--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Nov 03 10:41:38 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/132/CG34424-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1566.80         -1577.28
2      -1567.01         -1576.49
--------------------------------------
TOTAL    -1566.90         -1576.96
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.706752    0.016810    0.478873    0.971231    0.692624    986.17   1036.44    1.000
r(A<->C){all}   0.069834    0.000890    0.020878    0.134702    0.066466    756.73    771.81    1.001
r(A<->G){all}   0.186193    0.002422    0.098272    0.282881    0.181994    654.59    691.76    1.000
r(A<->T){all}   0.070334    0.002049    0.000042    0.154521    0.063758    470.83    556.89    1.000
r(C<->G){all}   0.059906    0.000552    0.016792    0.105600    0.057813    615.13    730.67    1.001
r(C<->T){all}   0.496880    0.004946    0.364222    0.630053    0.497758    654.17    734.86    1.000
r(G<->T){all}   0.116852    0.001566    0.046636    0.197452    0.113309    864.31    889.80    1.000
pi(A){all}      0.231597    0.000260    0.200752    0.263432    0.231553   1222.24   1285.31    1.000
pi(C){all}      0.295902    0.000306    0.262798    0.330867    0.295252    981.73    992.38    1.000
pi(G){all}      0.316560    0.000321    0.281715    0.351506    0.315815    754.23    981.55    1.000
pi(T){all}      0.155941    0.000188    0.131238    0.184362    0.155600    834.51    925.97    1.000
alpha{1,2}      0.109005    0.001536    0.013855    0.178348    0.110496    893.76    899.40    1.000
alpha{3}        1.879653    0.549239    0.636073    3.330932    1.770550   1170.37   1184.78    1.000
pinvar{all}     0.468581    0.005955    0.316441    0.602830    0.476896    879.89    887.81    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1480.313209
Model 2: PositiveSelection	-1480.313209
Model 0: one-ratio	-1490.745894
Model 3: discrete	-1476.413374
Model 7: beta	-1476.535763
Model 8: beta&w>1	-1476.535886


Model 0 vs 1	20.865369999999984

Model 2 vs 1	0.0

Model 8 vs 7	2.459999996062834E-4
>C1
MAATIQNTLKVALRKRMKDALKGIDAEAIARQSQAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMEEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C2
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNKELPMESHDVRLHGVITE
N
>C3
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C4
MAATIQNSLKVALRKRIKDALKGIDAEAIARQSQAVTSKVLQSEVFRQAQ
RVSIYLSTASELDTTALISEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPPTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHADKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
o
>C5
MAATIQNSLKVALRKRIKDALKSIDPEAIARQSQAVTAKVLQSEIFRHAQ
RVSIYLSTTSELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVNNEELPMESHDVRLHSVITE
o
>C6
MAATIQNSLKVALRGRMKDALKGLDAETIARQSRAVTAKVLQSEVFRQAQ
RVSIYLSTASELDTTALLLEMFRLEKMVFVPTYEGSKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGGRMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMESHDVRLHSVITE
N
>C7
MAATIQNTLKVALRKRMKDALKNLDTEAIARQSRAVTAKVLQSEFFRQAT
RVSIYLSTASEVDTTALLCEMFRLEKMVFVPTYEGTKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRTGARMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMETHDVRLHSVITE
N
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=201 

C1              MAATIQNTLKVALRKRMKDALKGIDAEAIARQSQAVTAKVLQSEIFRQAQ
C2              MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
C3              MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
C4              MAATIQNSLKVALRKRIKDALKGIDAEAIARQSQAVTSKVLQSEVFRQAQ
C5              MAATIQNSLKVALRKRIKDALKSIDPEAIARQSQAVTAKVLQSEIFRHAQ
C6              MAATIQNSLKVALRGRMKDALKGLDAETIARQSRAVTAKVLQSEVFRQAQ
C7              MAATIQNTLKVALRKRMKDALKNLDTEAIARQSRAVTAKVLQSEFFRQAT
                *******:****** *:*****.:*.::*****:***:******.**:* 

C1              RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMEEYE
C2              RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
C3              RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
C4              RVSIYLSTASELDTTALISEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
C5              RVSIYLSTTSELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
C6              RVSIYLSTASELDTTALLLEMFRLEKMVFVPTYEGSKMKMVRLRGMDEYE
C7              RVSIYLSTASEVDTTALLCEMFRLEKMVFVPTYEGTKMKMVRLRGMDEYE
                ********:**:*****: ****************::*********:***

C1              SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
C2              SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
C3              SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
C4              SLPPTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
C5              SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
C6              SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGGRMGHGMG
C7              SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRTGARMGHGMG
                *** ************************************ *.*******

C1              YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
C2              YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNKELPMESHDVRLHGVITE
C3              YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
C4              YYDKFLKQHADKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
C5              YYDKFLKQHAEKYPHKKISLMALSLNEQIVNNEELPMESHDVRLHSVITE
C6              YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMESHDVRLHSVITE
C7              YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMETHDVRLHSVITE
                **********:************:******.*:*****:******.****

C1              N
C2              N
C3              N
C4              o
C5              o
C6              N
C7              N
                 




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8442]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [8442]--->[8442]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.379 Mb, Max= 30.690 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MAATIQNTLKVALRKRMKDALKGIDAEAIARQSQAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMEEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C2
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNKELPMESHDVRLHGVITE
N
>C3
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C4
MAATIQNSLKVALRKRIKDALKGIDAEAIARQSQAVTSKVLQSEVFRQAQ
RVSIYLSTASELDTTALISEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPPTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHADKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
o
>C5
MAATIQNSLKVALRKRIKDALKSIDPEAIARQSQAVTAKVLQSEIFRHAQ
RVSIYLSTTSELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVNNEELPMESHDVRLHSVITE
o
>C6
MAATIQNSLKVALRGRMKDALKGLDAETIARQSRAVTAKVLQSEVFRQAQ
RVSIYLSTASELDTTALLLEMFRLEKMVFVPTYEGSKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGGRMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMESHDVRLHSVITE
N
>C7
MAATIQNTLKVALRKRMKDALKNLDTEAIARQSRAVTAKVLQSEFFRQAT
RVSIYLSTASEVDTTALLCEMFRLEKMVFVPTYEGTKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRTGARMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMETHDVRLHSVITE
N

FORMAT of file /tmp/tmp9155994204849441538aln Not Supported[FATAL:T-COFFEE]
>C1
MAATIQNTLKVALRKRMKDALKGIDAEAIARQSQAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMEEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C2
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNKELPMESHDVRLHGVITE
N
>C3
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C4
MAATIQNSLKVALRKRIKDALKGIDAEAIARQSQAVTSKVLQSEVFRQAQ
RVSIYLSTASELDTTALISEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPPTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHADKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
o
>C5
MAATIQNSLKVALRKRIKDALKSIDPEAIARQSQAVTAKVLQSEIFRHAQ
RVSIYLSTTSELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVNNEELPMESHDVRLHSVITE
o
>C6
MAATIQNSLKVALRGRMKDALKGLDAETIARQSRAVTAKVLQSEVFRQAQ
RVSIYLSTASELDTTALLLEMFRLEKMVFVPTYEGSKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGGRMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMESHDVRLHSVITE
N
>C7
MAATIQNTLKVALRKRMKDALKNLDTEAIARQSRAVTAKVLQSEFFRQAT
RVSIYLSTASEVDTTALLCEMFRLEKMVFVPTYEGTKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRTGARMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMETHDVRLHSVITE
N
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:201 S:100 BS:201
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# PW_SEQ_DISTANCES 
BOT	    0    1	 97.01 C1	 C2	 97.01
TOP	    1    0	 97.01 C2	 C1	 97.01
BOT	    0    2	 98.01 C1	 C3	 98.01
TOP	    2    0	 98.01 C3	 C1	 98.01
BOT	    0    3	 95.52 C1	 C4	 95.52
TOP	    3    0	 95.52 C4	 C1	 95.52
BOT	    0    4	 95.52 C1	 C5	 95.52
TOP	    4    0	 95.52 C5	 C1	 95.52
BOT	    0    5	 94.03 C1	 C6	 94.03
TOP	    5    0	 94.03 C6	 C1	 94.03
BOT	    0    6	 92.54 C1	 C7	 92.54
TOP	    6    0	 92.54 C7	 C1	 92.54
BOT	    1    2	 99.00 C2	 C3	 99.00
TOP	    2    1	 99.00 C3	 C2	 99.00
BOT	    1    3	 94.53 C2	 C4	 94.53
TOP	    3    1	 94.53 C4	 C2	 94.53
BOT	    1    4	 94.53 C2	 C5	 94.53
TOP	    4    1	 94.53 C5	 C2	 94.53
BOT	    1    5	 93.53 C2	 C6	 93.53
TOP	    5    1	 93.53 C6	 C2	 93.53
BOT	    1    6	 91.04 C2	 C7	 91.04
TOP	    6    1	 91.04 C7	 C2	 91.04
BOT	    2    3	 95.52 C3	 C4	 95.52
TOP	    3    2	 95.52 C4	 C3	 95.52
BOT	    2    4	 95.52 C3	 C5	 95.52
TOP	    4    2	 95.52 C5	 C3	 95.52
BOT	    2    5	 94.53 C3	 C6	 94.53
TOP	    5    2	 94.53 C6	 C3	 94.53
BOT	    2    6	 92.04 C3	 C7	 92.04
TOP	    6    2	 92.04 C7	 C3	 92.04
BOT	    3    4	 95.02 C4	 C5	 95.02
TOP	    4    3	 95.02 C5	 C4	 95.02
BOT	    3    5	 93.53 C4	 C6	 93.53
TOP	    5    3	 93.53 C6	 C4	 93.53
BOT	    3    6	 90.55 C4	 C7	 90.55
TOP	    6    3	 90.55 C7	 C4	 90.55
BOT	    4    5	 91.54 C5	 C6	 91.54
TOP	    5    4	 91.54 C6	 C5	 91.54
BOT	    4    6	 90.05 C5	 C7	 90.05
TOP	    6    4	 90.05 C7	 C5	 90.05
BOT	    5    6	 93.53 C6	 C7	 93.53
TOP	    6    5	 93.53 C7	 C6	 93.53
AVG	 0	 C1	  *	 95.44
AVG	 1	 C2	  *	 94.94
AVG	 2	 C3	  *	 95.77
AVG	 3	 C4	  *	 94.11
AVG	 4	 C5	  *	 93.70
AVG	 5	 C6	  *	 93.45
AVG	 6	 C7	  *	 91.63
TOT	 TOT	  *	 94.15
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCGGCCACGATCCAGAACACCCTGAAGGTGGCGCTGCGAAAGCGCAT
C2              ATGGCGGCCACGATCCAGAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
C3              ATGGCGGCCACGATCCAGAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
C4              ATGGCAGCCACGATCCAAAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
C5              ATGGCGGCCACGATCCAAAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
C6              ATGGCGGCTACAATCCAGAATAGTCTCAAAGTGGCGCTGAGGGGGCGCAT
C7              ATGGCGGCTACTATCCAAAACACCCTCAAAGTGGCGCTGAGGAAGCGCAT
                *****.** ** *****.** *  ** **.*********.*...******

C1              GAAGGATGCACTGAAGGGCATCGACGCGGAGGCCATCGCCCGGCAGTCGC
C2              GAAGGATGCACTGAAGGGCATCGACGCGGATGCCATCGCCCGGCAGTCGC
C3              GAAGGATGCACTGAAGGGCATCGACGCGGATGCCATCGCCCGGCAGTCGC
C4              TAAGGATGCACTGAAGGGCATCGACGCGGAGGCCATCGCTCGGCAGTCGC
C5              AAAGGATGCACTGAAGAGCATCGACCCGGAGGCTATCGCCCGGCAATCCC
C6              GAAGGATGCGCTCAAGGGCCTGGACGCGGAGACCATTGCCCGGCAATCCC
C7              GAAGGATGCCCTCAAAAACCTGGACACGGAGGCCATTGCCCGGCAATCTC
                 ******** ** **...*.* *** **** .* ** ** *****.** *

C1              AGGCCGTCACGGCTAAGGTGCTGCAAAGCGAGATCTTCCGGCAGGCGCAG
C2              ATGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGTCAGGCGCAG
C3              ATGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGGCAGGCGCAG
C4              AGGCCGTCACTTCCAAGGTGCTGCAAAGCGAGGTCTTCCGGCAGGCCCAG
C5              AGGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGGCATGCGCAG
C6              GGGCAGTCACGGCCAAGGTGCTCCAGAGCGAGGTTTTCCGCCAGGCCCAG
C7              GAGCAGTCACGGCCAAGGTGCTGCAAAGTGAGTTTTTTCGACAGGCAACG
                . **.*****  * ******** **.** *** * ** ** ** ** ..*

C1              CGGGTGAGCATTTACCTGAGCACAGCCTCGGAGCTGGACACCACGGCGCT
C2              CGGGTGAGCATTTACCTGAGCACCGCCTCGGAGCTGGACACCACGGCGCT
C3              CGGGTGAGCATTTACCTGAGCACCGCCTCGGAGCTGGACACCACAGCGCT
C4              CGGGTGAGCATTTACCTGAGCACCGCCTCCGAGTTGGACACCACGGCGCT
C5              CGGGTGAGCATTTACCTGAGCACCACCTCCGAGCTGGACACCACGGCGCT
C6              CGGGTGAGCATTTACCTGAGCACCGCCTCTGAACTGGACACCACGGCGCT
C7              CGGGTGAGTATCTACCTGAGCACAGCCTCGGAAGTGGACACCACGGCGCT
                ******** ** ***********..**** **. **********.*****

C1              GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTTGTGCCCACCTACG
C2              GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
C3              GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
C4              GATTTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
C5              GCTTTCGGAGATGTTCCGCCTGGAGAAGATGGTATTCGTGCCCACCTACG
C6              GCTCCTCGAGATGTTTCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
C7              GCTCTGCGAGATGTTCCGGCTGGAGAAGATGGTCTTCGTGCCCACCTACG
                *.*    ******** ** **************.** *************

C1              AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGAGGAGTACGAG
C2              AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGACGAGTACGAG
C3              AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGACGAGTACGAG
C4              AGGGCAGCAGGATGAAGATGGTGCGACTGCGCGGCATGGACGAGTACGAG
C5              AGGGCAGCAGGATGAAGATGGTGCGACTGCGCGGCATGGACGAGTACGAG
C6              AGGGCAGCAAGATGAAGATGGTCCGCCTGCGCGGAATGGACGAGTACGAG
C7              AGGGCACCAAGATGAAGATGGTCCGATTGCGGGGCATGGACGAGTACGAG
                ****** **.************ **  **** **.***** *********

C1              AGCCTGCCTCTGACCAAGTGGAACATAAAGCAGCCGGACTTCAAGGAGGC
C2              AGCCTGCCTCTGACCAAGTGGAACATTAAGCAGCCGGACTTCAAGGAGGC
C3              AGCCTGCCTCTGACCAAGTGGAACATTAAGCAGCCGGACTTTAAGGAGGC
C4              AGCCTGCCCCCGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC
C5              AGCCTGCCCCTGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC
C6              AGTCTCCCTCTGACCAAGTGGAACATCAAGCAGCCGGACTTTAAGGAGGC
C7              AGCCTTCCGCTGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC
                ** ** ** * *************** ************** ********

C1              ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATTGTGC
C2              ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATCGTGC
C3              ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATCGTGC
C4              GCGCGAAGATGCCATGACCAATGGGCACGGCATCGATCTCTTCATCGTGC
C5              GCGCGAAGATGCCATGACCAATGGGCACGGCATCGATCTCTTCATCGTGC
C6              ACGCGAAGATGCCATGACCAACGGCCACGGCATCGACCTCTTCATTGTGC
C7              TCGTGAAGATGCCATGACCAATGGACACGGCATCGATCTCTTCATTGTGC
                 ** **.************** ** *********** ******** ****

C1              CCGGTGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC
C2              CCGGCGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC
C3              CCGGCGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC
C4              CCGGAGTAGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGAATGGGC
C5              CGGGAGTGGCCTTCACCCGCTGTGGAGCTCGGATGGGCCATGGAATGGGC
C6              CCGGAGTGGCCTTCACCCGCTGCGGAGGTCGCATGGGCCATGGAATGGGT
C7              CCGGGGTGGCCTTCACCCGCACTGGAGCTCGCATGGGCCATGGCATGGGC
                * ** **.************:  **** *** ***********.***** 

C1              TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
C2              TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
C3              TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
C4              TACTACGACAAGTTCCTCAAGCAGCACGCGGATAAGTATCCGCACAAGAA
C5              TACTATGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
C6              TACTACGACAAGTTCCTGAAGCAGCACGCCGACAAGTATCCGCACAAGAA
C7              TACTACGACAAGTTCCTGAAGCAGCACGCGGACAAGTATCCGCACAAGAA
                ***** *********** *********** ** *****************

C1              GATCTCGCTGATGGCACTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG
C2              GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACAAGG
C3              GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG
C4              GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG
C5              GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAACAACGAGG
C6              GATCTCGCTGATGGCCCTGGCCCTCAACGAGCAGATTGTCAGCAACGAGG
C7              GATCTCCCTGATGGCACTGGCCCTCAACGAGCAGATCGTCAGCAACGAGG
                ****** ******** *** * ************** ****.****.***

C1              AGTTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
C2              AGTTGCCCATGGAGTCGCACGACGTCCGTTTGCACGGTGTAATTACGGAA
C3              AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
C4              AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
C5              AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
C6              AGCTGCCCATGGAGTCGCACGATGTCCGTTTGCACAGTGTAATTACAGAG
C7              AGCTGCCCATGGAGACGCACGATGTCCGTTTGCACAGTGTAATTACAGAA
                ** ***********:******* ************.**********.**.

C1              AAC
C2              AAC
C3              AAC
C4              ---
C5              ---
C6              AAC
C7              AAC
                   



>C1
ATGGCGGCCACGATCCAGAACACCCTGAAGGTGGCGCTGCGAAAGCGCAT
GAAGGATGCACTGAAGGGCATCGACGCGGAGGCCATCGCCCGGCAGTCGC
AGGCCGTCACGGCTAAGGTGCTGCAAAGCGAGATCTTCCGGCAGGCGCAG
CGGGTGAGCATTTACCTGAGCACAGCCTCGGAGCTGGACACCACGGCGCT
GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTTGTGCCCACCTACG
AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGAGGAGTACGAG
AGCCTGCCTCTGACCAAGTGGAACATAAAGCAGCCGGACTTCAAGGAGGC
ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATTGTGC
CCGGTGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC
TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
GATCTCGCTGATGGCACTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG
AGTTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
AAC
>C2
ATGGCGGCCACGATCCAGAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
GAAGGATGCACTGAAGGGCATCGACGCGGATGCCATCGCCCGGCAGTCGC
ATGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGTCAGGCGCAG
CGGGTGAGCATTTACCTGAGCACCGCCTCGGAGCTGGACACCACGGCGCT
GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGACGAGTACGAG
AGCCTGCCTCTGACCAAGTGGAACATTAAGCAGCCGGACTTCAAGGAGGC
ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATCGTGC
CCGGCGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC
TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACAAGG
AGTTGCCCATGGAGTCGCACGACGTCCGTTTGCACGGTGTAATTACGGAA
AAC
>C3
ATGGCGGCCACGATCCAGAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
GAAGGATGCACTGAAGGGCATCGACGCGGATGCCATCGCCCGGCAGTCGC
ATGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGGCAGGCGCAG
CGGGTGAGCATTTACCTGAGCACCGCCTCGGAGCTGGACACCACAGCGCT
GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGACGAGTACGAG
AGCCTGCCTCTGACCAAGTGGAACATTAAGCAGCCGGACTTTAAGGAGGC
ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATCGTGC
CCGGCGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC
TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG
AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
AAC
>C4
ATGGCAGCCACGATCCAAAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
TAAGGATGCACTGAAGGGCATCGACGCGGAGGCCATCGCTCGGCAGTCGC
AGGCCGTCACTTCCAAGGTGCTGCAAAGCGAGGTCTTCCGGCAGGCCCAG
CGGGTGAGCATTTACCTGAGCACCGCCTCCGAGTTGGACACCACGGCGCT
GATTTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
AGGGCAGCAGGATGAAGATGGTGCGACTGCGCGGCATGGACGAGTACGAG
AGCCTGCCCCCGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC
GCGCGAAGATGCCATGACCAATGGGCACGGCATCGATCTCTTCATCGTGC
CCGGAGTAGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGAATGGGC
TACTACGACAAGTTCCTCAAGCAGCACGCGGATAAGTATCCGCACAAGAA
GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG
AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
---
>C5
ATGGCGGCCACGATCCAAAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
AAAGGATGCACTGAAGAGCATCGACCCGGAGGCTATCGCCCGGCAATCCC
AGGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGGCATGCGCAG
CGGGTGAGCATTTACCTGAGCACCACCTCCGAGCTGGACACCACGGCGCT
GCTTTCGGAGATGTTCCGCCTGGAGAAGATGGTATTCGTGCCCACCTACG
AGGGCAGCAGGATGAAGATGGTGCGACTGCGCGGCATGGACGAGTACGAG
AGCCTGCCCCTGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC
GCGCGAAGATGCCATGACCAATGGGCACGGCATCGATCTCTTCATCGTGC
CGGGAGTGGCCTTCACCCGCTGTGGAGCTCGGATGGGCCATGGAATGGGC
TACTATGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAACAACGAGG
AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
---
>C6
ATGGCGGCTACAATCCAGAATAGTCTCAAAGTGGCGCTGAGGGGGCGCAT
GAAGGATGCGCTCAAGGGCCTGGACGCGGAGACCATTGCCCGGCAATCCC
GGGCAGTCACGGCCAAGGTGCTCCAGAGCGAGGTTTTCCGCCAGGCCCAG
CGGGTGAGCATTTACCTGAGCACCGCCTCTGAACTGGACACCACGGCGCT
GCTCCTCGAGATGTTTCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
AGGGCAGCAAGATGAAGATGGTCCGCCTGCGCGGAATGGACGAGTACGAG
AGTCTCCCTCTGACCAAGTGGAACATCAAGCAGCCGGACTTTAAGGAGGC
ACGCGAAGATGCCATGACCAACGGCCACGGCATCGACCTCTTCATTGTGC
CCGGAGTGGCCTTCACCCGCTGCGGAGGTCGCATGGGCCATGGAATGGGT
TACTACGACAAGTTCCTGAAGCAGCACGCCGACAAGTATCCGCACAAGAA
GATCTCGCTGATGGCCCTGGCCCTCAACGAGCAGATTGTCAGCAACGAGG
AGCTGCCCATGGAGTCGCACGATGTCCGTTTGCACAGTGTAATTACAGAG
AAC
>C7
ATGGCGGCTACTATCCAAAACACCCTCAAAGTGGCGCTGAGGAAGCGCAT
GAAGGATGCCCTCAAAAACCTGGACACGGAGGCCATTGCCCGGCAATCTC
GAGCAGTCACGGCCAAGGTGCTGCAAAGTGAGTTTTTTCGACAGGCAACG
CGGGTGAGTATCTACCTGAGCACAGCCTCGGAAGTGGACACCACGGCGCT
GCTCTGCGAGATGTTCCGGCTGGAGAAGATGGTCTTCGTGCCCACCTACG
AGGGCACCAAGATGAAGATGGTCCGATTGCGGGGCATGGACGAGTACGAG
AGCCTTCCGCTGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC
TCGTGAAGATGCCATGACCAATGGACACGGCATCGATCTCTTCATTGTGC
CCGGGGTGGCCTTCACCCGCACTGGAGCTCGCATGGGCCATGGCATGGGC
TACTACGACAAGTTCCTGAAGCAGCACGCGGACAAGTATCCGCACAAGAA
GATCTCCCTGATGGCACTGGCCCTCAACGAGCAGATCGTCAGCAACGAGG
AGCTGCCCATGGAGACGCACGATGTCCGTTTGCACAGTGTAATTACAGAA
AAC
>C1
MAATIQNTLKVALRKRMKDALKGIDAEAIARQSQAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMEEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C2
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNKELPMESHDVRLHGVITE
N
>C3
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C4
MAATIQNSLKVALRKRIKDALKGIDAEAIARQSQAVTSKVLQSEVFRQAQ
RVSIYLSTASELDTTALISEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPPTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHADKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
o
>C5
MAATIQNSLKVALRKRIKDALKSIDPEAIARQSQAVTAKVLQSEIFRHAQ
RVSIYLSTTSELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVNNEELPMESHDVRLHSVITE
o
>C6
MAATIQNSLKVALRGRMKDALKGLDAETIARQSRAVTAKVLQSEVFRQAQ
RVSIYLSTASELDTTALLLEMFRLEKMVFVPTYEGSKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGGRMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMESHDVRLHSVITE
N
>C7
MAATIQNTLKVALRKRMKDALKNLDTEAIARQSRAVTAKVLQSEFFRQAT
RVSIYLSTASEVDTTALLCEMFRLEKMVFVPTYEGTKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRTGARMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMETHDVRLHSVITE
N


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 7 taxa and 603 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Taxon 7 -> C7
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1478169398
      Setting output file names to "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1027890149
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 6123560823
      Seed = 1874386517
      Swapseed = 1478169398
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 24 unique site patterns
      Division 2 has 16 unique site patterns
      Division 3 has 60 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2068.524672 -- -24.557203
         Chain 2 -- -2082.502451 -- -24.557203
         Chain 3 -- -2063.097686 -- -24.557203
         Chain 4 -- -2023.627504 -- -24.557203

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2095.014151 -- -24.557203
         Chain 2 -- -2094.068514 -- -24.557203
         Chain 3 -- -2071.157788 -- -24.557203
         Chain 4 -- -2070.285802 -- -24.557203


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2068.525] (-2082.502) (-2063.098) (-2023.628) * [-2095.014] (-2094.069) (-2071.158) (-2070.286) 
        500 -- (-1637.625) (-1618.104) (-1642.255) [-1624.467] * (-1631.165) (-1628.318) [-1630.624] (-1625.038) -- 0:00:00
       1000 -- (-1635.333) [-1614.956] (-1627.245) (-1620.123) * (-1616.886) (-1607.869) [-1605.072] (-1604.217) -- 0:16:39
       1500 -- [-1607.277] (-1605.872) (-1611.371) (-1603.350) * (-1606.353) (-1609.624) [-1584.546] (-1602.871) -- 0:11:05
       2000 -- (-1605.064) (-1584.553) [-1595.812] (-1595.419) * (-1592.836) [-1584.471] (-1577.522) (-1591.178) -- 0:08:19
       2500 -- [-1581.194] (-1589.993) (-1583.654) (-1591.214) * (-1584.675) (-1586.161) (-1579.779) [-1576.224] -- 0:06:39
       3000 -- (-1593.506) (-1581.850) (-1580.451) [-1570.395] * [-1579.763] (-1589.535) (-1575.608) (-1586.454) -- 0:05:32
       3500 -- (-1578.260) (-1591.813) (-1577.520) [-1569.397] * (-1576.074) (-1583.446) [-1572.338] (-1580.311) -- 0:04:44
       4000 -- (-1574.450) [-1574.180] (-1572.010) (-1572.914) * (-1573.165) (-1582.443) [-1571.773] (-1576.655) -- 0:08:18
       4500 -- (-1571.112) [-1563.919] (-1571.587) (-1570.567) * (-1575.049) (-1574.869) [-1572.852] (-1570.047) -- 0:07:22
       5000 -- (-1583.094) [-1572.796] (-1571.710) (-1571.268) * (-1577.581) [-1568.237] (-1571.515) (-1580.032) -- 0:06:38

      Average standard deviation of split frequencies: 0.078567

       5500 -- (-1574.841) [-1574.538] (-1575.128) (-1575.409) * (-1570.634) [-1575.824] (-1569.175) (-1573.198) -- 0:06:01
       6000 -- (-1575.739) (-1577.253) (-1576.227) [-1579.111] * [-1584.185] (-1574.437) (-1569.794) (-1574.335) -- 0:05:31
       6500 -- (-1573.356) (-1570.036) (-1566.107) [-1576.855] * [-1572.105] (-1566.830) (-1573.524) (-1567.874) -- 0:05:05
       7000 -- (-1565.800) (-1572.361) [-1563.706] (-1577.141) * (-1575.365) (-1568.607) [-1567.452] (-1570.000) -- 0:04:43
       7500 -- [-1571.882] (-1569.303) (-1575.689) (-1568.998) * (-1568.634) (-1583.037) [-1569.188] (-1571.703) -- 0:04:24
       8000 -- (-1567.482) (-1569.327) [-1576.089] (-1571.681) * [-1579.284] (-1584.633) (-1572.296) (-1569.090) -- 0:04:08
       8500 -- [-1574.479] (-1568.521) (-1577.804) (-1573.893) * (-1579.719) (-1583.125) (-1570.211) [-1569.256] -- 0:05:49
       9000 -- [-1572.693] (-1573.692) (-1567.376) (-1575.108) * [-1573.824] (-1568.799) (-1568.485) (-1569.658) -- 0:05:30
       9500 -- (-1573.077) (-1582.772) (-1567.354) [-1568.068] * (-1576.486) (-1569.520) (-1571.337) [-1568.427] -- 0:05:12
      10000 -- (-1572.866) [-1573.249] (-1575.660) (-1573.285) * (-1571.630) [-1566.018] (-1568.578) (-1572.666) -- 0:04:57

      Average standard deviation of split frequencies: 0.036828

      10500 -- [-1566.050] (-1574.511) (-1571.027) (-1572.855) * [-1566.429] (-1571.198) (-1566.230) (-1570.434) -- 0:04:42
      11000 -- [-1567.397] (-1573.051) (-1570.303) (-1579.622) * (-1573.855) (-1571.759) (-1571.965) [-1570.374] -- 0:04:29
      11500 -- (-1566.350) [-1566.944] (-1572.341) (-1573.697) * [-1567.709] (-1571.994) (-1570.641) (-1572.118) -- 0:04:17
      12000 -- [-1577.213] (-1566.140) (-1575.959) (-1578.307) * (-1569.697) [-1567.114] (-1570.733) (-1566.212) -- 0:05:29
      12500 -- [-1573.069] (-1572.873) (-1574.083) (-1568.285) * (-1575.780) (-1577.496) [-1565.902] (-1579.343) -- 0:05:16
      13000 -- (-1572.377) (-1569.948) [-1567.097] (-1575.269) * (-1574.439) [-1567.948] (-1570.058) (-1577.219) -- 0:05:03
      13500 -- (-1564.858) (-1567.427) (-1574.681) [-1573.022] * (-1574.303) (-1567.847) (-1569.642) [-1574.196] -- 0:04:52
      14000 -- (-1570.794) [-1575.490] (-1571.350) (-1573.708) * (-1577.366) [-1568.849] (-1567.892) (-1577.876) -- 0:04:41
      14500 -- [-1575.962] (-1570.391) (-1568.855) (-1569.748) * (-1571.456) (-1569.761) [-1567.489] (-1574.909) -- 0:04:31
      15000 -- (-1575.897) (-1570.696) [-1572.786] (-1569.940) * (-1576.418) (-1584.434) [-1569.260] (-1574.833) -- 0:04:22

      Average standard deviation of split frequencies: 0.029463

      15500 -- (-1574.138) [-1571.144] (-1569.502) (-1569.885) * (-1573.542) [-1571.272] (-1575.963) (-1574.758) -- 0:04:14
      16000 -- (-1567.324) [-1572.027] (-1568.446) (-1571.193) * (-1576.587) (-1570.215) [-1570.175] (-1573.441) -- 0:04:06
      16500 -- (-1572.999) (-1564.998) [-1569.750] (-1576.057) * (-1572.581) [-1573.703] (-1573.029) (-1578.498) -- 0:04:58
      17000 -- (-1568.256) (-1567.009) (-1570.965) [-1573.255] * (-1573.047) [-1571.822] (-1574.680) (-1574.068) -- 0:04:49
      17500 -- (-1574.085) (-1574.721) [-1568.665] (-1572.798) * (-1573.110) (-1572.741) [-1567.130] (-1573.529) -- 0:04:40
      18000 -- (-1578.135) [-1567.072] (-1567.579) (-1581.304) * (-1564.868) [-1566.367] (-1572.601) (-1566.097) -- 0:04:32
      18500 -- (-1578.315) (-1566.432) (-1567.127) [-1568.759] * (-1570.218) (-1575.399) (-1573.262) [-1570.029] -- 0:04:25
      19000 -- (-1574.477) (-1576.306) (-1578.736) [-1568.022] * (-1566.647) (-1571.946) (-1571.788) [-1579.892] -- 0:04:18
      19500 -- (-1570.637) (-1575.382) [-1565.484] (-1571.795) * [-1567.084] (-1572.919) (-1571.624) (-1574.183) -- 0:04:11
      20000 -- (-1571.825) (-1570.434) (-1573.179) [-1568.195] * (-1574.481) [-1570.125] (-1568.335) (-1574.075) -- 0:04:54

      Average standard deviation of split frequencies: 0.022810

      20500 -- (-1570.518) (-1570.831) (-1566.218) [-1569.542] * (-1567.055) (-1570.144) [-1563.253] (-1568.978) -- 0:04:46
      21000 -- (-1569.230) [-1572.536] (-1574.547) (-1566.457) * (-1571.517) (-1576.853) [-1576.221] (-1577.880) -- 0:04:39
      21500 -- (-1572.425) (-1566.490) [-1564.868] (-1569.178) * (-1577.072) [-1576.947] (-1574.417) (-1577.263) -- 0:04:33
      22000 -- (-1575.125) (-1565.980) [-1569.715] (-1569.137) * (-1578.214) [-1564.721] (-1577.853) (-1570.696) -- 0:04:26
      22500 -- (-1569.450) (-1568.169) [-1570.790] (-1567.267) * (-1572.307) (-1573.608) [-1574.309] (-1568.096) -- 0:04:20
      23000 -- (-1570.671) (-1576.915) [-1569.955] (-1576.131) * (-1563.306) (-1578.501) (-1569.928) [-1566.852] -- 0:04:14
      23500 -- (-1579.221) [-1565.310] (-1567.854) (-1572.196) * (-1574.506) (-1569.625) (-1573.576) [-1573.986] -- 0:04:50
      24000 -- (-1574.411) (-1576.886) (-1570.681) [-1569.832] * (-1569.748) (-1568.478) [-1570.728] (-1575.588) -- 0:04:44
      24500 -- (-1577.404) (-1571.524) (-1580.315) [-1566.582] * (-1575.526) (-1570.961) (-1574.789) [-1575.741] -- 0:04:38
      25000 -- [-1571.032] (-1573.796) (-1567.268) (-1567.486) * (-1574.708) (-1570.991) (-1568.502) [-1572.258] -- 0:04:33

      Average standard deviation of split frequencies: 0.036262

      25500 -- (-1576.306) (-1576.766) (-1571.774) [-1570.873] * (-1572.011) (-1570.606) (-1574.440) [-1571.190] -- 0:04:27
      26000 -- [-1579.073] (-1570.698) (-1571.932) (-1568.682) * (-1574.359) (-1575.811) [-1572.944] (-1574.963) -- 0:04:22
      26500 -- [-1571.881] (-1567.329) (-1564.592) (-1571.100) * [-1568.545] (-1571.174) (-1570.731) (-1574.869) -- 0:04:17
      27000 -- (-1574.482) [-1570.912] (-1576.899) (-1570.413) * [-1566.074] (-1576.626) (-1572.574) (-1572.527) -- 0:04:12
      27500 -- [-1567.323] (-1575.809) (-1569.653) (-1569.122) * [-1567.556] (-1568.318) (-1564.826) (-1569.015) -- 0:04:07
      28000 -- (-1568.083) (-1572.349) (-1565.363) [-1570.848] * (-1568.756) [-1571.843] (-1568.028) (-1571.445) -- 0:04:37
      28500 -- (-1574.679) (-1573.819) (-1570.557) [-1572.112] * (-1566.476) [-1570.727] (-1571.681) (-1573.744) -- 0:04:32
      29000 -- (-1569.526) (-1582.917) (-1579.385) [-1566.296] * (-1574.478) (-1569.548) (-1573.459) [-1565.254] -- 0:04:27
      29500 -- (-1567.732) (-1570.821) (-1587.437) [-1567.223] * (-1574.691) (-1570.378) (-1567.567) [-1576.531] -- 0:04:23
      30000 -- (-1572.463) [-1569.212] (-1580.794) (-1574.490) * [-1565.931] (-1572.044) (-1576.566) (-1573.797) -- 0:04:18

      Average standard deviation of split frequencies: 0.043554

      30500 -- [-1568.314] (-1567.556) (-1578.026) (-1582.716) * [-1572.671] (-1570.743) (-1569.938) (-1568.991) -- 0:04:14
      31000 -- (-1570.771) (-1576.972) (-1567.820) [-1569.889] * [-1571.981] (-1569.158) (-1578.930) (-1576.702) -- 0:04:10
      31500 -- [-1571.014] (-1570.031) (-1574.975) (-1570.121) * [-1575.645] (-1572.972) (-1579.030) (-1576.475) -- 0:04:05
      32000 -- (-1576.376) [-1574.338] (-1569.885) (-1571.494) * [-1565.940] (-1574.229) (-1576.208) (-1568.872) -- 0:04:02
      32500 -- (-1572.140) (-1574.435) [-1567.554] (-1574.752) * (-1570.025) [-1572.338] (-1565.180) (-1570.016) -- 0:03:58
      33000 -- (-1567.168) (-1575.747) (-1570.232) [-1574.426] * [-1570.451] (-1566.241) (-1567.603) (-1572.961) -- 0:04:23
      33500 -- (-1571.210) [-1573.896] (-1571.106) (-1572.478) * (-1568.343) (-1587.445) [-1567.280] (-1569.990) -- 0:04:19
      34000 -- (-1578.302) (-1573.417) [-1573.745] (-1566.548) * (-1570.226) (-1566.910) [-1566.649] (-1572.544) -- 0:04:15
      34500 -- [-1572.492] (-1568.465) (-1573.831) (-1572.156) * (-1571.046) (-1571.756) (-1571.928) [-1568.273] -- 0:04:11
      35000 -- (-1573.544) (-1575.957) (-1572.599) [-1569.683] * [-1569.382] (-1570.228) (-1571.829) (-1577.055) -- 0:04:08

      Average standard deviation of split frequencies: 0.037101

      35500 -- [-1567.336] (-1568.805) (-1574.844) (-1578.344) * (-1572.420) (-1570.959) [-1570.534] (-1569.032) -- 0:04:04
      36000 -- (-1573.498) (-1574.277) (-1568.682) [-1566.030] * (-1576.036) (-1575.612) [-1570.628] (-1581.589) -- 0:04:01
      36500 -- (-1568.040) [-1567.587] (-1573.895) (-1582.067) * (-1579.497) [-1573.047] (-1568.601) (-1565.251) -- 0:03:57
      37000 -- (-1579.025) (-1568.239) (-1571.495) [-1569.037] * [-1578.667] (-1568.809) (-1567.838) (-1573.002) -- 0:03:54
      37500 -- (-1569.286) [-1575.425] (-1571.371) (-1575.139) * (-1573.785) (-1568.126) [-1571.236] (-1567.669) -- 0:03:51
      38000 -- [-1568.426] (-1570.263) (-1569.730) (-1572.478) * [-1569.458] (-1571.516) (-1571.251) (-1568.886) -- 0:04:13
      38500 -- (-1577.712) (-1574.044) [-1568.833] (-1568.646) * (-1570.116) (-1577.348) (-1575.142) [-1575.461] -- 0:04:09
      39000 -- (-1576.766) (-1569.011) (-1571.832) [-1570.366] * [-1574.774] (-1573.793) (-1574.120) (-1569.391) -- 0:04:06
      39500 -- [-1576.221] (-1580.931) (-1575.027) (-1567.305) * [-1572.637] (-1564.497) (-1575.328) (-1569.941) -- 0:04:03
      40000 -- (-1566.596) (-1572.775) (-1571.632) [-1567.813] * (-1572.664) (-1575.161) [-1565.952] (-1574.635) -- 0:04:00

      Average standard deviation of split frequencies: 0.027048

      40500 -- (-1577.669) [-1571.588] (-1568.669) (-1572.391) * (-1570.728) (-1579.089) (-1566.292) [-1570.174] -- 0:03:56
      41000 -- [-1568.578] (-1577.156) (-1569.387) (-1567.704) * [-1574.612] (-1564.597) (-1570.859) (-1574.811) -- 0:03:53
      41500 -- (-1581.406) (-1568.834) [-1571.270] (-1573.922) * (-1571.105) (-1569.073) (-1571.874) [-1568.255] -- 0:03:50
      42000 -- (-1578.679) [-1570.383] (-1573.101) (-1576.055) * (-1579.800) [-1571.410] (-1568.401) (-1571.688) -- 0:03:48
      42500 -- (-1571.592) (-1565.896) [-1567.541] (-1582.400) * (-1575.906) (-1572.285) (-1579.225) [-1571.682] -- 0:04:07
      43000 -- (-1568.656) (-1566.644) [-1571.500] (-1573.100) * (-1574.052) [-1573.215] (-1564.663) (-1572.443) -- 0:04:04
      43500 -- (-1567.749) (-1566.649) [-1574.280] (-1582.074) * (-1566.799) (-1574.732) (-1572.847) [-1565.417] -- 0:04:01
      44000 -- [-1566.358] (-1578.930) (-1573.225) (-1569.825) * (-1566.374) (-1574.155) (-1567.500) [-1568.500] -- 0:03:59
      44500 -- (-1575.324) [-1567.179] (-1573.527) (-1578.831) * (-1573.386) [-1567.665] (-1568.882) (-1573.099) -- 0:03:56
      45000 -- (-1572.559) [-1570.742] (-1576.008) (-1571.017) * (-1573.618) (-1574.936) (-1578.158) [-1571.599] -- 0:03:53

      Average standard deviation of split frequencies: 0.017080

      45500 -- (-1568.018) (-1572.034) (-1572.013) [-1571.207] * [-1574.774] (-1571.349) (-1571.174) (-1570.134) -- 0:03:50
      46000 -- (-1576.777) (-1569.120) (-1575.553) [-1570.603] * (-1577.918) [-1568.951] (-1572.504) (-1570.455) -- 0:03:48
      46500 -- (-1576.673) (-1575.609) (-1571.993) [-1567.109] * (-1577.199) (-1568.944) (-1571.931) [-1565.832] -- 0:03:45
      47000 -- [-1570.889] (-1567.663) (-1570.175) (-1572.891) * [-1579.223] (-1565.027) (-1569.793) (-1572.433) -- 0:03:43
      47500 -- (-1575.518) (-1577.662) [-1569.425] (-1574.413) * (-1578.645) (-1568.681) (-1576.141) [-1565.964] -- 0:04:00
      48000 -- (-1570.712) (-1570.366) [-1571.927] (-1573.671) * (-1568.466) (-1567.626) [-1565.611] (-1577.305) -- 0:03:58
      48500 -- (-1573.300) (-1573.124) [-1571.095] (-1581.847) * (-1571.152) [-1572.307] (-1570.336) (-1570.359) -- 0:03:55
      49000 -- (-1571.571) (-1569.151) [-1568.288] (-1578.288) * [-1580.251] (-1573.067) (-1571.486) (-1565.640) -- 0:03:52
      49500 -- (-1574.286) (-1566.860) [-1564.762] (-1575.135) * (-1575.727) [-1572.795] (-1571.059) (-1565.242) -- 0:03:50
      50000 -- (-1569.844) (-1566.759) [-1573.177] (-1571.196) * (-1576.803) (-1570.362) [-1571.818] (-1572.680) -- 0:03:48

      Average standard deviation of split frequencies: 0.020159

      50500 -- (-1565.613) (-1567.242) (-1573.982) [-1571.123] * (-1574.520) [-1570.045] (-1575.842) (-1569.056) -- 0:03:45
      51000 -- (-1565.472) [-1573.058] (-1571.454) (-1571.620) * (-1572.055) (-1573.981) [-1569.318] (-1567.115) -- 0:03:43
      51500 -- (-1574.627) (-1566.355) [-1566.498] (-1571.254) * [-1574.062] (-1576.898) (-1569.043) (-1567.600) -- 0:03:41
      52000 -- [-1572.761] (-1570.089) (-1571.657) (-1576.616) * (-1582.117) (-1571.511) (-1571.520) [-1572.882] -- 0:03:38
      52500 -- [-1567.689] (-1569.078) (-1576.687) (-1571.275) * (-1575.173) [-1569.427] (-1570.482) (-1574.175) -- 0:03:54
      53000 -- (-1573.601) [-1571.515] (-1569.142) (-1567.484) * [-1572.384] (-1571.169) (-1573.292) (-1568.778) -- 0:03:52
      53500 -- (-1578.938) (-1575.879) [-1572.438] (-1574.941) * (-1569.481) (-1571.818) (-1577.437) [-1567.255] -- 0:03:49
      54000 -- (-1575.189) (-1570.830) (-1569.225) [-1570.852] * (-1578.648) (-1576.269) [-1569.969] (-1571.721) -- 0:03:47
      54500 -- (-1568.567) [-1571.363] (-1574.017) (-1570.402) * (-1569.928) (-1571.494) (-1566.339) [-1569.277] -- 0:03:45
      55000 -- (-1572.338) [-1573.106] (-1571.477) (-1573.178) * [-1567.132] (-1567.206) (-1563.618) (-1579.587) -- 0:03:43

      Average standard deviation of split frequencies: 0.021045

      55500 -- [-1569.082] (-1568.207) (-1567.481) (-1574.676) * [-1567.380] (-1568.115) (-1568.777) (-1571.084) -- 0:03:41
      56000 -- [-1572.287] (-1572.032) (-1571.912) (-1573.485) * (-1586.100) (-1565.297) (-1569.696) [-1568.521] -- 0:03:39
      56500 -- [-1569.347] (-1578.183) (-1572.564) (-1574.788) * (-1571.670) [-1563.531] (-1574.352) (-1570.966) -- 0:03:37
      57000 -- (-1572.741) [-1576.255] (-1570.217) (-1579.474) * (-1575.896) [-1571.296] (-1575.040) (-1570.278) -- 0:03:51
      57500 -- (-1572.173) (-1568.188) [-1571.865] (-1574.073) * (-1576.856) (-1575.575) [-1565.313] (-1570.667) -- 0:03:49
      58000 -- (-1573.656) [-1568.501] (-1572.832) (-1576.701) * (-1571.972) (-1567.119) [-1573.297] (-1577.043) -- 0:03:47
      58500 -- (-1573.709) [-1571.786] (-1570.513) (-1572.874) * (-1574.089) (-1570.347) (-1569.556) [-1571.297] -- 0:03:45
      59000 -- (-1572.848) [-1571.526] (-1570.251) (-1575.070) * (-1576.198) (-1568.929) [-1567.699] (-1571.030) -- 0:03:43
      59500 -- (-1578.393) (-1571.191) (-1571.532) [-1570.911] * (-1570.143) (-1569.731) [-1571.565] (-1575.747) -- 0:03:41
      60000 -- (-1571.622) (-1577.060) [-1566.769] (-1564.577) * [-1570.182] (-1568.663) (-1568.959) (-1570.820) -- 0:03:39

      Average standard deviation of split frequencies: 0.024606

      60500 -- (-1566.090) [-1570.763] (-1573.900) (-1568.638) * [-1570.026] (-1569.401) (-1574.428) (-1574.512) -- 0:03:37
      61000 -- (-1571.238) (-1574.449) (-1569.531) [-1572.567] * (-1574.357) (-1569.919) [-1573.243] (-1575.475) -- 0:03:35
      61500 -- [-1578.644] (-1574.474) (-1577.572) (-1577.869) * [-1571.816] (-1566.007) (-1576.522) (-1578.924) -- 0:03:33
      62000 -- (-1575.977) (-1567.539) [-1567.468] (-1580.886) * (-1575.990) (-1584.891) (-1570.338) [-1573.748] -- 0:03:46
      62500 -- (-1572.733) (-1570.226) [-1568.640] (-1570.769) * (-1578.260) (-1573.170) [-1566.441] (-1582.240) -- 0:03:45
      63000 -- (-1577.354) [-1572.775] (-1571.206) (-1571.693) * [-1570.380] (-1570.879) (-1570.904) (-1571.576) -- 0:03:43
      63500 -- (-1569.341) [-1565.664] (-1564.649) (-1576.146) * (-1573.824) [-1567.521] (-1568.176) (-1573.609) -- 0:03:41
      64000 -- (-1574.057) [-1566.617] (-1573.975) (-1578.439) * (-1578.545) (-1566.362) (-1567.936) [-1570.790] -- 0:03:39
      64500 -- [-1573.810] (-1568.027) (-1571.737) (-1574.778) * [-1569.417] (-1575.824) (-1574.637) (-1573.703) -- 0:03:37
      65000 -- (-1566.878) [-1572.694] (-1572.841) (-1576.599) * (-1574.889) (-1575.787) (-1568.795) [-1572.298] -- 0:03:35

      Average standard deviation of split frequencies: 0.023808

      65500 -- (-1579.215) [-1575.747] (-1574.202) (-1573.310) * (-1568.787) [-1575.214] (-1575.613) (-1575.410) -- 0:03:34
      66000 -- (-1568.156) [-1571.015] (-1569.699) (-1570.777) * (-1573.623) [-1572.366] (-1568.710) (-1581.139) -- 0:03:32
      66500 -- (-1571.491) (-1576.345) [-1576.127] (-1579.564) * (-1580.134) (-1567.099) [-1568.991] (-1577.411) -- 0:03:44
      67000 -- (-1574.261) [-1569.474] (-1571.784) (-1577.985) * [-1567.119] (-1568.969) (-1565.302) (-1580.961) -- 0:03:42
      67500 -- [-1573.668] (-1574.370) (-1571.732) (-1574.464) * (-1572.843) [-1572.993] (-1569.956) (-1575.931) -- 0:03:41
      68000 -- (-1582.049) (-1568.939) [-1570.988] (-1574.918) * (-1576.022) (-1580.401) [-1570.653] (-1568.745) -- 0:03:39
      68500 -- (-1576.764) [-1563.049] (-1572.693) (-1578.239) * [-1572.061] (-1582.256) (-1572.893) (-1568.389) -- 0:03:37
      69000 -- (-1577.355) (-1565.448) (-1571.242) [-1575.913] * (-1574.532) (-1581.906) [-1572.057] (-1569.982) -- 0:03:35
      69500 -- [-1570.561] (-1566.939) (-1575.867) (-1574.819) * (-1570.568) [-1578.395] (-1565.838) (-1568.573) -- 0:03:34
      70000 -- (-1574.505) [-1571.600] (-1570.751) (-1577.296) * (-1576.862) [-1578.859] (-1566.769) (-1578.399) -- 0:03:32

      Average standard deviation of split frequencies: 0.018901

      70500 -- (-1565.334) [-1567.541] (-1569.105) (-1572.022) * [-1575.825] (-1570.897) (-1567.824) (-1570.027) -- 0:03:30
      71000 -- (-1564.321) (-1573.299) [-1570.321] (-1572.318) * (-1567.983) [-1571.461] (-1568.257) (-1574.679) -- 0:03:29
      71500 -- (-1570.461) (-1571.126) [-1568.469] (-1571.930) * (-1577.760) (-1572.497) [-1567.754] (-1569.431) -- 0:03:40
      72000 -- (-1585.110) [-1569.960] (-1571.290) (-1567.706) * [-1570.774] (-1575.494) (-1569.960) (-1571.508) -- 0:03:39
      72500 -- (-1571.592) [-1570.854] (-1570.015) (-1564.925) * (-1568.269) (-1573.284) [-1575.567] (-1568.124) -- 0:03:37
      73000 -- [-1573.342] (-1572.361) (-1569.281) (-1570.876) * (-1567.249) (-1568.979) [-1569.034] (-1569.727) -- 0:03:35
      73500 -- (-1576.655) (-1569.992) [-1565.479] (-1572.777) * [-1568.460] (-1567.666) (-1572.720) (-1574.572) -- 0:03:34
      74000 -- (-1569.738) (-1566.843) [-1576.535] (-1575.168) * [-1565.759] (-1575.518) (-1575.014) (-1574.120) -- 0:03:32
      74500 -- (-1569.278) (-1567.860) [-1571.354] (-1570.275) * (-1567.987) (-1574.636) [-1571.504] (-1574.621) -- 0:03:31
      75000 -- (-1577.800) [-1566.419] (-1583.685) (-1567.874) * (-1567.727) [-1569.392] (-1576.757) (-1568.950) -- 0:03:29

      Average standard deviation of split frequencies: 0.019642

      75500 -- (-1569.822) (-1570.457) [-1574.990] (-1568.557) * (-1571.657) [-1574.750] (-1569.066) (-1576.777) -- 0:03:28
      76000 -- (-1571.785) [-1569.988] (-1573.208) (-1586.957) * (-1571.204) [-1567.326] (-1574.819) (-1567.582) -- 0:03:38
      76500 -- (-1574.000) (-1575.858) (-1586.461) [-1571.596] * [-1576.219] (-1567.506) (-1571.506) (-1571.511) -- 0:03:37
      77000 -- (-1571.328) [-1571.518] (-1575.006) (-1573.681) * (-1569.404) [-1566.454] (-1574.033) (-1568.165) -- 0:03:35
      77500 -- (-1570.580) (-1581.164) (-1575.912) [-1570.187] * (-1577.764) [-1566.145] (-1573.961) (-1567.918) -- 0:03:34
      78000 -- (-1570.565) (-1581.620) [-1571.926] (-1575.574) * [-1572.631] (-1572.257) (-1577.217) (-1568.348) -- 0:03:32
      78500 -- (-1569.731) (-1574.423) (-1572.457) [-1571.574] * (-1584.041) [-1571.985] (-1571.551) (-1580.426) -- 0:03:31
      79000 -- [-1565.616] (-1582.942) (-1568.763) (-1576.621) * (-1573.192) (-1573.648) [-1575.974] (-1581.963) -- 0:03:29
      79500 -- (-1576.351) [-1572.844] (-1575.798) (-1575.564) * (-1577.336) (-1573.708) [-1574.922] (-1576.802) -- 0:03:28
      80000 -- [-1575.238] (-1574.156) (-1571.685) (-1571.853) * [-1573.330] (-1571.568) (-1582.036) (-1579.659) -- 0:03:27

      Average standard deviation of split frequencies: 0.020454

      80500 -- (-1571.897) (-1576.888) [-1569.376] (-1575.245) * (-1573.663) [-1575.067] (-1571.785) (-1570.786) -- 0:03:25
      81000 -- (-1566.153) (-1582.630) [-1572.402] (-1570.489) * (-1573.787) (-1571.312) (-1573.721) [-1566.436] -- 0:03:35
      81500 -- (-1575.260) [-1587.675] (-1579.828) (-1571.123) * (-1568.153) [-1568.796] (-1578.450) (-1571.103) -- 0:03:34
      82000 -- (-1569.493) (-1574.406) (-1574.826) [-1568.325] * (-1565.835) (-1566.982) [-1569.523] (-1568.071) -- 0:03:32
      82500 -- (-1569.681) [-1572.932] (-1570.332) (-1570.733) * (-1569.577) (-1569.456) [-1571.460] (-1572.429) -- 0:03:31
      83000 -- (-1576.013) (-1577.709) [-1567.418] (-1568.275) * (-1572.732) [-1569.980] (-1569.568) (-1578.073) -- 0:03:29
      83500 -- (-1573.693) (-1572.746) (-1573.810) [-1571.187] * (-1574.662) (-1568.419) [-1567.867] (-1568.063) -- 0:03:28
      84000 -- [-1570.617] (-1571.636) (-1579.078) (-1566.620) * (-1566.537) (-1574.212) (-1571.956) [-1567.820] -- 0:03:27
      84500 -- (-1567.834) (-1575.323) (-1570.208) [-1568.402] * (-1571.232) (-1568.543) (-1574.646) [-1568.557] -- 0:03:25
      85000 -- (-1569.733) (-1575.924) [-1570.201] (-1572.104) * (-1569.151) (-1572.703) [-1567.313] (-1568.778) -- 0:03:24

      Average standard deviation of split frequencies: 0.023753

      85500 -- [-1566.617] (-1565.215) (-1578.544) (-1572.011) * (-1572.489) (-1567.014) (-1573.311) [-1573.760] -- 0:03:23
      86000 -- (-1570.114) (-1572.502) [-1571.440] (-1575.238) * (-1576.844) (-1575.386) (-1569.517) [-1572.764] -- 0:03:32
      86500 -- (-1575.178) (-1572.659) (-1573.700) [-1570.739] * [-1566.746] (-1572.046) (-1567.617) (-1570.786) -- 0:03:31
      87000 -- [-1563.767] (-1577.513) (-1576.516) (-1570.489) * [-1565.784] (-1578.949) (-1570.917) (-1572.514) -- 0:03:29
      87500 -- (-1571.682) (-1571.326) [-1564.689] (-1570.239) * (-1570.732) (-1569.164) [-1565.786] (-1571.024) -- 0:03:28
      88000 -- [-1569.187] (-1576.000) (-1571.845) (-1572.007) * (-1585.025) (-1568.024) [-1573.729] (-1574.371) -- 0:03:27
      88500 -- (-1576.582) (-1577.070) (-1570.759) [-1567.658] * (-1569.177) [-1561.110] (-1576.348) (-1573.793) -- 0:03:25
      89000 -- (-1574.523) [-1571.237] (-1572.945) (-1572.625) * (-1573.351) [-1565.376] (-1576.688) (-1574.412) -- 0:03:24
      89500 -- (-1573.846) (-1577.568) [-1569.245] (-1570.033) * (-1566.174) [-1568.713] (-1570.961) (-1574.365) -- 0:03:23
      90000 -- (-1566.883) [-1569.140] (-1583.586) (-1568.433) * (-1567.737) (-1573.974) [-1568.120] (-1571.082) -- 0:03:22

      Average standard deviation of split frequencies: 0.015598

      90500 -- [-1568.966] (-1563.677) (-1570.006) (-1572.306) * (-1570.374) [-1569.941] (-1579.977) (-1573.144) -- 0:03:31
      91000 -- (-1570.105) (-1567.479) (-1568.361) [-1570.713] * (-1568.772) [-1568.545] (-1578.800) (-1578.013) -- 0:03:29
      91500 -- (-1572.728) (-1572.590) (-1574.783) [-1569.474] * (-1576.514) [-1569.255] (-1572.073) (-1569.043) -- 0:03:28
      92000 -- (-1567.721) (-1573.886) (-1569.614) [-1570.273] * (-1575.499) (-1573.683) [-1572.504] (-1571.844) -- 0:03:27
      92500 -- (-1576.831) [-1569.173] (-1572.653) (-1570.241) * [-1569.439] (-1573.888) (-1572.727) (-1565.263) -- 0:03:26
      93000 -- [-1573.400] (-1569.262) (-1568.296) (-1570.810) * [-1571.782] (-1572.015) (-1573.514) (-1565.655) -- 0:03:24
      93500 -- (-1571.651) (-1566.368) [-1566.948] (-1576.724) * (-1568.418) (-1572.990) [-1571.970] (-1579.600) -- 0:03:23
      94000 -- (-1574.203) (-1567.716) (-1573.088) [-1570.456] * (-1571.002) (-1571.841) [-1568.358] (-1572.331) -- 0:03:22
      94500 -- (-1571.386) (-1575.493) [-1574.827] (-1570.274) * (-1565.735) (-1578.666) [-1577.440] (-1576.655) -- 0:03:21
      95000 -- (-1572.617) (-1573.733) [-1566.119] (-1568.783) * (-1569.698) [-1575.089] (-1576.219) (-1572.431) -- 0:03:20

      Average standard deviation of split frequencies: 0.009821

      95500 -- [-1574.385] (-1573.823) (-1574.543) (-1578.105) * (-1573.503) (-1575.586) [-1572.236] (-1573.577) -- 0:03:28
      96000 -- (-1573.037) (-1575.173) (-1574.930) [-1568.249] * (-1566.362) (-1578.414) (-1574.630) [-1572.241] -- 0:03:27
      96500 -- (-1575.622) (-1567.781) (-1574.171) [-1568.453] * (-1567.538) [-1570.097] (-1572.533) (-1573.176) -- 0:03:25
      97000 -- (-1580.161) (-1577.825) [-1575.309] (-1566.683) * (-1575.507) (-1573.545) [-1565.519] (-1572.001) -- 0:03:24
      97500 -- (-1574.030) [-1572.004] (-1568.646) (-1569.655) * (-1570.612) (-1573.999) [-1569.723] (-1573.071) -- 0:03:23
      98000 -- [-1573.718] (-1569.176) (-1576.081) (-1576.615) * (-1567.935) (-1571.034) [-1571.134] (-1575.169) -- 0:03:22
      98500 -- [-1580.215] (-1569.302) (-1576.216) (-1570.613) * (-1571.501) [-1577.442] (-1571.086) (-1573.586) -- 0:03:21
      99000 -- (-1570.700) [-1565.222] (-1575.411) (-1568.330) * (-1570.209) [-1568.754] (-1568.871) (-1572.320) -- 0:03:20
      99500 -- (-1570.422) [-1567.934] (-1573.372) (-1573.797) * (-1573.559) (-1572.594) [-1569.715] (-1570.467) -- 0:03:19
      100000 -- (-1569.632) [-1566.118] (-1569.440) (-1566.292) * (-1573.078) (-1570.516) [-1567.490] (-1571.703) -- 0:03:18

      Average standard deviation of split frequencies: 0.010146

      100500 -- [-1563.887] (-1574.392) (-1570.917) (-1576.977) * [-1566.329] (-1565.787) (-1572.802) (-1573.321) -- 0:03:25
      101000 -- (-1572.497) (-1581.894) [-1568.924] (-1572.544) * [-1570.103] (-1571.650) (-1572.462) (-1573.460) -- 0:03:24
      101500 -- [-1568.204] (-1570.627) (-1578.056) (-1570.180) * (-1568.178) [-1569.311] (-1567.592) (-1570.315) -- 0:03:23
      102000 -- (-1575.047) (-1572.340) [-1565.497] (-1570.320) * [-1566.088] (-1572.591) (-1582.929) (-1574.255) -- 0:03:22
      102500 -- [-1570.793] (-1575.120) (-1576.314) (-1565.620) * (-1571.781) [-1571.196] (-1576.118) (-1572.830) -- 0:03:21
      103000 -- [-1568.689] (-1573.374) (-1568.838) (-1570.329) * (-1568.309) (-1570.561) [-1569.943] (-1567.566) -- 0:03:20
      103500 -- (-1567.492) (-1568.144) (-1574.835) [-1569.450] * [-1571.033] (-1568.351) (-1574.670) (-1567.183) -- 0:03:19
      104000 -- (-1572.055) [-1572.251] (-1576.810) (-1570.936) * [-1564.872] (-1570.980) (-1576.897) (-1567.129) -- 0:03:18
      104500 -- (-1572.043) [-1570.536] (-1581.893) (-1566.938) * (-1572.818) (-1574.262) [-1566.997] (-1577.233) -- 0:03:17
      105000 -- (-1569.714) (-1575.324) (-1580.821) [-1566.573] * (-1574.685) (-1569.250) [-1573.425] (-1569.950) -- 0:03:16

      Average standard deviation of split frequencies: 0.006671

      105500 -- (-1574.748) (-1573.844) [-1572.504] (-1570.856) * (-1575.374) (-1574.954) (-1572.612) [-1567.900] -- 0:03:23
      106000 -- [-1565.349] (-1572.916) (-1572.860) (-1573.197) * (-1580.272) [-1569.584] (-1570.759) (-1574.838) -- 0:03:22
      106500 -- [-1570.967] (-1573.151) (-1570.042) (-1579.777) * (-1575.429) [-1569.709] (-1576.870) (-1574.989) -- 0:03:21
      107000 -- (-1567.646) (-1574.176) (-1572.988) [-1582.075] * (-1568.692) (-1569.207) (-1572.738) [-1573.427] -- 0:03:20
      107500 -- (-1569.548) [-1578.267] (-1571.483) (-1581.703) * [-1570.326] (-1569.437) (-1580.092) (-1573.648) -- 0:03:19
      108000 -- [-1568.743] (-1575.316) (-1571.232) (-1576.717) * (-1578.724) (-1572.799) [-1572.966] (-1575.352) -- 0:03:18
      108500 -- (-1574.444) (-1571.471) [-1570.054] (-1574.900) * (-1572.060) (-1569.536) (-1572.110) [-1576.569] -- 0:03:17
      109000 -- [-1575.002] (-1577.522) (-1567.595) (-1573.884) * (-1572.799) (-1572.673) (-1572.645) [-1573.938] -- 0:03:16
      109500 -- (-1574.016) [-1571.986] (-1581.153) (-1570.973) * (-1571.508) [-1570.565] (-1569.852) (-1568.703) -- 0:03:15
      110000 -- (-1571.749) [-1569.413] (-1570.314) (-1582.482) * (-1579.943) (-1571.252) [-1572.573] (-1567.176) -- 0:03:22

      Average standard deviation of split frequencies: 0.011359

      110500 -- (-1572.940) [-1574.963] (-1566.390) (-1570.487) * (-1576.074) [-1571.105] (-1573.620) (-1575.187) -- 0:03:21
      111000 -- (-1566.768) (-1586.020) (-1570.095) [-1567.258] * [-1570.814] (-1574.051) (-1579.065) (-1571.982) -- 0:03:20
      111500 -- [-1573.186] (-1571.322) (-1573.718) (-1567.011) * [-1570.831] (-1572.651) (-1580.123) (-1575.691) -- 0:03:19
      112000 -- (-1578.276) (-1575.113) [-1570.545] (-1567.764) * (-1572.134) (-1574.869) (-1572.736) [-1571.826] -- 0:03:18
      112500 -- (-1585.083) (-1576.872) [-1570.217] (-1568.691) * (-1574.473) [-1569.016] (-1568.826) (-1573.979) -- 0:03:17
      113000 -- (-1571.837) (-1566.411) (-1573.154) [-1570.131] * (-1574.518) (-1570.223) [-1572.529] (-1583.254) -- 0:03:16
      113500 -- (-1576.880) [-1571.093] (-1573.712) (-1575.199) * (-1572.097) (-1571.411) [-1564.393] (-1574.079) -- 0:03:15
      114000 -- (-1570.636) (-1578.692) (-1573.695) [-1570.841] * [-1572.861] (-1570.226) (-1568.877) (-1568.704) -- 0:03:14
      114500 -- (-1570.480) (-1569.774) [-1574.467] (-1576.469) * (-1567.623) (-1576.197) [-1567.195] (-1567.586) -- 0:03:13
      115000 -- [-1573.109] (-1572.522) (-1571.183) (-1567.040) * (-1570.902) (-1572.648) [-1571.539] (-1567.816) -- 0:03:20

      Average standard deviation of split frequencies: 0.011514

      115500 -- (-1583.430) (-1571.430) [-1568.394] (-1567.357) * (-1571.859) [-1569.355] (-1576.571) (-1569.109) -- 0:03:19
      116000 -- (-1576.914) [-1570.143] (-1574.653) (-1576.145) * (-1572.318) (-1568.974) (-1569.849) [-1565.763] -- 0:03:18
      116500 -- (-1572.311) [-1565.637] (-1578.852) (-1566.446) * [-1567.791] (-1571.852) (-1568.703) (-1575.980) -- 0:03:17
      117000 -- (-1576.624) (-1571.570) (-1574.020) [-1576.581] * [-1570.559] (-1570.075) (-1577.252) (-1568.715) -- 0:03:16
      117500 -- (-1573.680) (-1570.604) (-1568.667) [-1578.884] * (-1564.881) [-1571.935] (-1570.198) (-1569.009) -- 0:03:15
      118000 -- (-1579.635) (-1567.375) (-1568.938) [-1570.682] * [-1569.169] (-1564.694) (-1573.330) (-1567.737) -- 0:03:14
      118500 -- (-1578.993) [-1567.015] (-1570.286) (-1578.057) * (-1567.753) [-1571.647] (-1570.644) (-1575.542) -- 0:03:13
      119000 -- (-1576.345) [-1566.079] (-1580.295) (-1572.633) * (-1568.396) (-1570.459) (-1580.466) [-1568.057] -- 0:03:19
      119500 -- (-1575.116) [-1568.810] (-1577.825) (-1568.620) * (-1569.019) (-1576.318) [-1573.356] (-1572.162) -- 0:03:18
      120000 -- (-1573.432) (-1572.133) [-1572.630] (-1572.659) * [-1567.281] (-1580.225) (-1575.539) (-1573.792) -- 0:03:18

      Average standard deviation of split frequencies: 0.009767

      120500 -- [-1577.161] (-1568.265) (-1577.531) (-1571.670) * (-1568.478) (-1578.410) [-1572.926] (-1574.884) -- 0:03:17
      121000 -- (-1579.570) [-1572.901] (-1572.046) (-1574.543) * (-1574.626) [-1572.115] (-1573.214) (-1577.221) -- 0:03:16
      121500 -- [-1568.999] (-1575.993) (-1574.998) (-1580.804) * (-1571.739) (-1567.172) (-1579.820) [-1565.495] -- 0:03:15
      122000 -- (-1568.264) (-1576.051) (-1573.853) [-1573.096] * (-1569.591) [-1572.558] (-1577.538) (-1576.507) -- 0:03:14
      122500 -- (-1574.765) (-1585.156) (-1575.504) [-1577.459] * (-1574.994) [-1569.272] (-1574.931) (-1569.566) -- 0:03:13
      123000 -- (-1564.105) (-1584.281) (-1580.474) [-1569.255] * (-1575.878) [-1570.170] (-1575.602) (-1571.668) -- 0:03:19
      123500 -- [-1571.556] (-1576.773) (-1574.975) (-1568.487) * (-1575.715) [-1570.137] (-1572.680) (-1570.131) -- 0:03:18
      124000 -- (-1566.294) [-1579.161] (-1574.078) (-1569.802) * [-1571.142] (-1575.632) (-1571.167) (-1573.564) -- 0:03:17
      124500 -- (-1569.751) (-1580.061) (-1570.417) [-1567.308] * [-1574.464] (-1573.141) (-1577.648) (-1567.685) -- 0:03:16
      125000 -- [-1573.077] (-1576.648) (-1569.394) (-1569.150) * [-1566.567] (-1575.402) (-1567.063) (-1573.282) -- 0:03:16

      Average standard deviation of split frequencies: 0.009353

      125500 -- (-1569.175) (-1580.593) (-1576.569) [-1569.724] * [-1575.474] (-1572.333) (-1572.691) (-1573.807) -- 0:03:15
      126000 -- (-1566.014) (-1576.283) (-1575.809) [-1573.271] * (-1567.751) (-1569.497) (-1575.791) [-1568.739] -- 0:03:14
      126500 -- (-1573.284) (-1572.089) (-1574.587) [-1576.895] * (-1569.063) (-1572.519) [-1572.830] (-1567.831) -- 0:03:13
      127000 -- (-1574.042) (-1576.781) [-1568.747] (-1569.334) * (-1574.990) [-1568.107] (-1576.740) (-1573.107) -- 0:03:12
      127500 -- (-1575.333) [-1572.046] (-1575.292) (-1564.523) * [-1573.105] (-1568.429) (-1575.717) (-1570.821) -- 0:03:11
      128000 -- (-1568.033) [-1572.326] (-1564.460) (-1574.044) * (-1574.599) [-1573.703] (-1575.724) (-1575.687) -- 0:03:17
      128500 -- (-1574.657) [-1570.513] (-1567.600) (-1572.973) * [-1567.932] (-1574.665) (-1568.893) (-1581.029) -- 0:03:16
      129000 -- (-1569.905) [-1569.881] (-1573.970) (-1566.730) * (-1566.656) (-1566.690) [-1567.541] (-1581.816) -- 0:03:15
      129500 -- (-1571.961) [-1568.292] (-1564.384) (-1566.954) * (-1573.551) (-1568.350) (-1565.813) [-1570.481] -- 0:03:14
      130000 -- [-1570.041] (-1567.635) (-1568.214) (-1567.300) * (-1572.035) (-1573.142) (-1565.361) [-1570.547] -- 0:03:14

      Average standard deviation of split frequencies: 0.010823

      130500 -- (-1571.953) (-1579.599) (-1571.723) [-1574.042] * (-1572.560) [-1578.404] (-1569.172) (-1571.911) -- 0:03:13
      131000 -- [-1569.712] (-1570.140) (-1569.090) (-1571.067) * (-1574.054) (-1566.602) [-1569.110] (-1569.475) -- 0:03:12
      131500 -- [-1566.355] (-1567.633) (-1575.780) (-1568.038) * (-1570.443) [-1567.016] (-1568.281) (-1562.850) -- 0:03:11
      132000 -- (-1571.095) (-1577.511) (-1579.020) [-1570.912] * (-1568.792) (-1568.387) (-1567.974) [-1567.087] -- 0:03:10
      132500 -- (-1573.433) (-1567.568) (-1573.042) [-1567.838] * (-1567.179) (-1576.066) (-1567.880) [-1574.470] -- 0:03:09
      133000 -- (-1569.207) (-1572.487) [-1580.123] (-1576.928) * [-1567.994] (-1565.775) (-1576.442) (-1574.170) -- 0:03:15
      133500 -- (-1569.662) (-1570.899) (-1571.907) [-1566.854] * (-1572.836) (-1568.769) [-1573.315] (-1573.081) -- 0:03:14
      134000 -- [-1568.542] (-1577.805) (-1573.162) (-1574.710) * (-1571.132) (-1575.593) (-1573.520) [-1573.701] -- 0:03:13
      134500 -- (-1570.705) (-1577.892) [-1577.703] (-1573.017) * [-1572.492] (-1570.959) (-1581.116) (-1581.204) -- 0:03:13
      135000 -- (-1577.490) (-1579.932) [-1566.749] (-1578.239) * (-1580.281) (-1566.373) [-1577.599] (-1574.306) -- 0:03:12

      Average standard deviation of split frequencies: 0.008088

      135500 -- (-1574.140) (-1574.501) [-1571.327] (-1577.379) * (-1581.804) (-1583.349) (-1570.189) [-1575.085] -- 0:03:11
      136000 -- (-1576.516) (-1