (-1495.981) [-1501.378] (-1499.859) (-1495.280) -- 0:01:59

      Average standard deviation of split frequencies: 0.001660

      425500 -- (-1501.213) (-1491.793) [-1492.211] (-1498.514) * (-1495.454) [-1492.554] (-1493.689) (-1501.793) -- 0:01:58
      426000 -- (-1495.392) [-1494.540] (-1495.884) (-1492.608) * (-1497.189) (-1489.131) [-1496.048] (-1498.696) -- 0:01:58
      426500 -- (-1496.385) (-1500.034) [-1494.488] (-1496.492) * (-1499.234) (-1496.095) [-1497.138] (-1501.235) -- 0:01:58
      427000 -- (-1506.131) [-1495.325] (-1496.409) (-1492.170) * (-1489.967) (-1495.426) (-1498.612) [-1500.282] -- 0:01:58
      427500 -- (-1495.688) [-1498.556] (-1496.502) (-1501.857) * (-1500.981) (-1499.988) [-1491.709] (-1499.260) -- 0:01:59
      428000 -- [-1498.241] (-1494.436) (-1499.689) (-1492.005) * (-1491.928) (-1495.814) [-1492.456] (-1492.923) -- 0:01:58
      428500 -- (-1490.836) (-1496.916) [-1497.519] (-1491.690) * (-1492.029) (-1497.722) (-1492.886) [-1493.355] -- 0:01:58
      429000 -- (-1492.141) (-1499.085) (-1497.363) [-1495.864] * (-1492.849) (-1492.868) [-1494.094] (-1493.963) -- 0:01:58
      429500 -- (-1500.060) (-1497.341) [-1497.461] (-1502.003) * (-1494.894) [-1496.106] (-1493.743) (-1496.310) -- 0:01:58
      430000 -- (-1497.853) [-1497.060] (-1500.326) (-1496.891) * (-1491.422) (-1499.509) [-1496.439] (-1501.483) -- 0:01:57

      Average standard deviation of split frequencies: 0.001642

      430500 -- (-1496.242) (-1499.896) [-1498.081] (-1501.819) * [-1496.400] (-1505.978) (-1501.240) (-1500.080) -- 0:01:57
      431000 -- (-1495.337) [-1491.873] (-1492.512) (-1502.534) * (-1495.587) (-1499.156) (-1501.445) [-1492.741] -- 0:01:57
      431500 -- (-1493.909) [-1497.744] (-1493.782) (-1502.401) * [-1493.579] (-1488.822) (-1504.514) (-1495.790) -- 0:01:57
      432000 -- (-1501.352) (-1495.752) [-1492.856] (-1498.168) * (-1502.000) (-1499.240) [-1496.724] (-1501.524) -- 0:01:57
      432500 -- (-1494.178) (-1499.425) (-1496.681) [-1492.344] * (-1497.481) (-1502.826) [-1496.833] (-1496.647) -- 0:01:58
      433000 -- (-1497.537) [-1494.703] (-1499.643) (-1492.444) * (-1497.956) [-1499.671] (-1495.209) (-1499.103) -- 0:01:57
      433500 -- (-1504.805) (-1493.236) (-1494.833) [-1494.269] * [-1489.500] (-1508.620) (-1503.144) (-1496.997) -- 0:01:57
      434000 -- (-1497.488) [-1492.550] (-1505.597) (-1491.384) * (-1497.368) [-1491.608] (-1509.127) (-1494.883) -- 0:01:57
      434500 -- (-1490.876) (-1491.104) (-1497.891) [-1496.944] * (-1492.895) (-1494.247) (-1506.899) [-1499.230] -- 0:01:57
      435000 -- (-1505.790) (-1502.772) (-1493.387) [-1495.039] * [-1493.677] (-1498.239) (-1500.122) (-1499.151) -- 0:01:56

      Average standard deviation of split frequencies: 0.001081

      435500 -- [-1494.324] (-1497.020) (-1499.697) (-1491.084) * (-1497.902) [-1494.702] (-1496.994) (-1504.529) -- 0:01:56
      436000 -- (-1499.731) (-1498.819) (-1503.617) [-1496.698] * (-1494.598) (-1494.062) (-1494.382) [-1496.314] -- 0:01:56
      436500 -- (-1493.769) (-1496.479) [-1494.063] (-1494.272) * (-1497.134) [-1498.286] (-1503.641) (-1497.664) -- 0:01:56
      437000 -- (-1492.453) (-1495.633) (-1492.701) [-1491.239] * (-1496.024) (-1498.973) (-1495.925) [-1499.255] -- 0:01:57
      437500 -- (-1501.031) (-1503.995) [-1499.427] (-1495.472) * [-1495.023] (-1493.315) (-1497.532) (-1497.273) -- 0:01:56
      438000 -- (-1494.514) [-1498.449] (-1491.021) (-1493.255) * (-1502.583) (-1501.688) (-1494.566) [-1496.437] -- 0:01:56
      438500 -- (-1497.378) (-1497.384) [-1492.114] (-1498.119) * [-1500.721] (-1504.238) (-1493.120) (-1495.470) -- 0:01:56
      439000 -- (-1498.736) (-1491.989) (-1495.279) [-1499.495] * [-1494.906] (-1504.444) (-1494.367) (-1496.732) -- 0:01:56
      439500 -- (-1494.847) [-1492.704] (-1500.795) (-1504.635) * (-1495.964) [-1493.396] (-1496.654) (-1494.954) -- 0:01:56
      440000 -- [-1495.418] (-1497.913) (-1496.829) (-1502.422) * (-1497.064) (-1489.545) [-1497.109] (-1491.088) -- 0:01:55

      Average standard deviation of split frequencies: 0.000535

      440500 -- (-1497.236) (-1499.422) (-1494.134) [-1497.217] * (-1500.842) (-1492.823) (-1495.114) [-1496.416] -- 0:01:55
      441000 -- (-1502.784) (-1500.009) (-1499.787) [-1493.610] * (-1496.222) [-1493.488] (-1495.913) (-1497.709) -- 0:01:55
      441500 -- (-1498.107) [-1494.691] (-1497.171) (-1493.148) * (-1497.102) (-1494.433) [-1492.447] (-1494.634) -- 0:01:55
      442000 -- (-1503.024) (-1498.489) (-1492.633) [-1493.010] * (-1498.631) [-1495.236] (-1496.696) (-1497.751) -- 0:01:56
      442500 -- [-1499.011] (-1499.769) (-1491.834) (-1495.918) * (-1495.524) [-1493.798] (-1494.573) (-1492.891) -- 0:01:55
      443000 -- (-1494.906) (-1497.949) (-1502.814) [-1492.986] * (-1495.252) (-1494.798) (-1493.470) [-1492.172] -- 0:01:55
      443500 -- (-1495.706) [-1495.178] (-1496.309) (-1496.348) * [-1491.059] (-1498.168) (-1499.051) (-1508.760) -- 0:01:55
      444000 -- (-1502.088) (-1494.372) [-1491.418] (-1491.373) * (-1495.256) (-1495.905) (-1499.344) [-1495.793] -- 0:01:55
      444500 -- (-1502.980) (-1498.392) (-1491.926) [-1493.772] * [-1493.383] (-1494.731) (-1505.295) (-1495.637) -- 0:01:54
      445000 -- (-1503.493) (-1496.358) (-1504.545) [-1494.855] * (-1496.016) [-1489.987] (-1503.109) (-1500.569) -- 0:01:54

      Average standard deviation of split frequencies: 0.000528

      445500 -- (-1498.990) (-1494.613) [-1494.182] (-1500.341) * (-1506.718) (-1498.470) [-1494.295] (-1493.025) -- 0:01:54
      446000 -- (-1497.589) (-1496.775) (-1497.248) [-1497.831] * (-1508.398) [-1493.350] (-1493.852) (-1492.757) -- 0:01:54
      446500 -- (-1494.242) (-1499.508) (-1495.344) [-1494.158] * [-1495.960] (-1498.126) (-1490.725) (-1497.653) -- 0:01:54
      447000 -- (-1501.403) [-1502.971] (-1501.966) (-1497.953) * (-1505.748) (-1497.040) (-1495.337) [-1500.503] -- 0:01:55
      447500 -- (-1497.292) (-1496.104) [-1501.916] (-1493.829) * (-1503.711) (-1500.875) (-1495.930) [-1498.273] -- 0:01:54
      448000 -- (-1499.096) [-1493.994] (-1497.269) (-1491.841) * (-1498.495) (-1496.030) (-1490.990) [-1499.249] -- 0:01:54
      448500 -- (-1493.280) (-1496.729) (-1510.561) [-1490.996] * (-1496.889) [-1495.422] (-1495.830) (-1501.126) -- 0:01:54
      449000 -- [-1489.525] (-1494.027) (-1501.785) (-1493.465) * (-1491.825) (-1497.567) [-1490.734] (-1495.379) -- 0:01:54
      449500 -- (-1499.519) [-1497.479] (-1494.293) (-1496.488) * (-1497.434) [-1492.391] (-1499.218) (-1496.134) -- 0:01:53
      450000 -- (-1504.796) (-1511.916) (-1494.213) [-1494.440] * (-1497.231) [-1494.597] (-1495.398) (-1494.459) -- 0:01:53

      Average standard deviation of split frequencies: 0.000523

      450500 -- (-1498.640) [-1500.086] (-1500.938) (-1498.598) * (-1494.309) (-1494.739) [-1496.734] (-1496.603) -- 0:01:53
      451000 -- (-1494.774) (-1497.833) [-1491.240] (-1495.320) * [-1488.471] (-1496.452) (-1495.135) (-1496.022) -- 0:01:53
      451500 -- [-1489.056] (-1496.932) (-1492.847) (-1496.655) * (-1497.052) [-1498.005] (-1495.194) (-1496.771) -- 0:01:54
      452000 -- (-1500.974) (-1498.138) (-1505.541) [-1508.409] * (-1497.715) (-1501.332) [-1498.469] (-1497.398) -- 0:01:53
      452500 -- [-1489.353] (-1493.688) (-1492.212) (-1496.978) * [-1492.215] (-1503.601) (-1491.923) (-1491.228) -- 0:01:53
      453000 -- (-1497.369) [-1493.641] (-1501.572) (-1502.612) * [-1491.755] (-1501.513) (-1499.083) (-1494.467) -- 0:01:53
      453500 -- (-1494.999) (-1493.069) [-1495.527] (-1497.424) * (-1494.730) (-1494.693) (-1502.171) [-1496.615] -- 0:01:53
      454000 -- (-1492.334) [-1494.672] (-1501.477) (-1500.865) * [-1494.059] (-1496.066) (-1494.573) (-1492.656) -- 0:01:53
      454500 -- (-1499.914) (-1495.825) [-1496.584] (-1506.825) * (-1500.106) [-1497.159] (-1496.391) (-1496.152) -- 0:01:52
      455000 -- [-1495.362] (-1496.804) (-1499.332) (-1500.272) * (-1503.777) (-1498.088) (-1499.429) [-1492.859] -- 0:01:52

      Average standard deviation of split frequencies: 0.000517

      455500 -- [-1495.469] (-1496.459) (-1494.285) (-1501.011) * (-1499.687) (-1497.374) [-1495.218] (-1496.176) -- 0:01:52
      456000 -- [-1502.120] (-1503.398) (-1503.213) (-1496.343) * (-1491.836) (-1497.417) [-1495.279] (-1505.563) -- 0:01:52
      456500 -- (-1492.919) (-1497.215) [-1495.900] (-1496.877) * (-1493.647) [-1496.302] (-1494.150) (-1493.458) -- 0:01:53
      457000 -- (-1495.559) [-1498.351] (-1497.959) (-1503.138) * (-1496.828) (-1495.451) [-1500.955] (-1496.029) -- 0:01:52
      457500 -- (-1492.585) (-1490.708) (-1496.263) [-1499.960] * (-1499.966) [-1497.103] (-1495.261) (-1496.028) -- 0:01:52
      458000 -- (-1493.362) (-1500.886) (-1494.877) [-1493.937] * [-1490.695] (-1492.908) (-1492.742) (-1496.614) -- 0:01:52
      458500 -- (-1496.930) [-1498.450] (-1494.907) (-1494.655) * (-1501.400) (-1492.499) [-1503.575] (-1504.068) -- 0:01:52
      459000 -- (-1488.879) (-1497.672) (-1494.742) [-1493.427] * (-1507.102) (-1497.000) (-1494.083) [-1499.245] -- 0:01:51
      459500 -- [-1498.614] (-1494.358) (-1498.701) (-1496.367) * (-1499.769) [-1493.668] (-1491.473) (-1498.139) -- 0:01:51
      460000 -- (-1495.441) (-1495.491) (-1494.874) [-1496.212] * [-1495.079] (-1493.847) (-1492.160) (-1497.783) -- 0:01:51

      Average standard deviation of split frequencies: 0.000512

      460500 -- (-1496.550) (-1492.515) [-1491.934] (-1493.270) * (-1499.107) (-1493.225) (-1496.994) [-1497.492] -- 0:01:51
      461000 -- (-1496.254) [-1492.530] (-1491.747) (-1503.183) * [-1495.638] (-1496.118) (-1492.819) (-1495.448) -- 0:01:51
      461500 -- (-1496.693) (-1497.138) (-1498.931) [-1498.368] * (-1498.636) [-1495.930] (-1494.530) (-1498.422) -- 0:01:52
      462000 -- (-1501.574) (-1495.699) [-1499.182] (-1495.946) * (-1505.045) (-1496.603) [-1490.707] (-1494.815) -- 0:01:51
      462500 -- (-1495.050) (-1499.922) (-1496.935) [-1497.917] * (-1496.882) (-1495.224) (-1497.533) [-1500.359] -- 0:01:51
      463000 -- (-1505.306) (-1497.250) [-1499.953] (-1496.926) * [-1493.876] (-1492.841) (-1495.812) (-1498.023) -- 0:01:51
      463500 -- (-1498.601) (-1500.156) (-1495.793) [-1498.604] * (-1497.355) (-1496.917) (-1492.408) [-1497.623] -- 0:01:51
      464000 -- [-1493.232] (-1499.579) (-1502.850) (-1502.075) * [-1496.207] (-1498.988) (-1505.154) (-1497.274) -- 0:01:50
      464500 -- (-1493.848) [-1493.949] (-1501.521) (-1495.051) * [-1494.590] (-1494.459) (-1496.915) (-1504.634) -- 0:01:50
      465000 -- (-1508.978) [-1497.822] (-1496.327) (-1494.980) * (-1496.235) [-1493.767] (-1504.608) (-1500.697) -- 0:01:50

      Average standard deviation of split frequencies: 0.000506

      465500 -- (-1493.267) (-1493.692) [-1498.913] (-1493.949) * (-1499.562) [-1488.535] (-1499.606) (-1493.042) -- 0:01:50
      466000 -- (-1504.578) [-1496.006] (-1497.667) (-1495.301) * (-1496.953) [-1492.325] (-1492.604) (-1492.598) -- 0:01:51
      466500 -- (-1502.495) (-1501.735) (-1492.428) [-1493.024] * [-1496.310] (-1507.177) (-1496.994) (-1498.740) -- 0:01:50
      467000 -- (-1495.970) (-1502.021) [-1498.057] (-1498.581) * (-1501.253) (-1506.950) [-1501.524] (-1489.866) -- 0:01:50
      467500 -- (-1499.742) (-1497.815) (-1493.417) [-1493.582] * (-1499.003) (-1497.452) (-1499.246) [-1489.843] -- 0:01:50
      468000 -- [-1496.858] (-1497.558) (-1494.758) (-1496.520) * (-1500.006) [-1494.019] (-1499.053) (-1494.225) -- 0:01:50
      468500 -- (-1496.691) [-1498.338] (-1492.002) (-1501.375) * (-1505.265) (-1494.467) (-1501.587) [-1502.137] -- 0:01:50
      469000 -- [-1493.408] (-1502.336) (-1493.803) (-1501.326) * (-1499.627) (-1501.751) (-1498.188) [-1501.864] -- 0:01:49
      469500 -- (-1493.416) [-1493.998] (-1493.409) (-1498.247) * (-1504.396) [-1493.167] (-1492.047) (-1496.329) -- 0:01:49
      470000 -- [-1500.284] (-1498.031) (-1496.106) (-1494.777) * (-1498.419) (-1500.095) (-1501.106) [-1499.065] -- 0:01:49

      Average standard deviation of split frequencies: 0.000501

      470500 -- (-1505.505) [-1499.197] (-1494.452) (-1496.394) * (-1501.088) (-1500.211) [-1492.146] (-1494.186) -- 0:01:49
      471000 -- (-1500.196) (-1496.556) (-1498.157) [-1493.912] * (-1496.716) (-1497.703) [-1499.075] (-1493.465) -- 0:01:50
      471500 -- [-1491.941] (-1491.804) (-1493.624) (-1493.865) * (-1495.301) (-1493.703) [-1496.432] (-1495.048) -- 0:01:49
      472000 -- (-1492.988) [-1493.278] (-1492.230) (-1494.088) * (-1496.598) (-1497.968) (-1497.908) [-1493.482] -- 0:01:49
      472500 -- [-1492.552] (-1502.812) (-1491.763) (-1491.352) * [-1492.331] (-1497.432) (-1497.557) (-1492.878) -- 0:01:49
      473000 -- [-1494.829] (-1491.961) (-1498.456) (-1496.200) * [-1498.380] (-1499.428) (-1494.771) (-1497.607) -- 0:01:49
      473500 -- [-1493.288] (-1492.851) (-1504.003) (-1494.923) * (-1501.177) (-1498.387) (-1494.049) [-1494.196] -- 0:01:48
      474000 -- (-1495.123) (-1499.941) [-1502.912] (-1493.135) * [-1502.372] (-1493.769) (-1496.960) (-1496.754) -- 0:01:48
      474500 -- [-1500.960] (-1505.149) (-1492.134) (-1496.611) * [-1491.990] (-1501.721) (-1496.123) (-1493.610) -- 0:01:48
      475000 -- [-1499.793] (-1500.451) (-1504.556) (-1497.972) * (-1497.352) (-1505.379) [-1495.224] (-1500.106) -- 0:01:48

      Average standard deviation of split frequencies: 0.000495

      475500 -- (-1496.150) [-1494.186] (-1506.706) (-1495.715) * [-1498.007] (-1495.866) (-1493.310) (-1503.477) -- 0:01:48
      476000 -- (-1490.906) (-1498.267) (-1495.244) [-1500.848] * (-1502.284) (-1498.476) [-1494.568] (-1498.504) -- 0:01:48
      476500 -- (-1496.577) (-1494.416) (-1501.445) [-1497.824] * [-1496.320] (-1489.733) (-1495.831) (-1503.691) -- 0:01:48
      477000 -- [-1493.239] (-1497.475) (-1495.391) (-1504.307) * [-1497.161] (-1493.834) (-1497.792) (-1499.231) -- 0:01:48
      477500 -- (-1494.284) (-1496.027) [-1495.109] (-1496.072) * (-1492.996) (-1491.973) (-1495.414) [-1494.465] -- 0:01:48
      478000 -- [-1501.591] (-1497.421) (-1501.019) (-1498.058) * (-1497.506) [-1499.654] (-1494.034) (-1491.240) -- 0:01:48
      478500 -- (-1499.846) [-1494.193] (-1502.306) (-1499.973) * (-1492.987) [-1493.492] (-1500.166) (-1495.759) -- 0:01:47
      479000 -- (-1490.276) (-1493.565) [-1497.189] (-1495.066) * (-1495.934) [-1499.976] (-1502.389) (-1502.915) -- 0:01:47
      479500 -- (-1502.032) (-1497.135) [-1493.390] (-1494.890) * [-1495.317] (-1493.898) (-1501.118) (-1495.643) -- 0:01:47
      480000 -- (-1498.974) (-1494.358) (-1503.539) [-1494.194] * (-1494.025) (-1498.170) (-1498.106) [-1490.835] -- 0:01:47

      Average standard deviation of split frequencies: 0.000490

      480500 -- (-1496.796) [-1493.842] (-1492.769) (-1497.107) * (-1496.185) (-1493.883) (-1499.690) [-1492.026] -- 0:01:48
      481000 -- (-1498.703) [-1502.159] (-1493.947) (-1500.408) * (-1496.786) [-1493.857] (-1499.061) (-1505.511) -- 0:01:47
      481500 -- [-1494.854] (-1497.324) (-1494.960) (-1498.995) * (-1491.539) [-1499.761] (-1491.302) (-1494.386) -- 0:01:47
      482000 -- (-1496.282) [-1495.183] (-1494.372) (-1505.053) * [-1493.301] (-1494.107) (-1494.749) (-1496.944) -- 0:01:47
      482500 -- [-1492.870] (-1495.835) (-1491.035) (-1501.511) * (-1494.920) (-1493.200) (-1501.206) [-1492.902] -- 0:01:47
      483000 -- [-1495.789] (-1493.540) (-1493.681) (-1496.183) * [-1498.125] (-1499.122) (-1491.999) (-1503.475) -- 0:01:47
      483500 -- (-1501.465) (-1496.055) [-1495.971] (-1495.099) * (-1494.689) [-1493.495] (-1495.656) (-1498.622) -- 0:01:46
      484000 -- (-1502.564) [-1496.138] (-1497.041) (-1498.734) * (-1498.988) (-1500.135) [-1494.438] (-1498.282) -- 0:01:46
      484500 -- [-1498.383] (-1498.870) (-1493.435) (-1494.714) * (-1496.032) [-1492.893] (-1492.088) (-1500.927) -- 0:01:46
      485000 -- (-1496.150) (-1499.075) [-1495.958] (-1499.548) * (-1489.213) (-1495.030) [-1495.144] (-1506.543) -- 0:01:46

      Average standard deviation of split frequencies: 0.000485

      485500 -- (-1496.319) (-1491.638) [-1495.093] (-1499.583) * (-1497.754) (-1503.086) [-1494.849] (-1494.448) -- 0:01:47
      486000 -- (-1502.268) [-1499.689] (-1492.212) (-1492.095) * (-1491.607) (-1497.576) [-1494.120] (-1505.142) -- 0:01:46
      486500 -- (-1497.801) (-1500.079) (-1492.412) [-1493.523] * [-1500.290] (-1493.121) (-1500.726) (-1501.328) -- 0:01:46
      487000 -- [-1493.609] (-1493.242) (-1496.422) (-1501.519) * (-1493.969) (-1495.821) [-1500.001] (-1505.020) -- 0:01:46
      487500 -- (-1497.886) (-1503.488) (-1500.785) [-1497.463] * (-1493.609) (-1501.942) [-1496.407] (-1501.541) -- 0:01:46
      488000 -- (-1503.472) (-1494.778) (-1505.166) [-1497.161] * [-1501.526] (-1497.202) (-1497.978) (-1498.807) -- 0:01:45
      488500 -- [-1495.551] (-1497.696) (-1497.251) (-1496.697) * [-1495.193] (-1494.697) (-1505.280) (-1502.302) -- 0:01:45
      489000 -- (-1497.312) (-1494.744) (-1496.587) [-1490.913] * (-1495.675) [-1493.442] (-1497.169) (-1506.311) -- 0:01:45
      489500 -- (-1497.722) [-1492.922] (-1497.008) (-1498.562) * (-1495.492) (-1503.078) [-1498.638] (-1499.703) -- 0:01:45
      490000 -- (-1498.019) [-1492.945] (-1498.351) (-1497.869) * [-1500.426] (-1495.325) (-1503.814) (-1497.907) -- 0:01:45

      Average standard deviation of split frequencies: 0.000480

      490500 -- [-1491.685] (-1498.356) (-1492.576) (-1493.830) * (-1494.472) [-1491.382] (-1503.642) (-1499.818) -- 0:01:45
      491000 -- (-1496.481) (-1497.089) (-1503.196) [-1499.035] * [-1494.918] (-1499.231) (-1497.433) (-1497.715) -- 0:01:45
      491500 -- (-1497.693) [-1497.516] (-1496.004) (-1507.225) * (-1495.264) (-1502.092) [-1495.191] (-1507.280) -- 0:01:45
      492000 -- [-1500.522] (-1492.527) (-1498.076) (-1503.829) * (-1496.268) [-1498.183] (-1498.122) (-1497.563) -- 0:01:45
      492500 -- (-1502.523) [-1492.252] (-1496.825) (-1495.626) * (-1499.867) (-1503.681) [-1492.989] (-1498.280) -- 0:01:45
      493000 -- (-1497.226) (-1499.195) (-1494.017) [-1499.558] * (-1495.724) [-1498.748] (-1493.774) (-1499.738) -- 0:01:44
      493500 -- (-1498.027) (-1496.063) (-1502.193) [-1496.729] * [-1494.679] (-1498.976) (-1490.800) (-1496.253) -- 0:01:44
      494000 -- (-1507.933) (-1494.749) [-1493.871] (-1496.318) * (-1506.859) [-1495.777] (-1496.812) (-1490.070) -- 0:01:44
      494500 -- (-1495.434) [-1490.049] (-1495.605) (-1493.592) * (-1500.716) (-1497.629) [-1491.573] (-1502.476) -- 0:01:44
      495000 -- (-1495.955) (-1494.291) [-1493.521] (-1499.720) * (-1502.276) (-1496.817) [-1494.472] (-1505.138) -- 0:01:45

      Average standard deviation of split frequencies: 0.000475

      495500 -- (-1493.411) (-1498.830) [-1492.490] (-1506.060) * (-1508.486) (-1493.626) [-1493.203] (-1497.924) -- 0:01:44
      496000 -- (-1506.590) [-1491.547] (-1494.325) (-1497.111) * (-1506.843) [-1503.733] (-1492.329) (-1494.662) -- 0:01:44
      496500 -- (-1500.807) [-1498.757] (-1495.372) (-1492.620) * (-1493.091) (-1495.979) (-1499.374) [-1500.805] -- 0:01:44
      497000 -- (-1496.575) (-1495.940) [-1495.959] (-1496.824) * (-1495.052) [-1493.743] (-1494.940) (-1499.121) -- 0:01:44
      497500 -- [-1492.194] (-1497.009) (-1495.909) (-1495.392) * (-1498.393) [-1495.588] (-1501.112) (-1501.734) -- 0:01:44
      498000 -- (-1496.223) (-1493.238) [-1497.173] (-1494.322) * (-1509.826) (-1494.223) (-1496.124) [-1497.858] -- 0:01:43
      498500 -- (-1494.475) (-1499.232) [-1493.391] (-1494.817) * (-1498.121) (-1496.379) (-1489.785) [-1494.580] -- 0:01:43
      499000 -- (-1506.558) (-1493.230) (-1499.711) [-1495.054] * (-1497.034) (-1500.514) [-1493.355] (-1496.418) -- 0:01:43
      499500 -- (-1503.075) [-1495.294] (-1495.619) (-1500.657) * [-1489.516] (-1497.297) (-1500.114) (-1496.752) -- 0:01:43
      500000 -- [-1494.132] (-1494.751) (-1500.366) (-1488.183) * (-1495.771) (-1493.490) [-1496.699] (-1500.229) -- 0:01:44

      Average standard deviation of split frequencies: 0.000471

      500500 -- [-1495.202] (-1491.572) (-1496.340) (-1490.884) * (-1494.020) (-1493.136) [-1492.448] (-1495.784) -- 0:01:43
      501000 -- (-1493.437) (-1492.561) [-1491.724] (-1493.173) * (-1493.899) (-1503.236) [-1500.268] (-1493.314) -- 0:01:43
      501500 -- (-1495.834) (-1503.234) [-1495.851] (-1497.111) * (-1504.109) (-1492.376) [-1491.374] (-1496.164) -- 0:01:43
      502000 -- (-1493.873) [-1497.805] (-1501.563) (-1493.657) * [-1490.888] (-1489.700) (-1496.932) (-1498.284) -- 0:01:43
      502500 -- (-1496.190) [-1496.298] (-1495.180) (-1492.022) * [-1501.166] (-1494.966) (-1500.267) (-1498.573) -- 0:01:42
      503000 -- (-1493.018) (-1493.785) [-1494.093] (-1496.123) * [-1495.526] (-1493.650) (-1494.498) (-1499.106) -- 0:01:42
      503500 -- (-1501.113) (-1493.339) (-1504.749) [-1493.519] * (-1501.039) (-1502.990) (-1495.007) [-1496.614] -- 0:01:42
      504000 -- (-1495.785) (-1495.910) (-1501.933) [-1491.056] * (-1501.430) [-1501.914] (-1495.617) (-1494.720) -- 0:01:42
      504500 -- (-1497.263) (-1494.531) (-1495.865) [-1497.697] * [-1497.768] (-1498.996) (-1493.936) (-1498.418) -- 0:01:42
      505000 -- (-1500.961) (-1494.275) [-1495.783] (-1491.969) * (-1493.268) (-1501.214) (-1498.795) [-1495.120] -- 0:01:42

      Average standard deviation of split frequencies: 0.000932

      505500 -- (-1503.510) [-1496.154] (-1493.573) (-1495.529) * [-1492.703] (-1507.206) (-1498.641) (-1498.077) -- 0:01:42
      506000 -- (-1495.232) (-1491.710) [-1498.182] (-1491.981) * (-1496.599) [-1502.647] (-1503.370) (-1498.516) -- 0:01:42
      506500 -- (-1495.193) [-1489.647] (-1496.070) (-1490.818) * [-1495.274] (-1499.033) (-1500.447) (-1499.279) -- 0:01:42
      507000 -- [-1506.170] (-1494.837) (-1503.440) (-1491.323) * [-1496.814] (-1497.799) (-1507.565) (-1507.248) -- 0:01:42
      507500 -- [-1491.842] (-1491.185) (-1495.924) (-1505.633) * (-1498.374) [-1496.554] (-1497.861) (-1508.113) -- 0:01:41
      508000 -- [-1493.960] (-1494.934) (-1496.436) (-1496.851) * [-1495.891] (-1493.771) (-1500.331) (-1503.217) -- 0:01:41
      508500 -- (-1494.490) [-1490.518] (-1494.480) (-1497.976) * (-1504.333) [-1493.429] (-1496.632) (-1506.925) -- 0:01:41
      509000 -- (-1492.856) [-1496.095] (-1491.577) (-1494.890) * (-1495.037) [-1492.146] (-1499.613) (-1502.897) -- 0:01:41
      509500 -- (-1497.663) (-1492.680) [-1495.401] (-1491.547) * [-1499.693] (-1493.474) (-1502.811) (-1498.818) -- 0:01:42
      510000 -- (-1498.248) (-1503.685) [-1493.807] (-1496.316) * (-1504.605) [-1499.002] (-1496.559) (-1503.089) -- 0:01:41

      Average standard deviation of split frequencies: 0.000923

      510500 -- (-1493.085) (-1504.341) [-1495.339] (-1503.448) * [-1493.990] (-1498.496) (-1499.777) (-1500.938) -- 0:01:41
      511000 -- (-1499.141) (-1493.540) (-1495.212) [-1497.313] * [-1493.899] (-1505.252) (-1496.726) (-1495.046) -- 0:01:41
      511500 -- (-1498.345) [-1493.551] (-1499.932) (-1490.092) * (-1496.292) [-1499.608] (-1493.134) (-1496.534) -- 0:01:41
      512000 -- (-1495.611) (-1493.955) (-1500.968) [-1491.500] * [-1503.867] (-1496.621) (-1494.569) (-1500.196) -- 0:01:41
      512500 -- (-1494.663) [-1491.370] (-1508.931) (-1494.680) * (-1499.046) (-1499.498) [-1497.175] (-1501.646) -- 0:01:40
      513000 -- (-1500.139) (-1494.109) (-1497.542) [-1493.104] * (-1496.408) (-1501.496) [-1494.443] (-1500.822) -- 0:01:40
      513500 -- (-1494.422) [-1494.908] (-1502.103) (-1499.950) * (-1498.954) (-1498.857) (-1494.822) [-1498.260] -- 0:01:40
      514000 -- (-1494.944) (-1500.863) (-1512.643) [-1494.472] * [-1492.154] (-1497.328) (-1492.440) (-1495.602) -- 0:01:40
      514500 -- (-1492.715) [-1494.909] (-1495.808) (-1505.423) * [-1492.895] (-1498.253) (-1506.031) (-1496.548) -- 0:01:40
      515000 -- (-1500.836) (-1496.287) [-1496.041] (-1497.147) * (-1494.641) (-1499.347) (-1500.224) [-1499.179] -- 0:01:40

      Average standard deviation of split frequencies: 0.000914

      515500 -- (-1497.059) (-1497.885) [-1495.641] (-1500.631) * [-1489.493] (-1493.886) (-1499.286) (-1501.378) -- 0:01:40
      516000 -- (-1497.994) (-1499.374) (-1491.962) [-1499.088] * (-1492.741) [-1492.905] (-1494.668) (-1497.618) -- 0:01:40
      516500 -- (-1494.833) (-1496.605) (-1495.935) [-1494.840] * [-1495.338] (-1496.611) (-1498.133) (-1500.007) -- 0:01:40
      517000 -- [-1494.370] (-1497.796) (-1504.224) (-1496.669) * (-1497.159) (-1496.248) [-1502.012] (-1495.572) -- 0:01:39
      517500 -- (-1495.737) (-1506.014) [-1501.196] (-1490.752) * (-1497.647) (-1493.279) (-1494.574) [-1496.654] -- 0:01:39
      518000 -- (-1497.941) (-1500.820) (-1502.503) [-1498.427] * [-1504.561] (-1498.138) (-1498.673) (-1512.024) -- 0:01:39
      518500 -- [-1494.646] (-1494.897) (-1495.492) (-1492.675) * (-1495.540) [-1499.255] (-1501.997) (-1505.080) -- 0:01:39
      519000 -- [-1495.760] (-1495.805) (-1500.592) (-1494.655) * (-1500.906) (-1498.912) (-1496.485) [-1497.632] -- 0:01:39
      519500 -- (-1492.478) (-1496.329) [-1497.502] (-1493.590) * (-1492.065) (-1503.266) [-1492.350] (-1502.590) -- 0:01:39
      520000 -- (-1494.334) [-1503.756] (-1497.370) (-1503.257) * (-1494.835) (-1501.310) [-1494.332] (-1497.187) -- 0:01:39

      Average standard deviation of split frequencies: 0.000905

      520500 -- (-1491.807) (-1505.084) (-1493.950) [-1494.317] * (-1494.021) (-1498.339) [-1493.027] (-1492.176) -- 0:01:39
      521000 -- (-1501.846) (-1495.167) [-1492.834] (-1494.909) * [-1500.788] (-1497.715) (-1494.843) (-1496.481) -- 0:01:39
      521500 -- [-1493.854] (-1494.183) (-1499.111) (-1495.570) * (-1494.822) (-1500.135) [-1491.712] (-1502.257) -- 0:01:39
      522000 -- (-1505.106) (-1503.610) [-1495.764] (-1494.526) * (-1496.966) (-1501.395) [-1493.249] (-1501.151) -- 0:01:38
      522500 -- (-1497.642) (-1494.053) (-1498.771) [-1503.888] * (-1492.596) (-1505.608) [-1492.558] (-1499.798) -- 0:01:38
      523000 -- [-1494.076] (-1498.141) (-1497.340) (-1496.266) * (-1493.703) (-1501.871) (-1493.375) [-1492.575] -- 0:01:38
      523500 -- (-1499.970) (-1497.698) (-1494.646) [-1493.941] * (-1499.628) (-1498.382) [-1496.512] (-1498.734) -- 0:01:38
      524000 -- (-1495.291) [-1492.890] (-1495.763) (-1495.620) * (-1500.730) [-1497.055] (-1495.846) (-1494.526) -- 0:01:38
      524500 -- (-1497.399) (-1495.568) (-1501.185) [-1494.769] * [-1494.005] (-1496.667) (-1498.761) (-1497.661) -- 0:01:38
      525000 -- (-1495.856) (-1492.804) [-1496.381] (-1498.176) * (-1497.590) (-1497.123) [-1499.870] (-1493.826) -- 0:01:38

      Average standard deviation of split frequencies: 0.000896

      525500 -- (-1492.875) (-1499.312) [-1494.992] (-1499.556) * (-1495.697) (-1496.285) [-1494.972] (-1500.530) -- 0:01:38
      526000 -- (-1499.394) (-1491.206) [-1490.734] (-1498.357) * (-1504.812) (-1499.748) (-1494.072) [-1502.243] -- 0:01:38
      526500 -- (-1502.170) (-1494.341) (-1495.986) [-1501.010] * (-1497.441) (-1498.960) (-1495.066) [-1495.570] -- 0:01:38
      527000 -- (-1492.583) [-1496.703] (-1503.930) (-1494.543) * (-1494.148) (-1495.326) [-1502.877] (-1496.559) -- 0:01:37
      527500 -- (-1491.645) [-1495.764] (-1498.423) (-1496.338) * [-1492.276] (-1499.458) (-1502.770) (-1495.430) -- 0:01:37
      528000 -- (-1512.911) (-1500.183) [-1497.453] (-1504.678) * (-1495.568) (-1496.025) [-1492.776] (-1498.986) -- 0:01:37
      528500 -- (-1500.545) (-1491.533) [-1496.322] (-1494.067) * (-1501.454) (-1496.266) [-1493.010] (-1497.016) -- 0:01:37
      529000 -- [-1493.722] (-1489.516) (-1501.650) (-1495.165) * (-1498.194) [-1494.161] (-1494.048) (-1503.006) -- 0:01:37
      529500 -- [-1491.511] (-1495.320) (-1501.610) (-1496.643) * (-1507.349) [-1494.125] (-1498.070) (-1500.659) -- 0:01:37
      530000 -- (-1495.839) (-1495.894) (-1512.988) [-1500.772] * (-1501.800) [-1495.912] (-1498.223) (-1503.252) -- 0:01:37

      Average standard deviation of split frequencies: 0.000888

      530500 -- [-1499.692] (-1501.854) (-1504.852) (-1496.860) * [-1492.438] (-1492.414) (-1497.813) (-1509.488) -- 0:01:37
      531000 -- (-1499.610) [-1498.758] (-1496.925) (-1496.983) * [-1495.283] (-1492.394) (-1493.064) (-1502.049) -- 0:01:37
      531500 -- [-1493.649] (-1495.839) (-1499.252) (-1494.644) * (-1500.359) (-1501.663) [-1499.358] (-1499.434) -- 0:01:36
      532000 -- [-1495.926] (-1489.656) (-1498.761) (-1494.778) * (-1499.289) (-1493.325) (-1495.787) [-1497.119] -- 0:01:36
      532500 -- (-1498.076) [-1495.146] (-1505.346) (-1497.665) * (-1494.046) (-1496.597) [-1496.885] (-1497.749) -- 0:01:36
      533000 -- (-1498.475) [-1494.066] (-1495.457) (-1497.627) * (-1507.641) [-1497.630] (-1499.317) (-1498.152) -- 0:01:36
      533500 -- (-1496.878) (-1496.709) (-1499.272) [-1502.575] * [-1498.595] (-1499.100) (-1491.857) (-1495.250) -- 0:01:36
      534000 -- (-1505.171) [-1492.161] (-1495.304) (-1495.946) * [-1496.916] (-1495.967) (-1494.177) (-1497.879) -- 0:01:36
      534500 -- (-1497.556) (-1503.149) (-1501.807) [-1493.187] * (-1496.252) (-1495.392) (-1503.541) [-1495.979] -- 0:01:36
      535000 -- (-1500.025) (-1503.700) [-1494.210] (-1492.649) * (-1501.813) (-1500.409) (-1492.284) [-1493.318] -- 0:01:36

      Average standard deviation of split frequencies: 0.000879

      535500 -- (-1495.171) (-1497.785) (-1496.710) [-1492.918] * (-1498.618) (-1501.855) (-1501.199) [-1496.408] -- 0:01:36
      536000 -- (-1498.981) [-1498.136] (-1503.087) (-1498.430) * (-1494.895) (-1499.118) (-1497.668) [-1497.618] -- 0:01:36
      536500 -- [-1498.084] (-1498.566) (-1497.673) (-1508.451) * (-1495.091) (-1495.120) (-1499.986) [-1494.277] -- 0:01:35
      537000 -- (-1496.992) [-1494.221] (-1492.980) (-1500.221) * [-1497.519] (-1500.690) (-1499.166) (-1494.396) -- 0:01:35
      537500 -- (-1500.391) (-1492.223) [-1491.326] (-1504.121) * [-1492.487] (-1494.696) (-1497.748) (-1505.804) -- 0:01:35
      538000 -- (-1502.974) (-1492.176) [-1491.085] (-1500.382) * (-1491.046) (-1497.492) (-1501.719) [-1502.930] -- 0:01:35
      538500 -- (-1504.154) [-1495.695] (-1494.359) (-1499.314) * (-1492.411) (-1496.130) [-1499.895] (-1499.719) -- 0:01:35
      539000 -- [-1500.958] (-1501.076) (-1497.915) (-1497.827) * (-1495.060) [-1494.994] (-1497.293) (-1498.676) -- 0:01:35
      539500 -- (-1501.073) (-1499.676) (-1496.384) [-1497.458] * [-1495.755] (-1495.636) (-1498.483) (-1506.054) -- 0:01:35
      540000 -- [-1496.630] (-1502.422) (-1497.527) (-1504.967) * [-1494.396] (-1497.930) (-1497.959) (-1504.545) -- 0:01:35

      Average standard deviation of split frequencies: 0.000872

      540500 -- (-1492.974) (-1504.404) (-1501.998) [-1496.601] * [-1490.829] (-1504.116) (-1488.653) (-1495.883) -- 0:01:35
      541000 -- (-1500.191) (-1502.763) [-1498.257] (-1500.498) * (-1494.949) (-1505.511) [-1496.982] (-1507.063) -- 0:01:35
      541500 -- (-1493.354) (-1501.152) [-1498.356] (-1493.828) * [-1501.819] (-1496.170) (-1499.162) (-1494.136) -- 0:01:34
      542000 -- (-1495.174) (-1492.659) (-1496.684) [-1492.207] * (-1501.771) [-1496.029] (-1497.723) (-1489.890) -- 0:01:34
      542500 -- (-1499.962) [-1489.826] (-1497.989) (-1494.503) * [-1492.574] (-1499.079) (-1509.656) (-1494.007) -- 0:01:34
      543000 -- (-1499.972) [-1492.821] (-1498.805) (-1497.608) * (-1494.571) (-1494.555) (-1500.535) [-1496.005] -- 0:01:34
      543500 -- (-1499.936) (-1492.627) (-1497.243) [-1494.453] * [-1497.567] (-1492.331) (-1496.927) (-1495.868) -- 0:01:34
      544000 -- [-1493.066] (-1494.402) (-1495.402) (-1500.116) * (-1497.604) [-1495.664] (-1498.476) (-1496.199) -- 0:01:34
      544500 -- (-1493.623) (-1499.166) (-1491.750) [-1497.546] * [-1494.993] (-1501.216) (-1500.302) (-1501.332) -- 0:01:34
      545000 -- (-1500.153) (-1492.015) [-1494.106] (-1493.973) * (-1493.484) (-1496.246) (-1501.532) [-1494.463] -- 0:01:34

      Average standard deviation of split frequencies: 0.000863

      545500 -- (-1495.293) [-1497.065] (-1496.643) (-1495.410) * [-1495.682] (-1502.465) (-1493.582) (-1497.487) -- 0:01:34
      546000 -- (-1497.384) (-1498.696) (-1493.332) [-1498.165] * (-1490.545) (-1496.880) [-1496.869] (-1499.839) -- 0:01:33
      546500 -- (-1504.698) [-1500.215] (-1498.100) (-1500.154) * [-1494.664] (-1501.293) (-1498.983) (-1491.861) -- 0:01:33
      547000 -- (-1498.670) (-1495.973) [-1490.565] (-1502.909) * [-1495.641] (-1497.224) (-1489.013) (-1489.683) -- 0:01:33
      547500 -- (-1500.712) [-1495.476] (-1501.372) (-1494.168) * (-1499.664) (-1493.355) (-1494.456) [-1499.533] -- 0:01:33
      548000 -- [-1495.434] (-1495.529) (-1500.078) (-1493.521) * (-1499.438) (-1494.078) (-1498.527) [-1490.497] -- 0:01:33
      548500 -- (-1491.623) (-1495.661) (-1495.617) [-1497.149] * (-1500.194) [-1494.395] (-1489.541) (-1496.378) -- 0:01:33
      549000 -- (-1491.315) (-1492.841) (-1494.577) [-1491.916] * (-1497.882) (-1498.016) [-1492.785] (-1498.368) -- 0:01:33
      549500 -- [-1494.301] (-1496.030) (-1493.674) (-1493.089) * (-1495.901) (-1495.127) [-1495.003] (-1499.894) -- 0:01:33
      550000 -- (-1494.754) (-1493.147) (-1494.668) [-1492.827] * (-1499.045) (-1499.582) [-1492.964] (-1496.234) -- 0:01:33

      Average standard deviation of split frequencies: 0.000856

      550500 -- (-1496.398) (-1500.756) (-1493.459) [-1493.287] * (-1501.002) [-1491.678] (-1493.211) (-1497.918) -- 0:01:33
      551000 -- (-1497.386) (-1499.497) (-1496.836) [-1498.310] * (-1494.868) (-1494.664) (-1496.275) [-1494.726] -- 0:01:32
      551500 -- (-1500.423) (-1494.726) [-1503.681] (-1495.588) * (-1494.931) (-1503.282) [-1497.716] (-1495.560) -- 0:01:32
      552000 -- (-1494.267) [-1498.099] (-1498.228) (-1496.164) * (-1495.670) (-1494.317) (-1492.245) [-1497.585] -- 0:01:32
      552500 -- (-1494.907) (-1497.562) [-1498.991] (-1498.323) * (-1500.384) (-1491.601) [-1496.021] (-1492.606) -- 0:01:32
      553000 -- (-1495.639) (-1490.028) [-1492.384] (-1501.409) * (-1493.368) (-1506.178) [-1496.703] (-1494.667) -- 0:01:32
      553500 -- (-1499.203) [-1491.647] (-1494.268) (-1494.185) * (-1495.745) (-1493.950) [-1497.093] (-1491.157) -- 0:01:32
      554000 -- (-1497.565) (-1496.672) [-1494.544] (-1498.867) * (-1502.025) [-1499.012] (-1498.804) (-1494.137) -- 0:01:32
      554500 -- (-1499.469) (-1494.183) (-1490.826) [-1494.466] * [-1492.626] (-1494.528) (-1495.147) (-1491.007) -- 0:01:32
      555000 -- (-1505.083) [-1494.045] (-1498.743) (-1496.183) * [-1490.262] (-1496.789) (-1490.728) (-1491.119) -- 0:01:32

      Average standard deviation of split frequencies: 0.000848

      555500 -- [-1498.647] (-1493.363) (-1496.073) (-1497.657) * (-1494.362) [-1497.035] (-1502.164) (-1494.362) -- 0:01:32
      556000 -- (-1497.856) (-1496.820) (-1495.077) [-1495.873] * (-1494.075) (-1499.152) (-1497.246) [-1492.533] -- 0:01:31
      556500 -- [-1496.943] (-1498.976) (-1497.438) (-1504.447) * (-1497.011) (-1495.077) [-1496.682] (-1494.574) -- 0:01:31
      557000 -- [-1494.671] (-1501.842) (-1490.767) (-1500.622) * (-1499.637) (-1511.111) [-1493.368] (-1501.358) -- 0:01:31
      557500 -- (-1494.372) (-1499.236) [-1491.644] (-1503.413) * (-1498.708) (-1500.295) [-1491.328] (-1504.522) -- 0:01:31
      558000 -- [-1494.648] (-1497.400) (-1496.260) (-1495.151) * (-1505.007) (-1496.226) (-1499.669) [-1494.763] -- 0:01:31
      558500 -- (-1493.991) (-1492.155) (-1491.518) [-1497.568] * (-1498.737) [-1501.398] (-1496.275) (-1502.373) -- 0:01:31
      559000 -- (-1494.527) (-1492.319) [-1496.369] (-1501.774) * [-1501.360] (-1501.943) (-1493.448) (-1494.911) -- 0:01:31
      559500 -- (-1494.381) (-1491.968) (-1493.220) [-1505.218] * (-1495.970) (-1492.820) [-1495.091] (-1492.017) -- 0:01:31
      560000 -- (-1501.274) (-1497.913) [-1496.802] (-1507.721) * (-1503.071) [-1501.650] (-1493.338) (-1503.023) -- 0:01:31

      Average standard deviation of split frequencies: 0.000841

      560500 -- (-1496.453) (-1504.571) (-1500.580) [-1493.740] * (-1498.263) (-1496.123) (-1507.591) [-1497.789] -- 0:01:30
      561000 -- [-1498.114] (-1502.202) (-1492.869) (-1494.482) * (-1502.408) [-1498.689] (-1502.442) (-1492.029) -- 0:01:30
      561500 -- [-1493.462] (-1500.367) (-1495.673) (-1494.472) * (-1503.594) (-1496.930) (-1501.158) [-1491.373] -- 0:01:30
      562000 -- [-1497.233] (-1500.660) (-1496.930) (-1510.849) * (-1499.319) [-1498.300] (-1496.975) (-1494.063) -- 0:01:30
      562500 -- (-1492.807) [-1501.143] (-1497.043) (-1497.198) * (-1495.187) (-1499.105) (-1496.735) [-1489.527] -- 0:01:30
      563000 -- (-1496.025) (-1495.035) (-1494.179) [-1500.769] * (-1493.251) (-1496.068) [-1497.439] (-1495.255) -- 0:01:30
      563500 -- (-1500.075) (-1494.631) (-1498.259) [-1496.018] * (-1496.818) [-1491.284] (-1508.079) (-1491.925) -- 0:01:30
      564000 -- (-1495.343) (-1497.491) [-1495.754] (-1502.464) * (-1491.416) [-1496.917] (-1500.482) (-1502.257) -- 0:01:30
      564500 -- (-1497.049) [-1499.482] (-1495.901) (-1501.956) * (-1494.794) (-1497.046) (-1502.965) [-1493.503] -- 0:01:30
      565000 -- (-1493.109) (-1496.064) (-1492.805) [-1490.546] * (-1498.740) (-1496.353) (-1504.916) [-1493.975] -- 0:01:30

      Average standard deviation of split frequencies: 0.001249

      565500 -- (-1492.678) (-1501.057) [-1494.473] (-1498.327) * (-1495.788) (-1499.439) (-1498.318) [-1495.684] -- 0:01:29
      566000 -- (-1493.153) (-1495.095) (-1499.676) [-1495.807] * [-1489.461] (-1500.333) (-1505.158) (-1494.178) -- 0:01:29
      566500 -- (-1488.876) [-1499.973] (-1495.501) (-1489.813) * (-1497.536) [-1497.421] (-1506.236) (-1501.884) -- 0:01:29
      567000 -- (-1494.695) (-1502.668) [-1498.412] (-1492.923) * (-1495.056) (-1498.674) (-1498.140) [-1505.652] -- 0:01:29
      567500 -- (-1493.804) (-1492.047) [-1493.414] (-1496.795) * (-1494.966) [-1499.679] (-1495.578) (-1502.541) -- 0:01:29
      568000 -- (-1504.420) (-1502.027) (-1505.412) [-1495.722] * (-1494.822) (-1491.430) [-1496.314] (-1505.708) -- 0:01:29
      568500 -- (-1509.012) [-1492.241] (-1499.620) (-1497.547) * [-1494.965] (-1491.697) (-1494.945) (-1497.783) -- 0:01:29
      569000 -- (-1495.394) (-1495.825) [-1492.880] (-1493.641) * [-1493.616] (-1498.268) (-1497.648) (-1491.587) -- 0:01:29
      569500 -- (-1497.488) (-1494.543) [-1493.461] (-1496.965) * (-1494.878) [-1498.309] (-1495.220) (-1491.992) -- 0:01:29
      570000 -- (-1497.583) (-1495.247) [-1488.009] (-1495.301) * [-1496.025] (-1506.446) (-1497.780) (-1502.965) -- 0:01:29

      Average standard deviation of split frequencies: 0.000826

      570500 -- (-1496.037) (-1498.064) [-1493.709] (-1497.901) * (-1507.178) (-1499.126) (-1496.114) [-1491.006] -- 0:01:28
      571000 -- (-1493.608) [-1492.175] (-1497.466) (-1491.286) * [-1500.524] (-1497.163) (-1500.606) (-1498.106) -- 0:01:28
      571500 -- [-1492.839] (-1503.486) (-1496.468) (-1494.217) * (-1499.845) (-1494.989) (-1497.912) [-1497.302] -- 0:01:28
      572000 -- (-1497.940) (-1494.303) (-1495.383) [-1492.477] * (-1501.080) (-1497.101) [-1497.633] (-1499.467) -- 0:01:28
      572500 -- (-1504.445) (-1501.951) [-1501.336] (-1494.525) * (-1500.555) (-1494.704) (-1498.631) [-1494.146] -- 0:01:28
      573000 -- (-1497.018) (-1504.992) (-1495.636) [-1495.256] * (-1498.160) [-1495.493] (-1503.515) (-1497.838) -- 0:01:28
      573500 -- (-1497.136) (-1496.932) (-1498.067) [-1497.995] * (-1497.497) (-1495.300) (-1498.170) [-1496.080] -- 0:01:28
      574000 -- [-1499.110] (-1501.805) (-1495.924) (-1496.760) * (-1497.897) [-1491.744] (-1498.369) (-1507.669) -- 0:01:28
      574500 -- [-1493.438] (-1496.000) (-1499.186) (-1500.724) * (-1493.009) (-1494.910) [-1493.736] (-1495.748) -- 0:01:28
      575000 -- (-1495.440) [-1494.941] (-1502.797) (-1494.164) * (-1495.296) [-1493.821] (-1494.010) (-1496.714) -- 0:01:27

      Average standard deviation of split frequencies: 0.000818

      575500 -- [-1495.560] (-1497.538) (-1495.492) (-1495.815) * (-1496.992) [-1492.789] (-1497.022) (-1502.750) -- 0:01:27
      576000 -- (-1497.765) [-1498.667] (-1491.504) (-1498.277) * (-1495.551) (-1492.074) [-1498.046] (-1498.091) -- 0:01:27
      576500 -- (-1493.419) (-1499.109) [-1497.192] (-1506.669) * (-1495.773) (-1500.791) [-1492.324] (-1500.204) -- 0:01:27
      577000 -- (-1500.047) [-1497.960] (-1497.080) (-1498.215) * (-1497.788) (-1504.612) [-1492.801] (-1496.798) -- 0:01:27
      577500 -- (-1503.329) [-1493.998] (-1494.465) (-1496.565) * (-1498.098) (-1503.717) (-1496.481) [-1512.324] -- 0:01:27
      578000 -- (-1491.851) (-1501.634) (-1497.591) [-1492.988] * (-1495.055) (-1504.680) [-1495.866] (-1498.926) -- 0:01:27
      578500 -- (-1498.122) (-1497.451) [-1500.529] (-1499.760) * [-1488.933] (-1512.264) (-1498.690) (-1494.524) -- 0:01:27
      579000 -- (-1501.187) [-1497.497] (-1506.762) (-1498.043) * (-1493.272) (-1500.081) [-1495.340] (-1494.891) -- 0:01:27
      579500 -- (-1490.405) [-1494.394] (-1496.981) (-1497.176) * (-1493.503) [-1491.521] (-1500.033) (-1496.960) -- 0:01:27
      580000 -- (-1496.248) (-1492.579) (-1499.366) [-1497.260] * (-1492.415) (-1500.411) (-1494.183) [-1494.493] -- 0:01:26

      Average standard deviation of split frequencies: 0.000406

      580500 -- (-1500.210) (-1493.751) [-1493.782] (-1502.350) * [-1491.502] (-1498.137) (-1494.715) (-1498.977) -- 0:01:26
      581000 -- (-1499.676) [-1500.355] (-1498.173) (-1499.937) * (-1504.667) (-1500.320) (-1499.176) [-1493.702] -- 0:01:26
      581500 -- (-1495.869) (-1499.097) [-1502.795] (-1498.938) * (-1497.296) (-1499.751) (-1497.378) [-1495.206] -- 0:01:26
      582000 -- (-1498.840) [-1496.055] (-1499.912) (-1497.818) * (-1494.306) (-1501.974) [-1494.558] (-1492.087) -- 0:01:26
      582500 -- (-1502.639) [-1495.196] (-1496.005) (-1496.869) * (-1495.462) [-1495.150] (-1495.572) (-1491.184) -- 0:01:26
      583000 -- [-1504.644] (-1501.531) (-1500.720) (-1493.978) * [-1495.137] (-1499.585) (-1500.758) (-1491.887) -- 0:01:26
      583500 -- [-1497.034] (-1498.863) (-1497.460) (-1497.060) * (-1495.471) [-1498.036] (-1492.765) (-1491.063) -- 0:01:26
      584000 -- (-1500.523) (-1491.664) [-1498.953] (-1499.677) * (-1499.560) (-1497.963) [-1498.569] (-1495.212) -- 0:01:26
      584500 -- [-1494.882] (-1495.512) (-1494.116) (-1510.172) * [-1495.886] (-1498.955) (-1493.821) (-1494.925) -- 0:01:26
      585000 -- [-1495.380] (-1492.417) (-1500.549) (-1494.469) * [-1490.619] (-1493.451) (-1492.669) (-1498.493) -- 0:01:25

      Average standard deviation of split frequencies: 0.000402

      585500 -- (-1501.891) [-1497.221] (-1501.178) (-1503.083) * (-1490.327) (-1499.868) (-1494.074) [-1496.056] -- 0:01:25
      586000 -- (-1501.494) [-1498.203] (-1499.034) (-1498.980) * (-1496.215) [-1497.354] (-1495.488) (-1497.051) -- 0:01:25
      586500 -- [-1492.317] (-1497.082) (-1494.203) (-1495.992) * (-1500.497) (-1492.873) [-1494.393] (-1501.149) -- 0:01:25
      587000 -- (-1498.029) (-1495.160) (-1500.680) [-1507.105] * (-1495.620) (-1506.315) (-1497.824) [-1495.803] -- 0:01:25
      587500 -- (-1497.130) [-1496.329] (-1493.517) (-1497.296) * [-1493.748] (-1498.304) (-1495.660) (-1497.852) -- 0:01:25
      588000 -- (-1499.376) [-1494.285] (-1495.468) (-1496.577) * (-1503.277) (-1503.282) (-1495.294) [-1497.776] -- 0:01:25
      588500 -- (-1499.343) (-1498.506) [-1493.051] (-1499.253) * (-1502.943) [-1493.823] (-1501.434) (-1503.080) -- 0:01:25
      589000 -- (-1505.411) [-1494.404] (-1496.202) (-1497.054) * (-1498.765) (-1497.972) (-1503.007) [-1503.515] -- 0:01:25
      589500 -- (-1500.239) (-1495.147) (-1498.040) [-1498.779] * (-1498.992) (-1496.004) [-1502.032] (-1499.445) -- 0:01:24
      590000 -- (-1502.817) (-1504.525) (-1495.809) [-1496.167] * (-1501.339) (-1495.859) (-1506.133) [-1497.215] -- 0:01:24

      Average standard deviation of split frequencies: 0.000399

      590500 -- (-1501.276) (-1497.054) (-1496.452) [-1495.181] * (-1498.310) [-1497.319] (-1496.951) (-1494.372) -- 0:01:24
      591000 -- (-1501.726) (-1497.911) (-1498.475) [-1496.600] * (-1497.405) (-1500.133) [-1492.323] (-1499.525) -- 0:01:24
      591500 -- (-1498.694) [-1495.913] (-1494.376) (-1489.972) * (-1499.060) (-1495.354) [-1497.941] (-1498.588) -- 0:01:24
      592000 -- (-1495.498) (-1497.546) (-1505.213) [-1491.717] * (-1498.205) [-1496.229] (-1502.912) (-1501.142) -- 0:01:24
      592500 -- [-1489.642] (-1498.566) (-1493.571) (-1497.483) * (-1495.646) [-1498.717] (-1499.320) (-1498.787) -- 0:01:24
      593000 -- [-1495.694] (-1492.916) (-1500.719) (-1499.843) * (-1493.290) [-1494.630] (-1492.544) (-1496.520) -- 0:01:24
      593500 -- (-1493.161) (-1492.898) [-1491.475] (-1491.263) * (-1497.779) (-1503.335) (-1495.499) [-1496.074] -- 0:01:24
      594000 -- (-1495.651) (-1500.236) (-1499.368) [-1494.832] * (-1495.728) (-1490.326) [-1498.532] (-1499.989) -- 0:01:24
      594500 -- [-1495.510] (-1495.678) (-1493.040) (-1503.748) * (-1497.032) (-1493.752) [-1493.131] (-1500.731) -- 0:01:23
      595000 -- (-1496.056) (-1506.510) [-1489.551] (-1510.662) * (-1490.755) (-1500.983) (-1494.538) [-1497.053] -- 0:01:23

      Average standard deviation of split frequencies: 0.000000

      595500 -- (-1491.905) [-1489.895] (-1490.254) (-1497.829) * (-1500.280) [-1494.239] (-1495.039) (-1500.471) -- 0:01:23
      596000 -- [-1496.049] (-1496.772) (-1490.398) (-1500.678) * (-1494.787) (-1500.446) [-1498.442] (-1494.027) -- 0:01:23
      596500 -- [-1498.022] (-1492.642) (-1500.376) (-1494.809) * (-1499.185) [-1490.400] (-1495.524) (-1497.633) -- 0:01:23
      597000 -- [-1493.755] (-1497.972) (-1496.153) (-1494.865) * [-1499.568] (-1498.456) (-1495.292) (-1491.713) -- 0:01:23
      597500 -- (-1490.836) (-1497.654) [-1496.575] (-1498.071) * (-1496.059) [-1492.875] (-1496.860) (-1497.721) -- 0:01:23
      598000 -- [-1495.784] (-1495.112) (-1495.888) (-1493.316) * (-1498.544) (-1499.083) (-1495.637) [-1496.130] -- 0:01:23
      598500 -- (-1496.139) [-1498.923] (-1498.295) (-1496.402) * (-1494.703) [-1499.042] (-1504.157) (-1498.234) -- 0:01:23
      599000 -- [-1501.200] (-1499.108) (-1494.429) (-1496.549) * (-1503.238) (-1499.053) [-1499.137] (-1494.421) -- 0:01:23
      599500 -- [-1495.622] (-1492.591) (-1492.373) (-1495.573) * (-1505.040) (-1493.558) [-1490.618] (-1498.033) -- 0:01:22
      600000 -- (-1498.111) [-1495.770] (-1495.596) (-1494.502) * (-1503.360) (-1495.686) (-1497.100) [-1492.050] -- 0:01:22

      Average standard deviation of split frequencies: 0.000000

      600500 -- [-1500.680] (-1500.901) (-1501.570) (-1502.077) * [-1497.431] (-1496.703) (-1493.164) (-1500.845) -- 0:01:22
      601000 -- (-1497.335) (-1515.113) (-1492.140) [-1492.927] * (-1498.168) (-1502.609) [-1494.774] (-1497.804) -- 0:01:22
      601500 -- (-1501.912) (-1504.900) (-1499.918) [-1496.733] * (-1495.135) (-1497.873) (-1493.820) [-1495.533] -- 0:01:22
      602000 -- (-1501.251) [-1497.399] (-1490.934) (-1495.242) * (-1506.164) (-1494.653) [-1496.499] (-1495.342) -- 0:01:22
      602500 -- (-1496.603) (-1501.306) [-1495.964] (-1494.485) * (-1502.347) (-1498.327) [-1492.659] (-1494.744) -- 0:01:22
      603000 -- (-1494.536) (-1501.230) [-1497.885] (-1498.096) * [-1502.690] (-1499.984) (-1491.905) (-1497.676) -- 0:01:22
      603500 -- (-1498.497) (-1494.652) [-1496.376] (-1493.295) * (-1501.752) (-1503.751) (-1499.196) [-1491.232] -- 0:01:22
      604000 -- [-1494.179] (-1497.886) (-1494.210) (-1494.909) * (-1500.142) (-1492.482) (-1502.128) [-1492.912] -- 0:01:21
      604500 -- (-1503.766) (-1497.217) [-1494.968] (-1499.769) * (-1502.697) (-1494.177) [-1498.548] (-1493.049) -- 0:01:21
      605000 -- (-1502.263) (-1500.778) (-1506.589) [-1498.493] * (-1503.120) (-1494.374) (-1498.407) [-1506.595] -- 0:01:21

      Average standard deviation of split frequencies: 0.000000

      605500 -- (-1491.512) [-1495.437] (-1493.716) (-1502.630) * [-1494.288] (-1504.410) (-1503.849) (-1496.567) -- 0:01:21
      606000 -- (-1496.994) (-1500.863) [-1493.116] (-1499.091) * (-1498.731) (-1501.409) [-1498.855] (-1500.764) -- 0:01:21
      606500 -- (-1497.019) (-1500.095) (-1498.039) [-1502.867] * [-1495.541] (-1493.301) (-1500.566) (-1500.349) -- 0:01:21
      607000 -- (-1496.321) (-1495.421) (-1494.922) [-1492.413] * (-1498.943) [-1492.508] (-1500.709) (-1495.591) -- 0:01:21
      607500 -- (-1501.788) (-1495.227) [-1490.901] (-1491.478) * [-1498.459] (-1493.716) (-1491.677) (-1500.584) -- 0:01:21
      608000 -- (-1494.257) (-1497.578) [-1496.354] (-1495.235) * (-1501.492) (-1491.737) (-1504.770) [-1496.485] -- 0:01:21
      608500 -- (-1497.779) [-1492.080] (-1491.256) (-1500.387) * (-1505.341) (-1494.699) [-1499.802] (-1498.531) -- 0:01:21
      609000 -- (-1497.466) (-1494.110) (-1497.044) [-1496.026] * (-1496.282) (-1494.485) (-1495.175) [-1489.803] -- 0:01:20
      609500 -- (-1505.134) (-1496.294) [-1494.341] (-1495.485) * (-1497.421) (-1492.418) [-1495.111] (-1508.981) -- 0:01:20
      610000 -- (-1501.213) (-1493.303) (-1502.701) [-1494.867] * (-1495.423) (-1496.449) (-1499.423) [-1495.817] -- 0:01:20

      Average standard deviation of split frequencies: 0.000000

      610500 -- [-1497.376] (-1505.100) (-1495.922) (-1499.426) * (-1493.262) [-1493.623] (-1499.593) (-1496.403) -- 0:01:20
      611000 -- (-1496.848) (-1496.943) (-1501.147) [-1494.464] * (-1500.700) [-1499.018] (-1492.006) (-1495.962) -- 0:01:20
      611500 -- (-1501.413) [-1497.998] (-1500.923) (-1496.907) * (-1501.042) (-1496.292) (-1503.422) [-1496.434] -- 0:01:20
      612000 -- (-1498.930) (-1505.679) (-1494.891) [-1511.819] * (-1496.385) [-1498.643] (-1497.053) (-1496.040) -- 0:01:20
      612500 -- (-1500.034) (-1504.795) [-1492.141] (-1498.792) * (-1500.784) (-1499.924) (-1495.410) [-1501.787] -- 0:01:20
      613000 -- (-1500.885) (-1497.996) (-1496.649) [-1498.746] * [-1498.062] (-1495.255) (-1495.312) (-1499.279) -- 0:01:20
      613500 -- (-1493.366) [-1499.641] (-1495.001) (-1499.043) * [-1494.816] (-1509.922) (-1495.140) (-1500.768) -- 0:01:20
      614000 -- [-1493.697] (-1495.685) (-1495.041) (-1498.699) * (-1494.949) (-1495.894) [-1496.246] (-1495.585) -- 0:01:19
      614500 -- [-1493.160] (-1497.365) (-1495.139) (-1499.897) * [-1499.425] (-1502.493) (-1495.008) (-1496.557) -- 0:01:19
      615000 -- (-1498.166) (-1493.402) [-1498.396] (-1498.611) * (-1500.929) (-1502.467) [-1492.861] (-1493.815) -- 0:01:19

      Average standard deviation of split frequencies: 0.000383

      615500 -- [-1494.832] (-1491.822) (-1493.399) (-1501.768) * (-1492.150) (-1493.368) (-1500.048) [-1504.737] -- 0:01:19
      616000 -- (-1495.735) (-1500.913) [-1497.126] (-1501.513) * [-1497.722] (-1500.020) (-1499.325) (-1502.111) -- 0:01:19
      616500 -- (-1495.918) [-1493.328] (-1490.145) (-1499.698) * (-1495.737) (-1500.016) (-1497.829) [-1503.275] -- 0:01:19
      617000 -- (-1492.334) (-1490.605) [-1497.114] (-1496.241) * [-1499.985] (-1496.311) (-1499.002) (-1502.063) -- 0:01:19
      617500 -- [-1496.260] (-1491.466) (-1505.906) (-1496.843) * (-1501.888) [-1502.531] (-1495.985) (-1495.034) -- 0:01:19
      618000 -- (-1495.991) [-1502.327] (-1497.172) (-1501.360) * [-1492.695] (-1496.569) (-1499.970) (-1497.275) -- 0:01:19
      618500 -- (-1496.359) (-1500.861) (-1497.401) [-1497.505] * (-1495.708) (-1494.272) [-1491.019] (-1497.022) -- 0:01:18
      619000 -- (-1498.154) (-1493.821) [-1498.524] (-1500.153) * (-1495.579) [-1491.806] (-1492.804) (-1499.04