--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Nov 03 10:41:38 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/132/CG34424-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1566.80 -1577.28
2 -1567.01 -1576.49
--------------------------------------
TOTAL -1566.90 -1576.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.706752 0.016810 0.478873 0.971231 0.692624 986.17 1036.44 1.000
r(A<->C){all} 0.069834 0.000890 0.020878 0.134702 0.066466 756.73 771.81 1.001
r(A<->G){all} 0.186193 0.002422 0.098272 0.282881 0.181994 654.59 691.76 1.000
r(A<->T){all} 0.070334 0.002049 0.000042 0.154521 0.063758 470.83 556.89 1.000
r(C<->G){all} 0.059906 0.000552 0.016792 0.105600 0.057813 615.13 730.67 1.001
r(C<->T){all} 0.496880 0.004946 0.364222 0.630053 0.497758 654.17 734.86 1.000
r(G<->T){all} 0.116852 0.001566 0.046636 0.197452 0.113309 864.31 889.80 1.000
pi(A){all} 0.231597 0.000260 0.200752 0.263432 0.231553 1222.24 1285.31 1.000
pi(C){all} 0.295902 0.000306 0.262798 0.330867 0.295252 981.73 992.38 1.000
pi(G){all} 0.316560 0.000321 0.281715 0.351506 0.315815 754.23 981.55 1.000
pi(T){all} 0.155941 0.000188 0.131238 0.184362 0.155600 834.51 925.97 1.000
alpha{1,2} 0.109005 0.001536 0.013855 0.178348 0.110496 893.76 899.40 1.000
alpha{3} 1.879653 0.549239 0.636073 3.330932 1.770550 1170.37 1184.78 1.000
pinvar{all} 0.468581 0.005955 0.316441 0.602830 0.476896 879.89 887.81 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1480.313209
Model 2: PositiveSelection -1480.313209
Model 0: one-ratio -1490.745894
Model 3: discrete -1476.413374
Model 7: beta -1476.535763
Model 8: beta&w>1 -1476.535886
Model 0 vs 1 20.865369999999984
Model 2 vs 1 0.0
Model 8 vs 7 2.459999996062834E-4
>C1
MAATIQNTLKVALRKRMKDALKGIDAEAIARQSQAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMEEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C2
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNKELPMESHDVRLHGVITE
N
>C3
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C4
MAATIQNSLKVALRKRIKDALKGIDAEAIARQSQAVTSKVLQSEVFRQAQ
RVSIYLSTASELDTTALISEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPPTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHADKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
o
>C5
MAATIQNSLKVALRKRIKDALKSIDPEAIARQSQAVTAKVLQSEIFRHAQ
RVSIYLSTTSELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVNNEELPMESHDVRLHSVITE
o
>C6
MAATIQNSLKVALRGRMKDALKGLDAETIARQSRAVTAKVLQSEVFRQAQ
RVSIYLSTASELDTTALLLEMFRLEKMVFVPTYEGSKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGGRMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMESHDVRLHSVITE
N
>C7
MAATIQNTLKVALRKRMKDALKNLDTEAIARQSRAVTAKVLQSEFFRQAT
RVSIYLSTASEVDTTALLCEMFRLEKMVFVPTYEGTKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRTGARMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMETHDVRLHSVITE
N
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=201
C1 MAATIQNTLKVALRKRMKDALKGIDAEAIARQSQAVTAKVLQSEIFRQAQ
C2 MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
C3 MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
C4 MAATIQNSLKVALRKRIKDALKGIDAEAIARQSQAVTSKVLQSEVFRQAQ
C5 MAATIQNSLKVALRKRIKDALKSIDPEAIARQSQAVTAKVLQSEIFRHAQ
C6 MAATIQNSLKVALRGRMKDALKGLDAETIARQSRAVTAKVLQSEVFRQAQ
C7 MAATIQNTLKVALRKRMKDALKNLDTEAIARQSRAVTAKVLQSEFFRQAT
*******:****** *:*****.:*.::*****:***:******.**:*
C1 RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMEEYE
C2 RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
C3 RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
C4 RVSIYLSTASELDTTALISEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
C5 RVSIYLSTTSELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
C6 RVSIYLSTASELDTTALLLEMFRLEKMVFVPTYEGSKMKMVRLRGMDEYE
C7 RVSIYLSTASEVDTTALLCEMFRLEKMVFVPTYEGTKMKMVRLRGMDEYE
********:**:*****: ****************::*********:***
C1 SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
C2 SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
C3 SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
C4 SLPPTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
C5 SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
C6 SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGGRMGHGMG
C7 SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRTGARMGHGMG
*** ************************************ *.*******
C1 YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
C2 YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNKELPMESHDVRLHGVITE
C3 YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
C4 YYDKFLKQHADKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
C5 YYDKFLKQHAEKYPHKKISLMALSLNEQIVNNEELPMESHDVRLHSVITE
C6 YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMESHDVRLHSVITE
C7 YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMETHDVRLHSVITE
**********:************:******.*:*****:******.****
C1 N
C2 N
C3 N
C4 o
C5 o
C6 N
C7 N
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8442]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [8442]--->[8442]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/132/CG34424-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.379 Mb, Max= 30.690 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MAATIQNTLKVALRKRMKDALKGIDAEAIARQSQAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMEEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C2
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNKELPMESHDVRLHGVITE
N
>C3
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C4
MAATIQNSLKVALRKRIKDALKGIDAEAIARQSQAVTSKVLQSEVFRQAQ
RVSIYLSTASELDTTALISEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPPTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHADKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
o
>C5
MAATIQNSLKVALRKRIKDALKSIDPEAIARQSQAVTAKVLQSEIFRHAQ
RVSIYLSTTSELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVNNEELPMESHDVRLHSVITE
o
>C6
MAATIQNSLKVALRGRMKDALKGLDAETIARQSRAVTAKVLQSEVFRQAQ
RVSIYLSTASELDTTALLLEMFRLEKMVFVPTYEGSKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGGRMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMESHDVRLHSVITE
N
>C7
MAATIQNTLKVALRKRMKDALKNLDTEAIARQSRAVTAKVLQSEFFRQAT
RVSIYLSTASEVDTTALLCEMFRLEKMVFVPTYEGTKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRTGARMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMETHDVRLHSVITE
N
FORMAT of file /tmp/tmp9155994204849441538aln Not Supported[FATAL:T-COFFEE]
>C1
MAATIQNTLKVALRKRMKDALKGIDAEAIARQSQAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMEEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C2
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNKELPMESHDVRLHGVITE
N
>C3
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C4
MAATIQNSLKVALRKRIKDALKGIDAEAIARQSQAVTSKVLQSEVFRQAQ
RVSIYLSTASELDTTALISEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPPTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHADKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
o
>C5
MAATIQNSLKVALRKRIKDALKSIDPEAIARQSQAVTAKVLQSEIFRHAQ
RVSIYLSTTSELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVNNEELPMESHDVRLHSVITE
o
>C6
MAATIQNSLKVALRGRMKDALKGLDAETIARQSRAVTAKVLQSEVFRQAQ
RVSIYLSTASELDTTALLLEMFRLEKMVFVPTYEGSKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGGRMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMESHDVRLHSVITE
N
>C7
MAATIQNTLKVALRKRMKDALKNLDTEAIARQSRAVTAKVLQSEFFRQAT
RVSIYLSTASEVDTTALLCEMFRLEKMVFVPTYEGTKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRTGARMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMETHDVRLHSVITE
N
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:201 S:100 BS:201
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# PW_SEQ_DISTANCES
BOT 0 1 97.01 C1 C2 97.01
TOP 1 0 97.01 C2 C1 97.01
BOT 0 2 98.01 C1 C3 98.01
TOP 2 0 98.01 C3 C1 98.01
BOT 0 3 95.52 C1 C4 95.52
TOP 3 0 95.52 C4 C1 95.52
BOT 0 4 95.52 C1 C5 95.52
TOP 4 0 95.52 C5 C1 95.52
BOT 0 5 94.03 C1 C6 94.03
TOP 5 0 94.03 C6 C1 94.03
BOT 0 6 92.54 C1 C7 92.54
TOP 6 0 92.54 C7 C1 92.54
BOT 1 2 99.00 C2 C3 99.00
TOP 2 1 99.00 C3 C2 99.00
BOT 1 3 94.53 C2 C4 94.53
TOP 3 1 94.53 C4 C2 94.53
BOT 1 4 94.53 C2 C5 94.53
TOP 4 1 94.53 C5 C2 94.53
BOT 1 5 93.53 C2 C6 93.53
TOP 5 1 93.53 C6 C2 93.53
BOT 1 6 91.04 C2 C7 91.04
TOP 6 1 91.04 C7 C2 91.04
BOT 2 3 95.52 C3 C4 95.52
TOP 3 2 95.52 C4 C3 95.52
BOT 2 4 95.52 C3 C5 95.52
TOP 4 2 95.52 C5 C3 95.52
BOT 2 5 94.53 C3 C6 94.53
TOP 5 2 94.53 C6 C3 94.53
BOT 2 6 92.04 C3 C7 92.04
TOP 6 2 92.04 C7 C3 92.04
BOT 3 4 95.02 C4 C5 95.02
TOP 4 3 95.02 C5 C4 95.02
BOT 3 5 93.53 C4 C6 93.53
TOP 5 3 93.53 C6 C4 93.53
BOT 3 6 90.55 C4 C7 90.55
TOP 6 3 90.55 C7 C4 90.55
BOT 4 5 91.54 C5 C6 91.54
TOP 5 4 91.54 C6 C5 91.54
BOT 4 6 90.05 C5 C7 90.05
TOP 6 4 90.05 C7 C5 90.05
BOT 5 6 93.53 C6 C7 93.53
TOP 6 5 93.53 C7 C6 93.53
AVG 0 C1 * 95.44
AVG 1 C2 * 94.94
AVG 2 C3 * 95.77
AVG 3 C4 * 94.11
AVG 4 C5 * 93.70
AVG 5 C6 * 93.45
AVG 6 C7 * 91.63
TOT TOT * 94.15
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCGGCCACGATCCAGAACACCCTGAAGGTGGCGCTGCGAAAGCGCAT
C2 ATGGCGGCCACGATCCAGAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
C3 ATGGCGGCCACGATCCAGAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
C4 ATGGCAGCCACGATCCAAAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
C5 ATGGCGGCCACGATCCAAAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
C6 ATGGCGGCTACAATCCAGAATAGTCTCAAAGTGGCGCTGAGGGGGCGCAT
C7 ATGGCGGCTACTATCCAAAACACCCTCAAAGTGGCGCTGAGGAAGCGCAT
*****.** ** *****.** * ** **.*********.*...******
C1 GAAGGATGCACTGAAGGGCATCGACGCGGAGGCCATCGCCCGGCAGTCGC
C2 GAAGGATGCACTGAAGGGCATCGACGCGGATGCCATCGCCCGGCAGTCGC
C3 GAAGGATGCACTGAAGGGCATCGACGCGGATGCCATCGCCCGGCAGTCGC
C4 TAAGGATGCACTGAAGGGCATCGACGCGGAGGCCATCGCTCGGCAGTCGC
C5 AAAGGATGCACTGAAGAGCATCGACCCGGAGGCTATCGCCCGGCAATCCC
C6 GAAGGATGCGCTCAAGGGCCTGGACGCGGAGACCATTGCCCGGCAATCCC
C7 GAAGGATGCCCTCAAAAACCTGGACACGGAGGCCATTGCCCGGCAATCTC
******** ** **...*.* *** **** .* ** ** *****.** *
C1 AGGCCGTCACGGCTAAGGTGCTGCAAAGCGAGATCTTCCGGCAGGCGCAG
C2 ATGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGTCAGGCGCAG
C3 ATGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGGCAGGCGCAG
C4 AGGCCGTCACTTCCAAGGTGCTGCAAAGCGAGGTCTTCCGGCAGGCCCAG
C5 AGGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGGCATGCGCAG
C6 GGGCAGTCACGGCCAAGGTGCTCCAGAGCGAGGTTTTCCGCCAGGCCCAG
C7 GAGCAGTCACGGCCAAGGTGCTGCAAAGTGAGTTTTTTCGACAGGCAACG
. **.***** * ******** **.** *** * ** ** ** ** ..*
C1 CGGGTGAGCATTTACCTGAGCACAGCCTCGGAGCTGGACACCACGGCGCT
C2 CGGGTGAGCATTTACCTGAGCACCGCCTCGGAGCTGGACACCACGGCGCT
C3 CGGGTGAGCATTTACCTGAGCACCGCCTCGGAGCTGGACACCACAGCGCT
C4 CGGGTGAGCATTTACCTGAGCACCGCCTCCGAGTTGGACACCACGGCGCT
C5 CGGGTGAGCATTTACCTGAGCACCACCTCCGAGCTGGACACCACGGCGCT
C6 CGGGTGAGCATTTACCTGAGCACCGCCTCTGAACTGGACACCACGGCGCT
C7 CGGGTGAGTATCTACCTGAGCACAGCCTCGGAAGTGGACACCACGGCGCT
******** ** ***********..**** **. **********.*****
C1 GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTTGTGCCCACCTACG
C2 GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
C3 GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
C4 GATTTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
C5 GCTTTCGGAGATGTTCCGCCTGGAGAAGATGGTATTCGTGCCCACCTACG
C6 GCTCCTCGAGATGTTTCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
C7 GCTCTGCGAGATGTTCCGGCTGGAGAAGATGGTCTTCGTGCCCACCTACG
*.* ******** ** **************.** *************
C1 AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGAGGAGTACGAG
C2 AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGACGAGTACGAG
C3 AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGACGAGTACGAG
C4 AGGGCAGCAGGATGAAGATGGTGCGACTGCGCGGCATGGACGAGTACGAG
C5 AGGGCAGCAGGATGAAGATGGTGCGACTGCGCGGCATGGACGAGTACGAG
C6 AGGGCAGCAAGATGAAGATGGTCCGCCTGCGCGGAATGGACGAGTACGAG
C7 AGGGCACCAAGATGAAGATGGTCCGATTGCGGGGCATGGACGAGTACGAG
****** **.************ ** **** **.***** *********
C1 AGCCTGCCTCTGACCAAGTGGAACATAAAGCAGCCGGACTTCAAGGAGGC
C2 AGCCTGCCTCTGACCAAGTGGAACATTAAGCAGCCGGACTTCAAGGAGGC
C3 AGCCTGCCTCTGACCAAGTGGAACATTAAGCAGCCGGACTTTAAGGAGGC
C4 AGCCTGCCCCCGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC
C5 AGCCTGCCCCTGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC
C6 AGTCTCCCTCTGACCAAGTGGAACATCAAGCAGCCGGACTTTAAGGAGGC
C7 AGCCTTCCGCTGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC
** ** ** * *************** ************** ********
C1 ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATTGTGC
C2 ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATCGTGC
C3 ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATCGTGC
C4 GCGCGAAGATGCCATGACCAATGGGCACGGCATCGATCTCTTCATCGTGC
C5 GCGCGAAGATGCCATGACCAATGGGCACGGCATCGATCTCTTCATCGTGC
C6 ACGCGAAGATGCCATGACCAACGGCCACGGCATCGACCTCTTCATTGTGC
C7 TCGTGAAGATGCCATGACCAATGGACACGGCATCGATCTCTTCATTGTGC
** **.************** ** *********** ******** ****
C1 CCGGTGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC
C2 CCGGCGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC
C3 CCGGCGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC
C4 CCGGAGTAGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGAATGGGC
C5 CGGGAGTGGCCTTCACCCGCTGTGGAGCTCGGATGGGCCATGGAATGGGC
C6 CCGGAGTGGCCTTCACCCGCTGCGGAGGTCGCATGGGCCATGGAATGGGT
C7 CCGGGGTGGCCTTCACCCGCACTGGAGCTCGCATGGGCCATGGCATGGGC
* ** **.************: **** *** ***********.*****
C1 TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
C2 TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
C3 TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
C4 TACTACGACAAGTTCCTCAAGCAGCACGCGGATAAGTATCCGCACAAGAA
C5 TACTATGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
C6 TACTACGACAAGTTCCTGAAGCAGCACGCCGACAAGTATCCGCACAAGAA
C7 TACTACGACAAGTTCCTGAAGCAGCACGCGGACAAGTATCCGCACAAGAA
***** *********** *********** ** *****************
C1 GATCTCGCTGATGGCACTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG
C2 GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACAAGG
C3 GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG
C4 GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG
C5 GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAACAACGAGG
C6 GATCTCGCTGATGGCCCTGGCCCTCAACGAGCAGATTGTCAGCAACGAGG
C7 GATCTCCCTGATGGCACTGGCCCTCAACGAGCAGATCGTCAGCAACGAGG
****** ******** *** * ************** ****.****.***
C1 AGTTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
C2 AGTTGCCCATGGAGTCGCACGACGTCCGTTTGCACGGTGTAATTACGGAA
C3 AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
C4 AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
C5 AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
C6 AGCTGCCCATGGAGTCGCACGATGTCCGTTTGCACAGTGTAATTACAGAG
C7 AGCTGCCCATGGAGACGCACGATGTCCGTTTGCACAGTGTAATTACAGAA
** ***********:******* ************.**********.**.
C1 AAC
C2 AAC
C3 AAC
C4 ---
C5 ---
C6 AAC
C7 AAC
>C1
ATGGCGGCCACGATCCAGAACACCCTGAAGGTGGCGCTGCGAAAGCGCAT
GAAGGATGCACTGAAGGGCATCGACGCGGAGGCCATCGCCCGGCAGTCGC
AGGCCGTCACGGCTAAGGTGCTGCAAAGCGAGATCTTCCGGCAGGCGCAG
CGGGTGAGCATTTACCTGAGCACAGCCTCGGAGCTGGACACCACGGCGCT
GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTTGTGCCCACCTACG
AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGAGGAGTACGAG
AGCCTGCCTCTGACCAAGTGGAACATAAAGCAGCCGGACTTCAAGGAGGC
ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATTGTGC
CCGGTGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC
TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
GATCTCGCTGATGGCACTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG
AGTTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
AAC
>C2
ATGGCGGCCACGATCCAGAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
GAAGGATGCACTGAAGGGCATCGACGCGGATGCCATCGCCCGGCAGTCGC
ATGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGTCAGGCGCAG
CGGGTGAGCATTTACCTGAGCACCGCCTCGGAGCTGGACACCACGGCGCT
GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGACGAGTACGAG
AGCCTGCCTCTGACCAAGTGGAACATTAAGCAGCCGGACTTCAAGGAGGC
ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATCGTGC
CCGGCGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC
TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACAAGG
AGTTGCCCATGGAGTCGCACGACGTCCGTTTGCACGGTGTAATTACGGAA
AAC
>C3
ATGGCGGCCACGATCCAGAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
GAAGGATGCACTGAAGGGCATCGACGCGGATGCCATCGCCCGGCAGTCGC
ATGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGGCAGGCGCAG
CGGGTGAGCATTTACCTGAGCACCGCCTCGGAGCTGGACACCACAGCGCT
GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGACGAGTACGAG
AGCCTGCCTCTGACCAAGTGGAACATTAAGCAGCCGGACTTTAAGGAGGC
ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATCGTGC
CCGGCGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC
TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG
AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
AAC
>C4
ATGGCAGCCACGATCCAAAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
TAAGGATGCACTGAAGGGCATCGACGCGGAGGCCATCGCTCGGCAGTCGC
AGGCCGTCACTTCCAAGGTGCTGCAAAGCGAGGTCTTCCGGCAGGCCCAG
CGGGTGAGCATTTACCTGAGCACCGCCTCCGAGTTGGACACCACGGCGCT
GATTTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
AGGGCAGCAGGATGAAGATGGTGCGACTGCGCGGCATGGACGAGTACGAG
AGCCTGCCCCCGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC
GCGCGAAGATGCCATGACCAATGGGCACGGCATCGATCTCTTCATCGTGC
CCGGAGTAGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGAATGGGC
TACTACGACAAGTTCCTCAAGCAGCACGCGGATAAGTATCCGCACAAGAA
GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG
AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
---
>C5
ATGGCGGCCACGATCCAAAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT
AAAGGATGCACTGAAGAGCATCGACCCGGAGGCTATCGCCCGGCAATCCC
AGGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGGCATGCGCAG
CGGGTGAGCATTTACCTGAGCACCACCTCCGAGCTGGACACCACGGCGCT
GCTTTCGGAGATGTTCCGCCTGGAGAAGATGGTATTCGTGCCCACCTACG
AGGGCAGCAGGATGAAGATGGTGCGACTGCGCGGCATGGACGAGTACGAG
AGCCTGCCCCTGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC
GCGCGAAGATGCCATGACCAATGGGCACGGCATCGATCTCTTCATCGTGC
CGGGAGTGGCCTTCACCCGCTGTGGAGCTCGGATGGGCCATGGAATGGGC
TACTATGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA
GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAACAACGAGG
AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA
---
>C6
ATGGCGGCTACAATCCAGAATAGTCTCAAAGTGGCGCTGAGGGGGCGCAT
GAAGGATGCGCTCAAGGGCCTGGACGCGGAGACCATTGCCCGGCAATCCC
GGGCAGTCACGGCCAAGGTGCTCCAGAGCGAGGTTTTCCGCCAGGCCCAG
CGGGTGAGCATTTACCTGAGCACCGCCTCTGAACTGGACACCACGGCGCT
GCTCCTCGAGATGTTTCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG
AGGGCAGCAAGATGAAGATGGTCCGCCTGCGCGGAATGGACGAGTACGAG
AGTCTCCCTCTGACCAAGTGGAACATCAAGCAGCCGGACTTTAAGGAGGC
ACGCGAAGATGCCATGACCAACGGCCACGGCATCGACCTCTTCATTGTGC
CCGGAGTGGCCTTCACCCGCTGCGGAGGTCGCATGGGCCATGGAATGGGT
TACTACGACAAGTTCCTGAAGCAGCACGCCGACAAGTATCCGCACAAGAA
GATCTCGCTGATGGCCCTGGCCCTCAACGAGCAGATTGTCAGCAACGAGG
AGCTGCCCATGGAGTCGCACGATGTCCGTTTGCACAGTGTAATTACAGAG
AAC
>C7
ATGGCGGCTACTATCCAAAACACCCTCAAAGTGGCGCTGAGGAAGCGCAT
GAAGGATGCCCTCAAAAACCTGGACACGGAGGCCATTGCCCGGCAATCTC
GAGCAGTCACGGCCAAGGTGCTGCAAAGTGAGTTTTTTCGACAGGCAACG
CGGGTGAGTATCTACCTGAGCACAGCCTCGGAAGTGGACACCACGGCGCT
GCTCTGCGAGATGTTCCGGCTGGAGAAGATGGTCTTCGTGCCCACCTACG
AGGGCACCAAGATGAAGATGGTCCGATTGCGGGGCATGGACGAGTACGAG
AGCCTTCCGCTGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC
TCGTGAAGATGCCATGACCAATGGACACGGCATCGATCTCTTCATTGTGC
CCGGGGTGGCCTTCACCCGCACTGGAGCTCGCATGGGCCATGGCATGGGC
TACTACGACAAGTTCCTGAAGCAGCACGCGGACAAGTATCCGCACAAGAA
GATCTCCCTGATGGCACTGGCCCTCAACGAGCAGATCGTCAGCAACGAGG
AGCTGCCCATGGAGACGCACGATGTCCGTTTGCACAGTGTAATTACAGAA
AAC
>C1
MAATIQNTLKVALRKRMKDALKGIDAEAIARQSQAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMEEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C2
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNKELPMESHDVRLHGVITE
N
>C3
MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
N
>C4
MAATIQNSLKVALRKRIKDALKGIDAEAIARQSQAVTSKVLQSEVFRQAQ
RVSIYLSTASELDTTALISEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPPTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHADKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
o
>C5
MAATIQNSLKVALRKRIKDALKSIDPEAIARQSQAVTAKVLQSEIFRHAQ
RVSIYLSTTSELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
YYDKFLKQHAEKYPHKKISLMALSLNEQIVNNEELPMESHDVRLHSVITE
o
>C6
MAATIQNSLKVALRGRMKDALKGLDAETIARQSRAVTAKVLQSEVFRQAQ
RVSIYLSTASELDTTALLLEMFRLEKMVFVPTYEGSKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGGRMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMESHDVRLHSVITE
N
>C7
MAATIQNTLKVALRKRMKDALKNLDTEAIARQSRAVTAKVLQSEFFRQAT
RVSIYLSTASEVDTTALLCEMFRLEKMVFVPTYEGTKMKMVRLRGMDEYE
SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRTGARMGHGMG
YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMETHDVRLHSVITE
N
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 7 taxa and 603 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478169398
Setting output file names to "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1027890149
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 6123560823
Seed = 1874386517
Swapseed = 1478169398
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 24 unique site patterns
Division 2 has 16 unique site patterns
Division 3 has 60 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2068.524672 -- -24.557203
Chain 2 -- -2082.502451 -- -24.557203
Chain 3 -- -2063.097686 -- -24.557203
Chain 4 -- -2023.627504 -- -24.557203
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2095.014151 -- -24.557203
Chain 2 -- -2094.068514 -- -24.557203
Chain 3 -- -2071.157788 -- -24.557203
Chain 4 -- -2070.285802 -- -24.557203
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2068.525] (-2082.502) (-2063.098) (-2023.628) * [-2095.014] (-2094.069) (-2071.158) (-2070.286)
500 -- (-1637.625) (-1618.104) (-1642.255) [-1624.467] * (-1631.165) (-1628.318) [-1630.624] (-1625.038) -- 0:00:00
1000 -- (-1635.333) [-1614.956] (-1627.245) (-1620.123) * (-1616.886) (-1607.869) [-1605.072] (-1604.217) -- 0:16:39
1500 -- [-1607.277] (-1605.872) (-1611.371) (-1603.350) * (-1606.353) (-1609.624) [-1584.546] (-1602.871) -- 0:11:05
2000 -- (-1605.064) (-1584.553) [-1595.812] (-1595.419) * (-1592.836) [-1584.471] (-1577.522) (-1591.178) -- 0:08:19
2500 -- [-1581.194] (-1589.993) (-1583.654) (-1591.214) * (-1584.675) (-1586.161) (-1579.779) [-1576.224] -- 0:06:39
3000 -- (-1593.506) (-1581.850) (-1580.451) [-1570.395] * [-1579.763] (-1589.535) (-1575.608) (-1586.454) -- 0:05:32
3500 -- (-1578.260) (-1591.813) (-1577.520) [-1569.397] * (-1576.074) (-1583.446) [-1572.338] (-1580.311) -- 0:04:44
4000 -- (-1574.450) [-1574.180] (-1572.010) (-1572.914) * (-1573.165) (-1582.443) [-1571.773] (-1576.655) -- 0:08:18
4500 -- (-1571.112) [-1563.919] (-1571.587) (-1570.567) * (-1575.049) (-1574.869) [-1572.852] (-1570.047) -- 0:07:22
5000 -- (-1583.094) [-1572.796] (-1571.710) (-1571.268) * (-1577.581) [-1568.237] (-1571.515) (-1580.032) -- 0:06:38
Average standard deviation of split frequencies: 0.078567
5500 -- (-1574.841) [-1574.538] (-1575.128) (-1575.409) * (-1570.634) [-1575.824] (-1569.175) (-1573.198) -- 0:06:01
6000 -- (-1575.739) (-1577.253) (-1576.227) [-1579.111] * [-1584.185] (-1574.437) (-1569.794) (-1574.335) -- 0:05:31
6500 -- (-1573.356) (-1570.036) (-1566.107) [-1576.855] * [-1572.105] (-1566.830) (-1573.524) (-1567.874) -- 0:05:05
7000 -- (-1565.800) (-1572.361) [-1563.706] (-1577.141) * (-1575.365) (-1568.607) [-1567.452] (-1570.000) -- 0:04:43
7500 -- [-1571.882] (-1569.303) (-1575.689) (-1568.998) * (-1568.634) (-1583.037) [-1569.188] (-1571.703) -- 0:04:24
8000 -- (-1567.482) (-1569.327) [-1576.089] (-1571.681) * [-1579.284] (-1584.633) (-1572.296) (-1569.090) -- 0:04:08
8500 -- [-1574.479] (-1568.521) (-1577.804) (-1573.893) * (-1579.719) (-1583.125) (-1570.211) [-1569.256] -- 0:05:49
9000 -- [-1572.693] (-1573.692) (-1567.376) (-1575.108) * [-1573.824] (-1568.799) (-1568.485) (-1569.658) -- 0:05:30
9500 -- (-1573.077) (-1582.772) (-1567.354) [-1568.068] * (-1576.486) (-1569.520) (-1571.337) [-1568.427] -- 0:05:12
10000 -- (-1572.866) [-1573.249] (-1575.660) (-1573.285) * (-1571.630) [-1566.018] (-1568.578) (-1572.666) -- 0:04:57
Average standard deviation of split frequencies: 0.036828
10500 -- [-1566.050] (-1574.511) (-1571.027) (-1572.855) * [-1566.429] (-1571.198) (-1566.230) (-1570.434) -- 0:04:42
11000 -- [-1567.397] (-1573.051) (-1570.303) (-1579.622) * (-1573.855) (-1571.759) (-1571.965) [-1570.374] -- 0:04:29
11500 -- (-1566.350) [-1566.944] (-1572.341) (-1573.697) * [-1567.709] (-1571.994) (-1570.641) (-1572.118) -- 0:04:17
12000 -- [-1577.213] (-1566.140) (-1575.959) (-1578.307) * (-1569.697) [-1567.114] (-1570.733) (-1566.212) -- 0:05:29
12500 -- [-1573.069] (-1572.873) (-1574.083) (-1568.285) * (-1575.780) (-1577.496) [-1565.902] (-1579.343) -- 0:05:16
13000 -- (-1572.377) (-1569.948) [-1567.097] (-1575.269) * (-1574.439) [-1567.948] (-1570.058) (-1577.219) -- 0:05:03
13500 -- (-1564.858) (-1567.427) (-1574.681) [-1573.022] * (-1574.303) (-1567.847) (-1569.642) [-1574.196] -- 0:04:52
14000 -- (-1570.794) [-1575.490] (-1571.350) (-1573.708) * (-1577.366) [-1568.849] (-1567.892) (-1577.876) -- 0:04:41
14500 -- [-1575.962] (-1570.391) (-1568.855) (-1569.748) * (-1571.456) (-1569.761) [-1567.489] (-1574.909) -- 0:04:31
15000 -- (-1575.897) (-1570.696) [-1572.786] (-1569.940) * (-1576.418) (-1584.434) [-1569.260] (-1574.833) -- 0:04:22
Average standard deviation of split frequencies: 0.029463
15500 -- (-1574.138) [-1571.144] (-1569.502) (-1569.885) * (-1573.542) [-1571.272] (-1575.963) (-1574.758) -- 0:04:14
16000 -- (-1567.324) [-1572.027] (-1568.446) (-1571.193) * (-1576.587) (-1570.215) [-1570.175] (-1573.441) -- 0:04:06
16500 -- (-1572.999) (-1564.998) [-1569.750] (-1576.057) * (-1572.581) [-1573.703] (-1573.029) (-1578.498) -- 0:04:58
17000 -- (-1568.256) (-1567.009) (-1570.965) [-1573.255] * (-1573.047) [-1571.822] (-1574.680) (-1574.068) -- 0:04:49
17500 -- (-1574.085) (-1574.721) [-1568.665] (-1572.798) * (-1573.110) (-1572.741) [-1567.130] (-1573.529) -- 0:04:40
18000 -- (-1578.135) [-1567.072] (-1567.579) (-1581.304) * (-1564.868) [-1566.367] (-1572.601) (-1566.097) -- 0:04:32
18500 -- (-1578.315) (-1566.432) (-1567.127) [-1568.759] * (-1570.218) (-1575.399) (-1573.262) [-1570.029] -- 0:04:25
19000 -- (-1574.477) (-1576.306) (-1578.736) [-1568.022] * (-1566.647) (-1571.946) (-1571.788) [-1579.892] -- 0:04:18
19500 -- (-1570.637) (-1575.382) [-1565.484] (-1571.795) * [-1567.084] (-1572.919) (-1571.624) (-1574.183) -- 0:04:11
20000 -- (-1571.825) (-1570.434) (-1573.179) [-1568.195] * (-1574.481) [-1570.125] (-1568.335) (-1574.075) -- 0:04:54
Average standard deviation of split frequencies: 0.022810
20500 -- (-1570.518) (-1570.831) (-1566.218) [-1569.542] * (-1567.055) (-1570.144) [-1563.253] (-1568.978) -- 0:04:46
21000 -- (-1569.230) [-1572.536] (-1574.547) (-1566.457) * (-1571.517) (-1576.853) [-1576.221] (-1577.880) -- 0:04:39
21500 -- (-1572.425) (-1566.490) [-1564.868] (-1569.178) * (-1577.072) [-1576.947] (-1574.417) (-1577.263) -- 0:04:33
22000 -- (-1575.125) (-1565.980) [-1569.715] (-1569.137) * (-1578.214) [-1564.721] (-1577.853) (-1570.696) -- 0:04:26
22500 -- (-1569.450) (-1568.169) [-1570.790] (-1567.267) * (-1572.307) (-1573.608) [-1574.309] (-1568.096) -- 0:04:20
23000 -- (-1570.671) (-1576.915) [-1569.955] (-1576.131) * (-1563.306) (-1578.501) (-1569.928) [-1566.852] -- 0:04:14
23500 -- (-1579.221) [-1565.310] (-1567.854) (-1572.196) * (-1574.506) (-1569.625) (-1573.576) [-1573.986] -- 0:04:50
24000 -- (-1574.411) (-1576.886) (-1570.681) [-1569.832] * (-1569.748) (-1568.478) [-1570.728] (-1575.588) -- 0:04:44
24500 -- (-1577.404) (-1571.524) (-1580.315) [-1566.582] * (-1575.526) (-1570.961) (-1574.789) [-1575.741] -- 0:04:38
25000 -- [-1571.032] (-1573.796) (-1567.268) (-1567.486) * (-1574.708) (-1570.991) (-1568.502) [-1572.258] -- 0:04:33
Average standard deviation of split frequencies: 0.036262
25500 -- (-1576.306) (-1576.766) (-1571.774) [-1570.873] * (-1572.011) (-1570.606) (-1574.440) [-1571.190] -- 0:04:27
26000 -- [-1579.073] (-1570.698) (-1571.932) (-1568.682) * (-1574.359) (-1575.811) [-1572.944] (-1574.963) -- 0:04:22
26500 -- [-1571.881] (-1567.329) (-1564.592) (-1571.100) * [-1568.545] (-1571.174) (-1570.731) (-1574.869) -- 0:04:17
27000 -- (-1574.482) [-1570.912] (-1576.899) (-1570.413) * [-1566.074] (-1576.626) (-1572.574) (-1572.527) -- 0:04:12
27500 -- [-1567.323] (-1575.809) (-1569.653) (-1569.122) * [-1567.556] (-1568.318) (-1564.826) (-1569.015) -- 0:04:07
28000 -- (-1568.083) (-1572.349) (-1565.363) [-1570.848] * (-1568.756) [-1571.843] (-1568.028) (-1571.445) -- 0:04:37
28500 -- (-1574.679) (-1573.819) (-1570.557) [-1572.112] * (-1566.476) [-1570.727] (-1571.681) (-1573.744) -- 0:04:32
29000 -- (-1569.526) (-1582.917) (-1579.385) [-1566.296] * (-1574.478) (-1569.548) (-1573.459) [-1565.254] -- 0:04:27
29500 -- (-1567.732) (-1570.821) (-1587.437) [-1567.223] * (-1574.691) (-1570.378) (-1567.567) [-1576.531] -- 0:04:23
30000 -- (-1572.463) [-1569.212] (-1580.794) (-1574.490) * [-1565.931] (-1572.044) (-1576.566) (-1573.797) -- 0:04:18
Average standard deviation of split frequencies: 0.043554
30500 -- [-1568.314] (-1567.556) (-1578.026) (-1582.716) * [-1572.671] (-1570.743) (-1569.938) (-1568.991) -- 0:04:14
31000 -- (-1570.771) (-1576.972) (-1567.820) [-1569.889] * [-1571.981] (-1569.158) (-1578.930) (-1576.702) -- 0:04:10
31500 -- [-1571.014] (-1570.031) (-1574.975) (-1570.121) * [-1575.645] (-1572.972) (-1579.030) (-1576.475) -- 0:04:05
32000 -- (-1576.376) [-1574.338] (-1569.885) (-1571.494) * [-1565.940] (-1574.229) (-1576.208) (-1568.872) -- 0:04:02
32500 -- (-1572.140) (-1574.435) [-1567.554] (-1574.752) * (-1570.025) [-1572.338] (-1565.180) (-1570.016) -- 0:03:58
33000 -- (-1567.168) (-1575.747) (-1570.232) [-1574.426] * [-1570.451] (-1566.241) (-1567.603) (-1572.961) -- 0:04:23
33500 -- (-1571.210) [-1573.896] (-1571.106) (-1572.478) * (-1568.343) (-1587.445) [-1567.280] (-1569.990) -- 0:04:19
34000 -- (-1578.302) (-1573.417) [-1573.745] (-1566.548) * (-1570.226) (-1566.910) [-1566.649] (-1572.544) -- 0:04:15
34500 -- [-1572.492] (-1568.465) (-1573.831) (-1572.156) * (-1571.046) (-1571.756) (-1571.928) [-1568.273] -- 0:04:11
35000 -- (-1573.544) (-1575.957) (-1572.599) [-1569.683] * [-1569.382] (-1570.228) (-1571.829) (-1577.055) -- 0:04:08
Average standard deviation of split frequencies: 0.037101
35500 -- [-1567.336] (-1568.805) (-1574.844) (-1578.344) * (-1572.420) (-1570.959) [-1570.534] (-1569.032) -- 0:04:04
36000 -- (-1573.498) (-1574.277) (-1568.682) [-1566.030] * (-1576.036) (-1575.612) [-1570.628] (-1581.589) -- 0:04:01
36500 -- (-1568.040) [-1567.587] (-1573.895) (-1582.067) * (-1579.497) [-1573.047] (-1568.601) (-1565.251) -- 0:03:57
37000 -- (-1579.025) (-1568.239) (-1571.495) [-1569.037] * [-1578.667] (-1568.809) (-1567.838) (-1573.002) -- 0:03:54
37500 -- (-1569.286) [-1575.425] (-1571.371) (-1575.139) * (-1573.785) (-1568.126) [-1571.236] (-1567.669) -- 0:03:51
38000 -- [-1568.426] (-1570.263) (-1569.730) (-1572.478) * [-1569.458] (-1571.516) (-1571.251) (-1568.886) -- 0:04:13
38500 -- (-1577.712) (-1574.044) [-1568.833] (-1568.646) * (-1570.116) (-1577.348) (-1575.142) [-1575.461] -- 0:04:09
39000 -- (-1576.766) (-1569.011) (-1571.832) [-1570.366] * [-1574.774] (-1573.793) (-1574.120) (-1569.391) -- 0:04:06
39500 -- [-1576.221] (-1580.931) (-1575.027) (-1567.305) * [-1572.637] (-1564.497) (-1575.328) (-1569.941) -- 0:04:03
40000 -- (-1566.596) (-1572.775) (-1571.632) [-1567.813] * (-1572.664) (-1575.161) [-1565.952] (-1574.635) -- 0:04:00
Average standard deviation of split frequencies: 0.027048
40500 -- (-1577.669) [-1571.588] (-1568.669) (-1572.391) * (-1570.728) (-1579.089) (-1566.292) [-1570.174] -- 0:03:56
41000 -- [-1568.578] (-1577.156) (-1569.387) (-1567.704) * [-1574.612] (-1564.597) (-1570.859) (-1574.811) -- 0:03:53
41500 -- (-1581.406) (-1568.834) [-1571.270] (-1573.922) * (-1571.105) (-1569.073) (-1571.874) [-1568.255] -- 0:03:50
42000 -- (-1578.679) [-1570.383] (-1573.101) (-1576.055) * (-1579.800) [-1571.410] (-1568.401) (-1571.688) -- 0:03:48
42500 -- (-1571.592) (-1565.896) [-1567.541] (-1582.400) * (-1575.906) (-1572.285) (-1579.225) [-1571.682] -- 0:04:07
43000 -- (-1568.656) (-1566.644) [-1571.500] (-1573.100) * (-1574.052) [-1573.215] (-1564.663) (-1572.443) -- 0:04:04
43500 -- (-1567.749) (-1566.649) [-1574.280] (-1582.074) * (-1566.799) (-1574.732) (-1572.847) [-1565.417] -- 0:04:01
44000 -- [-1566.358] (-1578.930) (-1573.225) (-1569.825) * (-1566.374) (-1574.155) (-1567.500) [-1568.500] -- 0:03:59
44500 -- (-1575.324) [-1567.179] (-1573.527) (-1578.831) * (-1573.386) [-1567.665] (-1568.882) (-1573.099) -- 0:03:56
45000 -- (-1572.559) [-1570.742] (-1576.008) (-1571.017) * (-1573.618) (-1574.936) (-1578.158) [-1571.599] -- 0:03:53
Average standard deviation of split frequencies: 0.017080
45500 -- (-1568.018) (-1572.034) (-1572.013) [-1571.207] * [-1574.774] (-1571.349) (-1571.174) (-1570.134) -- 0:03:50
46000 -- (-1576.777) (-1569.120) (-1575.553) [-1570.603] * (-1577.918) [-1568.951] (-1572.504) (-1570.455) -- 0:03:48
46500 -- (-1576.673) (-1575.609) (-1571.993) [-1567.109] * (-1577.199) (-1568.944) (-1571.931) [-1565.832] -- 0:03:45
47000 -- [-1570.889] (-1567.663) (-1570.175) (-1572.891) * [-1579.223] (-1565.027) (-1569.793) (-1572.433) -- 0:03:43
47500 -- (-1575.518) (-1577.662) [-1569.425] (-1574.413) * (-1578.645) (-1568.681) (-1576.141) [-1565.964] -- 0:04:00
48000 -- (-1570.712) (-1570.366) [-1571.927] (-1573.671) * (-1568.466) (-1567.626) [-1565.611] (-1577.305) -- 0:03:58
48500 -- (-1573.300) (-1573.124) [-1571.095] (-1581.847) * (-1571.152) [-1572.307] (-1570.336) (-1570.359) -- 0:03:55
49000 -- (-1571.571) (-1569.151) [-1568.288] (-1578.288) * [-1580.251] (-1573.067) (-1571.486) (-1565.640) -- 0:03:52
49500 -- (-1574.286) (-1566.860) [-1564.762] (-1575.135) * (-1575.727) [-1572.795] (-1571.059) (-1565.242) -- 0:03:50
50000 -- (-1569.844) (-1566.759) [-1573.177] (-1571.196) * (-1576.803) (-1570.362) [-1571.818] (-1572.680) -- 0:03:48
Average standard deviation of split frequencies: 0.020159
50500 -- (-1565.613) (-1567.242) (-1573.982) [-1571.123] * (-1574.520) [-1570.045] (-1575.842) (-1569.056) -- 0:03:45
51000 -- (-1565.472) [-1573.058] (-1571.454) (-1571.620) * (-1572.055) (-1573.981) [-1569.318] (-1567.115) -- 0:03:43
51500 -- (-1574.627) (-1566.355) [-1566.498] (-1571.254) * [-1574.062] (-1576.898) (-1569.043) (-1567.600) -- 0:03:41
52000 -- [-1572.761] (-1570.089) (-1571.657) (-1576.616) * (-1582.117) (-1571.511) (-1571.520) [-1572.882] -- 0:03:38
52500 -- [-1567.689] (-1569.078) (-1576.687) (-1571.275) * (-1575.173) [-1569.427] (-1570.482) (-1574.175) -- 0:03:54
53000 -- (-1573.601) [-1571.515] (-1569.142) (-1567.484) * [-1572.384] (-1571.169) (-1573.292) (-1568.778) -- 0:03:52
53500 -- (-1578.938) (-1575.879) [-1572.438] (-1574.941) * (-1569.481) (-1571.818) (-1577.437) [-1567.255] -- 0:03:49
54000 -- (-1575.189) (-1570.830) (-1569.225) [-1570.852] * (-1578.648) (-1576.269) [-1569.969] (-1571.721) -- 0:03:47
54500 -- (-1568.567) [-1571.363] (-1574.017) (-1570.402) * (-1569.928) (-1571.494) (-1566.339) [-1569.277] -- 0:03:45
55000 -- (-1572.338) [-1573.106] (-1571.477) (-1573.178) * [-1567.132] (-1567.206) (-1563.618) (-1579.587) -- 0:03:43
Average standard deviation of split frequencies: 0.021045
55500 -- [-1569.082] (-1568.207) (-1567.481) (-1574.676) * [-1567.380] (-1568.115) (-1568.777) (-1571.084) -- 0:03:41
56000 -- [-1572.287] (-1572.032) (-1571.912) (-1573.485) * (-1586.100) (-1565.297) (-1569.696) [-1568.521] -- 0:03:39
56500 -- [-1569.347] (-1578.183) (-1572.564) (-1574.788) * (-1571.670) [-1563.531] (-1574.352) (-1570.966) -- 0:03:37
57000 -- (-1572.741) [-1576.255] (-1570.217) (-1579.474) * (-1575.896) [-1571.296] (-1575.040) (-1570.278) -- 0:03:51
57500 -- (-1572.173) (-1568.188) [-1571.865] (-1574.073) * (-1576.856) (-1575.575) [-1565.313] (-1570.667) -- 0:03:49
58000 -- (-1573.656) [-1568.501] (-1572.832) (-1576.701) * (-1571.972) (-1567.119) [-1573.297] (-1577.043) -- 0:03:47
58500 -- (-1573.709) [-1571.786] (-1570.513) (-1572.874) * (-1574.089) (-1570.347) (-1569.556) [-1571.297] -- 0:03:45
59000 -- (-1572.848) [-1571.526] (-1570.251) (-1575.070) * (-1576.198) (-1568.929) [-1567.699] (-1571.030) -- 0:03:43
59500 -- (-1578.393) (-1571.191) (-1571.532) [-1570.911] * (-1570.143) (-1569.731) [-1571.565] (-1575.747) -- 0:03:41
60000 -- (-1571.622) (-1577.060) [-1566.769] (-1564.577) * [-1570.182] (-1568.663) (-1568.959) (-1570.820) -- 0:03:39
Average standard deviation of split frequencies: 0.024606
60500 -- (-1566.090) [-1570.763] (-1573.900) (-1568.638) * [-1570.026] (-1569.401) (-1574.428) (-1574.512) -- 0:03:37
61000 -- (-1571.238) (-1574.449) (-1569.531) [-1572.567] * (-1574.357) (-1569.919) [-1573.243] (-1575.475) -- 0:03:35
61500 -- [-1578.644] (-1574.474) (-1577.572) (-1577.869) * [-1571.816] (-1566.007) (-1576.522) (-1578.924) -- 0:03:33
62000 -- (-1575.977) (-1567.539) [-1567.468] (-1580.886) * (-1575.990) (-1584.891) (-1570.338) [-1573.748] -- 0:03:46
62500 -- (-1572.733) (-1570.226) [-1568.640] (-1570.769) * (-1578.260) (-1573.170) [-1566.441] (-1582.240) -- 0:03:45
63000 -- (-1577.354) [-1572.775] (-1571.206) (-1571.693) * [-1570.380] (-1570.879) (-1570.904) (-1571.576) -- 0:03:43
63500 -- (-1569.341) [-1565.664] (-1564.649) (-1576.146) * (-1573.824) [-1567.521] (-1568.176) (-1573.609) -- 0:03:41
64000 -- (-1574.057) [-1566.617] (-1573.975) (-1578.439) * (-1578.545) (-1566.362) (-1567.936) [-1570.790] -- 0:03:39
64500 -- [-1573.810] (-1568.027) (-1571.737) (-1574.778) * [-1569.417] (-1575.824) (-1574.637) (-1573.703) -- 0:03:37
65000 -- (-1566.878) [-1572.694] (-1572.841) (-1576.599) * (-1574.889) (-1575.787) (-1568.795) [-1572.298] -- 0:03:35
Average standard deviation of split frequencies: 0.023808
65500 -- (-1579.215) [-1575.747] (-1574.202) (-1573.310) * (-1568.787) [-1575.214] (-1575.613) (-1575.410) -- 0:03:34
66000 -- (-1568.156) [-1571.015] (-1569.699) (-1570.777) * (-1573.623) [-1572.366] (-1568.710) (-1581.139) -- 0:03:32
66500 -- (-1571.491) (-1576.345) [-1576.127] (-1579.564) * (-1580.134) (-1567.099) [-1568.991] (-1577.411) -- 0:03:44
67000 -- (-1574.261) [-1569.474] (-1571.784) (-1577.985) * [-1567.119] (-1568.969) (-1565.302) (-1580.961) -- 0:03:42
67500 -- [-1573.668] (-1574.370) (-1571.732) (-1574.464) * (-1572.843) [-1572.993] (-1569.956) (-1575.931) -- 0:03:41
68000 -- (-1582.049) (-1568.939) [-1570.988] (-1574.918) * (-1576.022) (-1580.401) [-1570.653] (-1568.745) -- 0:03:39
68500 -- (-1576.764) [-1563.049] (-1572.693) (-1578.239) * [-1572.061] (-1582.256) (-1572.893) (-1568.389) -- 0:03:37
69000 -- (-1577.355) (-1565.448) (-1571.242) [-1575.913] * (-1574.532) (-1581.906) [-1572.057] (-1569.982) -- 0:03:35
69500 -- [-1570.561] (-1566.939) (-1575.867) (-1574.819) * (-1570.568) [-1578.395] (-1565.838) (-1568.573) -- 0:03:34
70000 -- (-1574.505) [-1571.600] (-1570.751) (-1577.296) * (-1576.862) [-1578.859] (-1566.769) (-1578.399) -- 0:03:32
Average standard deviation of split frequencies: 0.018901
70500 -- (-1565.334) [-1567.541] (-1569.105) (-1572.022) * [-1575.825] (-1570.897) (-1567.824) (-1570.027) -- 0:03:30
71000 -- (-1564.321) (-1573.299) [-1570.321] (-1572.318) * (-1567.983) [-1571.461] (-1568.257) (-1574.679) -- 0:03:29
71500 -- (-1570.461) (-1571.126) [-1568.469] (-1571.930) * (-1577.760) (-1572.497) [-1567.754] (-1569.431) -- 0:03:40
72000 -- (-1585.110) [-1569.960] (-1571.290) (-1567.706) * [-1570.774] (-1575.494) (-1569.960) (-1571.508) -- 0:03:39
72500 -- (-1571.592) [-1570.854] (-1570.015) (-1564.925) * (-1568.269) (-1573.284) [-1575.567] (-1568.124) -- 0:03:37
73000 -- [-1573.342] (-1572.361) (-1569.281) (-1570.876) * (-1567.249) (-1568.979) [-1569.034] (-1569.727) -- 0:03:35
73500 -- (-1576.655) (-1569.992) [-1565.479] (-1572.777) * [-1568.460] (-1567.666) (-1572.720) (-1574.572) -- 0:03:34
74000 -- (-1569.738) (-1566.843) [-1576.535] (-1575.168) * [-1565.759] (-1575.518) (-1575.014) (-1574.120) -- 0:03:32
74500 -- (-1569.278) (-1567.860) [-1571.354] (-1570.275) * (-1567.987) (-1574.636) [-1571.504] (-1574.621) -- 0:03:31
75000 -- (-1577.800) [-1566.419] (-1583.685) (-1567.874) * (-1567.727) [-1569.392] (-1576.757) (-1568.950) -- 0:03:29
Average standard deviation of split frequencies: 0.019642
75500 -- (-1569.822) (-1570.457) [-1574.990] (-1568.557) * (-1571.657) [-1574.750] (-1569.066) (-1576.777) -- 0:03:28
76000 -- (-1571.785) [-1569.988] (-1573.208) (-1586.957) * (-1571.204) [-1567.326] (-1574.819) (-1567.582) -- 0:03:38
76500 -- (-1574.000) (-1575.858) (-1586.461) [-1571.596] * [-1576.219] (-1567.506) (-1571.506) (-1571.511) -- 0:03:37
77000 -- (-1571.328) [-1571.518] (-1575.006) (-1573.681) * (-1569.404) [-1566.454] (-1574.033) (-1568.165) -- 0:03:35
77500 -- (-1570.580) (-1581.164) (-1575.912) [-1570.187] * (-1577.764) [-1566.145] (-1573.961) (-1567.918) -- 0:03:34
78000 -- (-1570.565) (-1581.620) [-1571.926] (-1575.574) * [-1572.631] (-1572.257) (-1577.217) (-1568.348) -- 0:03:32
78500 -- (-1569.731) (-1574.423) (-1572.457) [-1571.574] * (-1584.041) [-1571.985] (-1571.551) (-1580.426) -- 0:03:31
79000 -- [-1565.616] (-1582.942) (-1568.763) (-1576.621) * (-1573.192) (-1573.648) [-1575.974] (-1581.963) -- 0:03:29
79500 -- (-1576.351) [-1572.844] (-1575.798) (-1575.564) * (-1577.336) (-1573.708) [-1574.922] (-1576.802) -- 0:03:28
80000 -- [-1575.238] (-1574.156) (-1571.685) (-1571.853) * [-1573.330] (-1571.568) (-1582.036) (-1579.659) -- 0:03:27
Average standard deviation of split frequencies: 0.020454
80500 -- (-1571.897) (-1576.888) [-1569.376] (-1575.245) * (-1573.663) [-1575.067] (-1571.785) (-1570.786) -- 0:03:25
81000 -- (-1566.153) (-1582.630) [-1572.402] (-1570.489) * (-1573.787) (-1571.312) (-1573.721) [-1566.436] -- 0:03:35
81500 -- (-1575.260) [-1587.675] (-1579.828) (-1571.123) * (-1568.153) [-1568.796] (-1578.450) (-1571.103) -- 0:03:34
82000 -- (-1569.493) (-1574.406) (-1574.826) [-1568.325] * (-1565.835) (-1566.982) [-1569.523] (-1568.071) -- 0:03:32
82500 -- (-1569.681) [-1572.932] (-1570.332) (-1570.733) * (-1569.577) (-1569.456) [-1571.460] (-1572.429) -- 0:03:31
83000 -- (-1576.013) (-1577.709) [-1567.418] (-1568.275) * (-1572.732) [-1569.980] (-1569.568) (-1578.073) -- 0:03:29
83500 -- (-1573.693) (-1572.746) (-1573.810) [-1571.187] * (-1574.662) (-1568.419) [-1567.867] (-1568.063) -- 0:03:28
84000 -- [-1570.617] (-1571.636) (-1579.078) (-1566.620) * (-1566.537) (-1574.212) (-1571.956) [-1567.820] -- 0:03:27
84500 -- (-1567.834) (-1575.323) (-1570.208) [-1568.402] * (-1571.232) (-1568.543) (-1574.646) [-1568.557] -- 0:03:25
85000 -- (-1569.733) (-1575.924) [-1570.201] (-1572.104) * (-1569.151) (-1572.703) [-1567.313] (-1568.778) -- 0:03:24
Average standard deviation of split frequencies: 0.023753
85500 -- [-1566.617] (-1565.215) (-1578.544) (-1572.011) * (-1572.489) (-1567.014) (-1573.311) [-1573.760] -- 0:03:23
86000 -- (-1570.114) (-1572.502) [-1571.440] (-1575.238) * (-1576.844) (-1575.386) (-1569.517) [-1572.764] -- 0:03:32
86500 -- (-1575.178) (-1572.659) (-1573.700) [-1570.739] * [-1566.746] (-1572.046) (-1567.617) (-1570.786) -- 0:03:31
87000 -- [-1563.767] (-1577.513) (-1576.516) (-1570.489) * [-1565.784] (-1578.949) (-1570.917) (-1572.514) -- 0:03:29
87500 -- (-1571.682) (-1571.326) [-1564.689] (-1570.239) * (-1570.732) (-1569.164) [-1565.786] (-1571.024) -- 0:03:28
88000 -- [-1569.187] (-1576.000) (-1571.845) (-1572.007) * (-1585.025) (-1568.024) [-1573.729] (-1574.371) -- 0:03:27
88500 -- (-1576.582) (-1577.070) (-1570.759) [-1567.658] * (-1569.177) [-1561.110] (-1576.348) (-1573.793) -- 0:03:25
89000 -- (-1574.523) [-1571.237] (-1572.945) (-1572.625) * (-1573.351) [-1565.376] (-1576.688) (-1574.412) -- 0:03:24
89500 -- (-1573.846) (-1577.568) [-1569.245] (-1570.033) * (-1566.174) [-1568.713] (-1570.961) (-1574.365) -- 0:03:23
90000 -- (-1566.883) [-1569.140] (-1583.586) (-1568.433) * (-1567.737) (-1573.974) [-1568.120] (-1571.082) -- 0:03:22
Average standard deviation of split frequencies: 0.015598
90500 -- [-1568.966] (-1563.677) (-1570.006) (-1572.306) * (-1570.374) [-1569.941] (-1579.977) (-1573.144) -- 0:03:31
91000 -- (-1570.105) (-1567.479) (-1568.361) [-1570.713] * (-1568.772) [-1568.545] (-1578.800) (-1578.013) -- 0:03:29
91500 -- (-1572.728) (-1572.590) (-1574.783) [-1569.474] * (-1576.514) [-1569.255] (-1572.073) (-1569.043) -- 0:03:28
92000 -- (-1567.721) (-1573.886) (-1569.614) [-1570.273] * (-1575.499) (-1573.683) [-1572.504] (-1571.844) -- 0:03:27
92500 -- (-1576.831) [-1569.173] (-1572.653) (-1570.241) * [-1569.439] (-1573.888) (-1572.727) (-1565.263) -- 0:03:26
93000 -- [-1573.400] (-1569.262) (-1568.296) (-1570.810) * [-1571.782] (-1572.015) (-1573.514) (-1565.655) -- 0:03:24
93500 -- (-1571.651) (-1566.368) [-1566.948] (-1576.724) * (-1568.418) (-1572.990) [-1571.970] (-1579.600) -- 0:03:23
94000 -- (-1574.203) (-1567.716) (-1573.088) [-1570.456] * (-1571.002) (-1571.841) [-1568.358] (-1572.331) -- 0:03:22
94500 -- (-1571.386) (-1575.493) [-1574.827] (-1570.274) * (-1565.735) (-1578.666) [-1577.440] (-1576.655) -- 0:03:21
95000 -- (-1572.617) (-1573.733) [-1566.119] (-1568.783) * (-1569.698) [-1575.089] (-1576.219) (-1572.431) -- 0:03:20
Average standard deviation of split frequencies: 0.009821
95500 -- [-1574.385] (-1573.823) (-1574.543) (-1578.105) * (-1573.503) (-1575.586) [-1572.236] (-1573.577) -- 0:03:28
96000 -- (-1573.037) (-1575.173) (-1574.930) [-1568.249] * (-1566.362) (-1578.414) (-1574.630) [-1572.241] -- 0:03:27
96500 -- (-1575.622) (-1567.781) (-1574.171) [-1568.453] * (-1567.538) [-1570.097] (-1572.533) (-1573.176) -- 0:03:25
97000 -- (-1580.161) (-1577.825) [-1575.309] (-1566.683) * (-1575.507) (-1573.545) [-1565.519] (-1572.001) -- 0:03:24
97500 -- (-1574.030) [-1572.004] (-1568.646) (-1569.655) * (-1570.612) (-1573.999) [-1569.723] (-1573.071) -- 0:03:23
98000 -- [-1573.718] (-1569.176) (-1576.081) (-1576.615) * (-1567.935) (-1571.034) [-1571.134] (-1575.169) -- 0:03:22
98500 -- [-1580.215] (-1569.302) (-1576.216) (-1570.613) * (-1571.501) [-1577.442] (-1571.086) (-1573.586) -- 0:03:21
99000 -- (-1570.700) [-1565.222] (-1575.411) (-1568.330) * (-1570.209) [-1568.754] (-1568.871) (-1572.320) -- 0:03:20
99500 -- (-1570.422) [-1567.934] (-1573.372) (-1573.797) * (-1573.559) (-1572.594) [-1569.715] (-1570.467) -- 0:03:19
100000 -- (-1569.632) [-1566.118] (-1569.440) (-1566.292) * (-1573.078) (-1570.516) [-1567.490] (-1571.703) -- 0:03:18
Average standard deviation of split frequencies: 0.010146
100500 -- [-1563.887] (-1574.392) (-1570.917) (-1576.977) * [-1566.329] (-1565.787) (-1572.802) (-1573.321) -- 0:03:25
101000 -- (-1572.497) (-1581.894) [-1568.924] (-1572.544) * [-1570.103] (-1571.650) (-1572.462) (-1573.460) -- 0:03:24
101500 -- [-1568.204] (-1570.627) (-1578.056) (-1570.180) * (-1568.178) [-1569.311] (-1567.592) (-1570.315) -- 0:03:23
102000 -- (-1575.047) (-1572.340) [-1565.497] (-1570.320) * [-1566.088] (-1572.591) (-1582.929) (-1574.255) -- 0:03:22
102500 -- [-1570.793] (-1575.120) (-1576.314) (-1565.620) * (-1571.781) [-1571.196] (-1576.118) (-1572.830) -- 0:03:21
103000 -- [-1568.689] (-1573.374) (-1568.838) (-1570.329) * (-1568.309) (-1570.561) [-1569.943] (-1567.566) -- 0:03:20
103500 -- (-1567.492) (-1568.144) (-1574.835) [-1569.450] * [-1571.033] (-1568.351) (-1574.670) (-1567.183) -- 0:03:19
104000 -- (-1572.055) [-1572.251] (-1576.810) (-1570.936) * [-1564.872] (-1570.980) (-1576.897) (-1567.129) -- 0:03:18
104500 -- (-1572.043) [-1570.536] (-1581.893) (-1566.938) * (-1572.818) (-1574.262) [-1566.997] (-1577.233) -- 0:03:17
105000 -- (-1569.714) (-1575.324) (-1580.821) [-1566.573] * (-1574.685) (-1569.250) [-1573.425] (-1569.950) -- 0:03:16
Average standard deviation of split frequencies: 0.006671
105500 -- (-1574.748) (-1573.844) [-1572.504] (-1570.856) * (-1575.374) (-1574.954) (-1572.612) [-1567.900] -- 0:03:23
106000 -- [-1565.349] (-1572.916) (-1572.860) (-1573.197) * (-1580.272) [-1569.584] (-1570.759) (-1574.838) -- 0:03:22
106500 -- [-1570.967] (-1573.151) (-1570.042) (-1579.777) * (-1575.429) [-1569.709] (-1576.870) (-1574.989) -- 0:03:21
107000 -- (-1567.646) (-1574.176) (-1572.988) [-1582.075] * (-1568.692) (-1569.207) (-1572.738) [-1573.427] -- 0:03:20
107500 -- (-1569.548) [-1578.267] (-1571.483) (-1581.703) * [-1570.326] (-1569.437) (-1580.092) (-1573.648) -- 0:03:19
108000 -- [-1568.743] (-1575.316) (-1571.232) (-1576.717) * (-1578.724) (-1572.799) [-1572.966] (-1575.352) -- 0:03:18
108500 -- (-1574.444) (-1571.471) [-1570.054] (-1574.900) * (-1572.060) (-1569.536) (-1572.110) [-1576.569] -- 0:03:17
109000 -- [-1575.002] (-1577.522) (-1567.595) (-1573.884) * (-1572.799) (-1572.673) (-1572.645) [-1573.938] -- 0:03:16
109500 -- (-1574.016) [-1571.986] (-1581.153) (-1570.973) * (-1571.508) [-1570.565] (-1569.852) (-1568.703) -- 0:03:15
110000 -- (-1571.749) [-1569.413] (-1570.314) (-1582.482) * (-1579.943) (-1571.252) [-1572.573] (-1567.176) -- 0:03:22
Average standard deviation of split frequencies: 0.011359
110500 -- (-1572.940) [-1574.963] (-1566.390) (-1570.487) * (-1576.074) [-1571.105] (-1573.620) (-1575.187) -- 0:03:21
111000 -- (-1566.768) (-1586.020) (-1570.095) [-1567.258] * [-1570.814] (-1574.051) (-1579.065) (-1571.982) -- 0:03:20
111500 -- [-1573.186] (-1571.322) (-1573.718) (-1567.011) * [-1570.831] (-1572.651) (-1580.123) (-1575.691) -- 0:03:19
112000 -- (-1578.276) (-1575.113) [-1570.545] (-1567.764) * (-1572.134) (-1574.869) (-1572.736) [-1571.826] -- 0:03:18
112500 -- (-1585.083) (-1576.872) [-1570.217] (-1568.691) * (-1574.473) [-1569.016] (-1568.826) (-1573.979) -- 0:03:17
113000 -- (-1571.837) (-1566.411) (-1573.154) [-1570.131] * (-1574.518) (-1570.223) [-1572.529] (-1583.254) -- 0:03:16
113500 -- (-1576.880) [-1571.093] (-1573.712) (-1575.199) * (-1572.097) (-1571.411) [-1564.393] (-1574.079) -- 0:03:15
114000 -- (-1570.636) (-1578.692) (-1573.695) [-1570.841] * [-1572.861] (-1570.226) (-1568.877) (-1568.704) -- 0:03:14
114500 -- (-1570.480) (-1569.774) [-1574.467] (-1576.469) * (-1567.623) (-1576.197) [-1567.195] (-1567.586) -- 0:03:13
115000 -- [-1573.109] (-1572.522) (-1571.183) (-1567.040) * (-1570.902) (-1572.648) [-1571.539] (-1567.816) -- 0:03:20
Average standard deviation of split frequencies: 0.011514
115500 -- (-1583.430) (-1571.430) [-1568.394] (-1567.357) * (-1571.859) [-1569.355] (-1576.571) (-1569.109) -- 0:03:19
116000 -- (-1576.914) [-1570.143] (-1574.653) (-1576.145) * (-1572.318) (-1568.974) (-1569.849) [-1565.763] -- 0:03:18
116500 -- (-1572.311) [-1565.637] (-1578.852) (-1566.446) * [-1567.791] (-1571.852) (-1568.703) (-1575.980) -- 0:03:17
117000 -- (-1576.624) (-1571.570) (-1574.020) [-1576.581] * [-1570.559] (-1570.075) (-1577.252) (-1568.715) -- 0:03:16
117500 -- (-1573.680) (-1570.604) (-1568.667) [-1578.884] * (-1564.881) [-1571.935] (-1570.198) (-1569.009) -- 0:03:15
118000 -- (-1579.635) (-1567.375) (-1568.938) [-1570.682] * [-1569.169] (-1564.694) (-1573.330) (-1567.737) -- 0:03:14
118500 -- (-1578.993) [-1567.015] (-1570.286) (-1578.057) * (-1567.753) [-1571.647] (-1570.644) (-1575.542) -- 0:03:13
119000 -- (-1576.345) [-1566.079] (-1580.295) (-1572.633) * (-1568.396) (-1570.459) (-1580.466) [-1568.057] -- 0:03:19
119500 -- (-1575.116) [-1568.810] (-1577.825) (-1568.620) * (-1569.019) (-1576.318) [-1573.356] (-1572.162) -- 0:03:18
120000 -- (-1573.432) (-1572.133) [-1572.630] (-1572.659) * [-1567.281] (-1580.225) (-1575.539) (-1573.792) -- 0:03:18
Average standard deviation of split frequencies: 0.009767
120500 -- [-1577.161] (-1568.265) (-1577.531) (-1571.670) * (-1568.478) (-1578.410) [-1572.926] (-1574.884) -- 0:03:17
121000 -- (-1579.570) [-1572.901] (-1572.046) (-1574.543) * (-1574.626) [-1572.115] (-1573.214) (-1577.221) -- 0:03:16
121500 -- [-1568.999] (-1575.993) (-1574.998) (-1580.804) * (-1571.739) (-1567.172) (-1579.820) [-1565.495] -- 0:03:15
122000 -- (-1568.264) (-1576.051) (-1573.853) [-1573.096] * (-1569.591) [-1572.558] (-1577.538) (-1576.507) -- 0:03:14
122500 -- (-1574.765) (-1585.156) (-1575.504) [-1577.459] * (-1574.994) [-1569.272] (-1574.931) (-1569.566) -- 0:03:13
123000 -- (-1564.105) (-1584.281) (-1580.474) [-1569.255] * (-1575.878) [-1570.170] (-1575.602) (-1571.668) -- 0:03:19
123500 -- [-1571.556] (-1576.773) (-1574.975) (-1568.487) * (-1575.715) [-1570.137] (-1572.680) (-1570.131) -- 0:03:18
124000 -- (-1566.294) [-1579.161] (-1574.078) (-1569.802) * [-1571.142] (-1575.632) (-1571.167) (-1573.564) -- 0:03:17
124500 -- (-1569.751) (-1580.061) (-1570.417) [-1567.308] * [-1574.464] (-1573.141) (-1577.648) (-1567.685) -- 0:03:16
125000 -- [-1573.077] (-1576.648) (-1569.394) (-1569.150) * [-1566.567] (-1575.402) (-1567.063) (-1573.282) -- 0:03:16
Average standard deviation of split frequencies: 0.009353
125500 -- (-1569.175) (-1580.593) (-1576.569) [-1569.724] * [-1575.474] (-1572.333) (-1572.691) (-1573.807) -- 0:03:15
126000 -- (-1566.014) (-1576.283) (-1575.809) [-1573.271] * (-1567.751) (-1569.497) (-1575.791) [-1568.739] -- 0:03:14
126500 -- (-1573.284) (-1572.089) (-1574.587) [-1576.895] * (-1569.063) (-1572.519) [-1572.830] (-1567.831) -- 0:03:13
127000 -- (-1574.042) (-1576.781) [-1568.747] (-1569.334) * (-1574.990) [-1568.107] (-1576.740) (-1573.107) -- 0:03:12
127500 -- (-1575.333) [-1572.046] (-1575.292) (-1564.523) * [-1573.105] (-1568.429) (-1575.717) (-1570.821) -- 0:03:11
128000 -- (-1568.033) [-1572.326] (-1564.460) (-1574.044) * (-1574.599) [-1573.703] (-1575.724) (-1575.687) -- 0:03:17
128500 -- (-1574.657) [-1570.513] (-1567.600) (-1572.973) * [-1567.932] (-1574.665) (-1568.893) (-1581.029) -- 0:03:16
129000 -- (-1569.905) [-1569.881] (-1573.970) (-1566.730) * (-1566.656) (-1566.690) [-1567.541] (-1581.816) -- 0:03:15
129500 -- (-1571.961) [-1568.292] (-1564.384) (-1566.954) * (-1573.551) (-1568.350) (-1565.813) [-1570.481] -- 0:03:14
130000 -- [-1570.041] (-1567.635) (-1568.214) (-1567.300) * (-1572.035) (-1573.142) (-1565.361) [-1570.547] -- 0:03:14
Average standard deviation of split frequencies: 0.010823
130500 -- (-1571.953) (-1579.599) (-1571.723) [-1574.042] * (-1572.560) [-1578.404] (-1569.172) (-1571.911) -- 0:03:13
131000 -- [-1569.712] (-1570.140) (-1569.090) (-1571.067) * (-1574.054) (-1566.602) [-1569.110] (-1569.475) -- 0:03:12
131500 -- [-1566.355] (-1567.633) (-1575.780) (-1568.038) * (-1570.443) [-1567.016] (-1568.281) (-1562.850) -- 0:03:11
132000 -- (-1571.095) (-1577.511) (-1579.020) [-1570.912] * (-1568.792) (-1568.387) (-1567.974) [-1567.087] -- 0:03:10
132500 -- (-1573.433) (-1567.568) (-1573.042) [-1567.838] * (-1567.179) (-1576.066) (-1567.880) [-1574.470] -- 0:03:09
133000 -- (-1569.207) (-1572.487) [-1580.123] (-1576.928) * [-1567.994] (-1565.775) (-1576.442) (-1574.170) -- 0:03:15
133500 -- (-1569.662) (-1570.899) (-1571.907) [-1566.854] * (-1572.836) (-1568.769) [-1573.315] (-1573.081) -- 0:03:14
134000 -- [-1568.542] (-1577.805) (-1573.162) (-1574.710) * (-1571.132) (-1575.593) (-1573.520) [-1573.701] -- 0:03:13
134500 -- (-1570.705) (-1577.892) [-1577.703] (-1573.017) * [-1572.492] (-1570.959) (-1581.116) (-1581.204) -- 0:03:13
135000 -- (-1577.490) (-1579.932) [-1566.749] (-1578.239) * (-1580.281) (-1566.373) [-1577.599] (-1574.306) -- 0:03:12
Average standard deviation of split frequencies: 0.008088
135500 -- (-1574.140) (-1574.501) [-1571.327] (-1577.379) * (-1581.804) (-1583.349) (-1570.189) [-1575.085] -- 0:03:11
136000 -- (-1576.516) (-1573.959) [-1573.361] (-1572.447) * (-1575.157) (-1568.838) (-1572.557) [-1569.996] -- 0:03:10
136500 -- [-1569.643] (-1574.382) (-1569.294) (-1570.996) * [-1569.915] (-1569.755) (-1573.488) (-1572.434) -- 0:03:09
137000 -- (-1572.920) (-1567.965) [-1569.491] (-1569.780) * [-1571.787] (-1570.237) (-1569.982) (-1570.134) -- 0:03:08
137500 -- (-1579.894) (-1570.493) (-1575.496) [-1574.677] * (-1575.220) (-1569.551) [-1577.177] (-1570.280) -- 0:03:08
138000 -- (-1574.809) [-1572.449] (-1565.594) (-1572.826) * [-1568.316] (-1562.915) (-1569.187) (-1578.915) -- 0:03:13
138500 -- (-1576.933) (-1571.657) (-1571.374) [-1568.139] * (-1573.351) (-1567.518) [-1574.586] (-1578.999) -- 0:03:12
139000 -- (-1575.563) (-1568.187) (-1576.863) [-1570.623] * (-1568.926) (-1571.140) (-1574.333) [-1571.729] -- 0:03:12
139500 -- (-1566.782) [-1575.789] (-1569.855) (-1568.397) * [-1567.372] (-1571.600) (-1569.215) (-1567.063) -- 0:03:11
140000 -- [-1565.313] (-1569.438) (-1584.125) (-1568.300) * (-1569.798) [-1572.506] (-1578.388) (-1562.941) -- 0:03:10
Average standard deviation of split frequencies: 0.010054
140500 -- (-1574.741) (-1572.692) [-1575.450] (-1573.965) * [-1569.317] (-1575.299) (-1573.745) (-1570.401) -- 0:03:09
141000 -- [-1570.668] (-1572.100) (-1578.941) (-1574.127) * (-1572.927) (-1569.067) [-1575.635] (-1569.281) -- 0:03:08
141500 -- [-1571.439] (-1575.812) (-1574.731) (-1575.232) * (-1562.767) (-1570.902) (-1573.070) [-1573.110] -- 0:03:08
142000 -- (-1572.734) (-1572.059) (-1578.800) [-1569.706] * (-1577.280) (-1576.363) (-1572.595) [-1569.605] -- 0:03:07
142500 -- (-1565.570) (-1571.496) (-1575.578) [-1568.954] * [-1572.481] (-1571.556) (-1581.504) (-1570.966) -- 0:03:06
143000 -- (-1570.522) (-1569.831) [-1571.550] (-1575.565) * (-1571.513) [-1568.163] (-1571.737) (-1577.240) -- 0:03:11
143500 -- (-1568.531) [-1571.333] (-1569.420) (-1569.914) * (-1574.307) (-1569.406) [-1570.435] (-1571.700) -- 0:03:10
144000 -- (-1574.838) (-1570.043) [-1569.563] (-1574.456) * (-1573.264) [-1568.230] (-1573.619) (-1577.392) -- 0:03:10
144500 -- (-1570.422) [-1573.445] (-1577.706) (-1573.211) * (-1576.037) [-1566.566] (-1573.268) (-1577.754) -- 0:03:09
145000 -- (-1574.215) [-1573.862] (-1572.280) (-1568.477) * [-1569.885] (-1572.969) (-1576.231) (-1577.860) -- 0:03:08
Average standard deviation of split frequencies: 0.012377
145500 -- (-1570.303) [-1575.392] (-1570.436) (-1565.840) * (-1572.503) [-1573.472] (-1570.624) (-1572.465) -- 0:03:07
146000 -- (-1573.238) (-1576.232) (-1575.749) [-1570.849] * (-1568.237) (-1573.672) (-1571.347) [-1576.500] -- 0:03:07
146500 -- (-1575.503) [-1574.977] (-1575.608) (-1574.605) * (-1566.278) (-1573.510) (-1575.505) [-1572.664] -- 0:03:06
147000 -- (-1571.428) (-1569.620) [-1573.914] (-1579.950) * (-1572.976) (-1567.480) (-1570.580) [-1572.241] -- 0:03:05
147500 -- (-1570.417) [-1564.767] (-1573.047) (-1579.022) * (-1571.761) (-1577.301) [-1565.339] (-1575.139) -- 0:03:04
148000 -- (-1576.462) (-1573.941) (-1575.935) [-1570.699] * (-1566.526) (-1573.249) (-1575.441) [-1574.538] -- 0:03:09
148500 -- (-1578.874) [-1573.030] (-1581.278) (-1573.442) * (-1569.188) (-1577.509) (-1573.513) [-1564.938] -- 0:03:09
149000 -- (-1582.142) [-1571.112] (-1573.101) (-1568.748) * [-1564.971] (-1577.183) (-1571.122) (-1566.753) -- 0:03:08
149500 -- (-1577.649) (-1571.998) (-1578.050) [-1567.200] * (-1569.243) [-1569.371] (-1569.930) (-1569.619) -- 0:03:07
150000 -- (-1574.890) (-1571.598) (-1575.357) [-1570.172] * (-1577.524) (-1573.496) [-1574.402] (-1571.850) -- 0:03:07
Average standard deviation of split frequencies: 0.013037
150500 -- [-1579.410] (-1571.178) (-1569.100) (-1581.034) * (-1571.970) (-1569.216) [-1568.657] (-1567.042) -- 0:03:06
151000 -- (-1577.219) [-1569.153] (-1575.306) (-1573.555) * [-1571.664] (-1570.988) (-1575.165) (-1573.336) -- 0:03:05
151500 -- [-1572.146] (-1576.232) (-1568.996) (-1570.355) * [-1571.858] (-1577.052) (-1576.306) (-1568.265) -- 0:03:04
152000 -- (-1582.666) (-1570.202) [-1572.899] (-1568.208) * (-1578.382) [-1570.941] (-1579.217) (-1571.888) -- 0:03:04
152500 -- [-1571.990] (-1570.616) (-1576.370) (-1570.805) * [-1575.847] (-1577.813) (-1577.124) (-1581.600) -- 0:03:03
153000 -- (-1568.567) [-1567.923] (-1568.642) (-1575.705) * (-1575.272) (-1578.170) (-1571.616) [-1575.966] -- 0:03:08
153500 -- (-1567.764) (-1572.247) [-1579.792] (-1575.048) * (-1574.667) (-1576.620) [-1573.376] (-1582.646) -- 0:03:07
154000 -- (-1574.970) (-1575.840) [-1571.479] (-1585.802) * [-1569.266] (-1579.967) (-1579.364) (-1574.426) -- 0:03:06
154500 -- (-1570.989) (-1578.162) (-1572.981) [-1572.272] * (-1577.507) (-1574.714) (-1569.964) [-1572.351] -- 0:03:06
155000 -- [-1581.252] (-1575.676) (-1573.683) (-1571.910) * (-1565.597) (-1578.584) (-1567.653) [-1571.299] -- 0:03:05
Average standard deviation of split frequencies: 0.012591
155500 -- (-1570.415) (-1572.444) (-1565.601) [-1564.583] * [-1566.709] (-1571.409) (-1567.423) (-1568.863) -- 0:03:04
156000 -- (-1572.288) [-1567.505] (-1567.994) (-1581.561) * [-1571.203] (-1575.139) (-1565.379) (-1569.550) -- 0:03:03
156500 -- (-1570.614) [-1572.902] (-1569.586) (-1572.640) * [-1576.221] (-1576.785) (-1570.265) (-1573.626) -- 0:03:03
157000 -- [-1571.963] (-1571.391) (-1570.736) (-1575.144) * [-1572.638] (-1577.265) (-1566.065) (-1573.738) -- 0:03:02
157500 -- (-1569.251) (-1567.941) [-1566.049] (-1570.396) * (-1566.579) (-1581.001) [-1574.946] (-1573.503) -- 0:03:01
158000 -- (-1570.074) (-1571.601) (-1568.382) [-1571.285] * (-1567.035) (-1574.669) (-1577.090) [-1573.845] -- 0:03:06
158500 -- (-1577.974) [-1568.119] (-1571.493) (-1576.226) * (-1579.518) (-1570.419) (-1593.119) [-1571.961] -- 0:03:05
159000 -- (-1573.182) [-1575.354] (-1571.104) (-1574.463) * (-1573.936) (-1566.633) (-1575.392) [-1574.250] -- 0:03:05
159500 -- (-1573.092) [-1578.271] (-1581.146) (-1572.197) * (-1582.838) [-1567.637] (-1578.490) (-1571.626) -- 0:03:04
160000 -- (-1571.478) [-1574.651] (-1572.372) (-1573.653) * [-1574.167] (-1565.593) (-1574.514) (-1571.284) -- 0:03:03
Average standard deviation of split frequencies: 0.009291
160500 -- [-1566.934] (-1572.468) (-1576.541) (-1568.872) * (-1576.551) (-1574.076) [-1569.892] (-1577.264) -- 0:03:03
161000 -- (-1580.323) (-1572.531) [-1568.340] (-1571.761) * (-1576.130) (-1569.307) [-1568.067] (-1568.404) -- 0:03:02
161500 -- (-1575.702) [-1569.595] (-1571.385) (-1571.798) * (-1568.339) (-1567.287) [-1565.881] (-1567.751) -- 0:03:01
162000 -- [-1565.420] (-1577.702) (-1571.221) (-1577.611) * [-1570.421] (-1572.070) (-1567.761) (-1568.478) -- 0:03:01
162500 -- (-1569.187) [-1569.462] (-1571.185) (-1576.987) * (-1579.420) (-1569.359) [-1566.671] (-1571.817) -- 0:03:05
163000 -- (-1571.559) (-1574.906) [-1573.077] (-1568.846) * [-1572.963] (-1569.079) (-1577.753) (-1567.374) -- 0:03:04
163500 -- (-1569.070) (-1570.385) [-1575.095] (-1577.527) * [-1568.237] (-1573.174) (-1567.378) (-1568.759) -- 0:03:04
164000 -- (-1565.586) (-1566.470) (-1574.642) [-1572.458] * [-1573.468] (-1569.581) (-1566.576) (-1570.215) -- 0:03:03
164500 -- [-1570.983] (-1569.702) (-1569.851) (-1582.053) * (-1569.294) (-1579.823) (-1572.224) [-1571.218] -- 0:03:02
165000 -- (-1567.573) (-1569.543) (-1579.481) [-1574.660] * [-1566.503] (-1569.617) (-1570.086) (-1573.847) -- 0:03:02
Average standard deviation of split frequencies: 0.011359
165500 -- [-1567.785] (-1572.589) (-1577.710) (-1575.244) * [-1567.694] (-1578.645) (-1578.080) (-1567.465) -- 0:03:01
166000 -- (-1574.153) (-1569.480) [-1568.341] (-1578.176) * (-1574.862) (-1573.794) [-1584.307] (-1570.459) -- 0:03:00
166500 -- (-1573.311) (-1571.852) (-1572.215) [-1568.848] * (-1578.541) [-1569.796] (-1574.623) (-1576.104) -- 0:03:00
167000 -- [-1564.908] (-1577.790) (-1571.546) (-1571.120) * [-1571.840] (-1572.865) (-1572.445) (-1568.481) -- 0:02:59
167500 -- (-1574.244) (-1574.070) (-1575.598) [-1569.326] * (-1577.314) (-1573.113) [-1571.983] (-1567.666) -- 0:03:03
168000 -- (-1566.605) (-1579.465) (-1567.681) [-1568.275] * [-1567.140] (-1570.671) (-1570.846) (-1574.782) -- 0:03:03
168500 -- (-1575.460) (-1576.498) (-1566.270) [-1570.835] * (-1570.162) (-1569.687) (-1572.941) [-1566.231] -- 0:03:02
169000 -- (-1569.480) (-1569.254) (-1572.657) [-1571.708] * [-1575.672] (-1572.395) (-1575.526) (-1567.407) -- 0:03:01
169500 -- (-1569.052) (-1574.801) [-1573.415] (-1570.515) * (-1569.653) (-1577.109) [-1567.967] (-1585.779) -- 0:03:01
170000 -- (-1578.712) (-1576.212) [-1575.576] (-1572.713) * [-1575.307] (-1574.159) (-1572.343) (-1567.093) -- 0:03:00
Average standard deviation of split frequencies: 0.014271
170500 -- [-1574.110] (-1574.962) (-1569.767) (-1569.078) * (-1572.941) (-1573.039) (-1577.477) [-1571.621] -- 0:03:00
171000 -- [-1573.962] (-1570.323) (-1571.259) (-1568.121) * [-1571.836] (-1577.388) (-1576.242) (-1563.171) -- 0:02:59
171500 -- (-1575.835) (-1572.539) [-1571.556] (-1573.444) * (-1576.678) (-1571.732) (-1567.144) [-1566.810] -- 0:02:58
172000 -- (-1582.951) (-1570.107) [-1568.089] (-1576.200) * (-1572.314) [-1570.337] (-1569.669) (-1574.327) -- 0:02:58
172500 -- [-1573.936] (-1568.323) (-1571.220) (-1572.779) * (-1569.561) (-1569.826) (-1566.471) [-1570.457] -- 0:03:02
173000 -- (-1575.113) [-1572.710] (-1571.470) (-1570.592) * (-1569.315) (-1572.897) [-1566.621] (-1568.708) -- 0:03:01
173500 -- (-1579.458) [-1569.143] (-1569.633) (-1565.251) * (-1572.214) (-1573.158) (-1565.093) [-1571.358] -- 0:03:01
174000 -- (-1585.377) (-1571.778) (-1564.093) [-1569.079] * (-1577.014) (-1572.412) [-1567.630] (-1570.495) -- 0:03:00
174500 -- (-1570.042) [-1568.969] (-1569.632) (-1573.870) * [-1570.073] (-1576.883) (-1567.156) (-1574.709) -- 0:02:59
175000 -- (-1574.169) (-1575.358) [-1567.129] (-1572.735) * (-1573.430) (-1578.555) (-1570.199) [-1573.647] -- 0:02:59
Average standard deviation of split frequencies: 0.012499
175500 -- (-1574.240) [-1569.727] (-1580.358) (-1576.279) * (-1568.850) (-1574.847) [-1573.108] (-1573.268) -- 0:02:58
176000 -- (-1572.292) [-1568.793] (-1573.520) (-1573.703) * (-1565.838) (-1575.085) [-1569.851] (-1572.512) -- 0:02:57
176500 -- (-1567.401) (-1571.527) [-1567.895] (-1567.705) * (-1569.847) [-1570.975] (-1573.765) (-1572.970) -- 0:02:57
177000 -- (-1569.566) (-1573.047) [-1573.114] (-1569.472) * (-1574.044) (-1569.129) [-1567.692] (-1575.053) -- 0:02:56
177500 -- [-1565.334] (-1567.298) (-1569.097) (-1568.825) * [-1572.238] (-1572.430) (-1568.555) (-1575.024) -- 0:03:00
178000 -- [-1570.229] (-1571.411) (-1572.817) (-1569.909) * (-1575.009) (-1574.991) [-1572.678] (-1572.821) -- 0:03:00
178500 -- (-1572.954) [-1566.545] (-1568.338) (-1576.636) * (-1568.817) (-1578.961) (-1577.383) [-1572.963] -- 0:02:59
179000 -- [-1569.072] (-1576.012) (-1570.548) (-1573.802) * [-1570.035] (-1570.645) (-1578.654) (-1571.395) -- 0:02:58
179500 -- (-1571.864) (-1577.362) [-1565.603] (-1577.452) * (-1568.553) (-1567.338) [-1575.143] (-1572.089) -- 0:02:58
180000 -- (-1574.278) (-1573.898) [-1575.211] (-1574.559) * (-1574.935) (-1575.315) [-1577.442] (-1576.346) -- 0:02:57
Average standard deviation of split frequencies: 0.013046
180500 -- (-1586.961) (-1578.348) [-1569.464] (-1569.590) * (-1572.486) (-1573.332) [-1571.897] (-1568.959) -- 0:02:57
181000 -- [-1568.087] (-1568.316) (-1572.454) (-1568.919) * [-1571.472] (-1573.154) (-1564.113) (-1576.278) -- 0:02:56
181500 -- [-1571.572] (-1571.253) (-1576.197) (-1573.096) * (-1569.921) (-1580.252) (-1569.878) [-1572.265] -- 0:02:55
182000 -- (-1577.037) [-1567.939] (-1573.880) (-1584.747) * (-1565.335) (-1579.764) (-1570.398) [-1571.507] -- 0:02:55
182500 -- (-1571.589) (-1576.473) (-1569.111) [-1570.098] * (-1569.625) (-1576.778) (-1573.395) [-1576.456] -- 0:02:59
183000 -- [-1572.876] (-1575.015) (-1575.242) (-1574.777) * [-1567.805] (-1569.778) (-1564.142) (-1572.715) -- 0:02:58
183500 -- [-1574.220] (-1569.563) (-1573.274) (-1577.380) * [-1575.452] (-1578.307) (-1570.191) (-1570.122) -- 0:02:57
184000 -- (-1568.779) [-1571.143] (-1581.505) (-1570.389) * (-1572.686) (-1569.021) [-1573.905] (-1566.689) -- 0:02:57
184500 -- (-1567.967) (-1564.655) [-1574.229] (-1566.317) * (-1575.188) [-1567.494] (-1573.200) (-1582.033) -- 0:02:56
185000 -- (-1575.056) (-1570.474) [-1569.494] (-1575.522) * (-1578.886) (-1568.666) (-1566.360) [-1577.324] -- 0:02:56
Average standard deviation of split frequencies: 0.010560
185500 -- (-1574.465) (-1571.125) [-1567.787] (-1576.286) * (-1578.083) (-1576.385) [-1568.926] (-1569.340) -- 0:02:55
186000 -- (-1570.510) (-1570.345) [-1566.625] (-1573.315) * (-1580.863) (-1571.102) (-1572.646) [-1573.777] -- 0:02:55
186500 -- (-1577.240) (-1585.679) [-1571.431] (-1576.251) * (-1577.362) [-1566.766] (-1575.748) (-1569.334) -- 0:02:54
187000 -- (-1571.228) (-1573.045) [-1571.103] (-1571.359) * [-1568.707] (-1576.020) (-1574.691) (-1571.651) -- 0:02:53
187500 -- (-1576.390) (-1584.206) [-1568.950] (-1566.853) * [-1570.963] (-1574.277) (-1578.048) (-1569.875) -- 0:02:57
188000 -- (-1571.906) (-1567.567) (-1574.292) [-1572.555] * (-1572.384) [-1572.649] (-1575.045) (-1573.469) -- 0:02:57
188500 -- (-1573.884) (-1572.245) (-1566.536) [-1570.604] * [-1566.355] (-1579.555) (-1573.315) (-1568.404) -- 0:02:56
189000 -- (-1571.212) (-1569.924) [-1567.073] (-1570.908) * (-1568.047) (-1574.691) [-1566.411] (-1571.220) -- 0:02:55
189500 -- (-1569.536) [-1568.012] (-1568.928) (-1568.588) * [-1567.554] (-1574.466) (-1572.092) (-1568.906) -- 0:02:55
190000 -- [-1571.636] (-1577.851) (-1570.607) (-1567.348) * (-1569.511) (-1573.710) [-1584.131] (-1573.665) -- 0:02:54
Average standard deviation of split frequencies: 0.010714
190500 -- (-1567.257) (-1586.668) [-1572.722] (-1573.837) * (-1573.698) (-1573.969) (-1576.247) [-1573.894] -- 0:02:54
191000 -- (-1575.359) (-1587.034) (-1569.610) [-1566.398] * (-1574.762) (-1565.816) [-1574.119] (-1577.454) -- 0:02:53
191500 -- [-1567.012] (-1575.251) (-1574.563) (-1573.825) * (-1570.895) (-1564.965) [-1570.864] (-1572.800) -- 0:02:53
192000 -- (-1580.671) (-1570.171) (-1576.647) [-1572.011] * [-1576.057] (-1566.643) (-1583.880) (-1579.281) -- 0:02:52
192500 -- (-1573.235) [-1568.499] (-1577.240) (-1570.165) * [-1571.500] (-1572.825) (-1575.729) (-1576.963) -- 0:02:56
193000 -- [-1568.154] (-1573.570) (-1578.409) (-1572.561) * (-1570.847) [-1571.777] (-1579.274) (-1577.825) -- 0:02:55
193500 -- (-1567.657) (-1575.263) (-1571.046) [-1569.989] * [-1571.606] (-1573.324) (-1582.262) (-1576.311) -- 0:02:55
194000 -- (-1574.644) [-1572.345] (-1570.733) (-1572.934) * (-1571.174) [-1564.825] (-1574.253) (-1580.404) -- 0:02:54
194500 -- (-1577.055) (-1570.401) (-1571.778) [-1571.941] * (-1567.261) [-1572.836] (-1570.975) (-1573.521) -- 0:02:53
195000 -- (-1573.585) (-1573.815) [-1571.694] (-1569.645) * (-1573.082) (-1579.562) (-1574.151) [-1573.146] -- 0:02:53
Average standard deviation of split frequencies: 0.010422
195500 -- (-1573.626) (-1574.876) (-1573.435) [-1567.969] * (-1571.746) [-1566.919] (-1566.864) (-1571.879) -- 0:02:52
196000 -- [-1572.676] (-1574.904) (-1569.771) (-1575.861) * (-1577.415) (-1569.645) (-1573.461) [-1571.077] -- 0:02:52
196500 -- [-1574.286] (-1575.232) (-1571.120) (-1572.743) * (-1571.299) [-1569.138] (-1580.481) (-1577.204) -- 0:02:51
197000 -- [-1569.385] (-1570.718) (-1580.761) (-1575.532) * (-1569.218) (-1573.509) [-1575.798] (-1572.249) -- 0:02:51
197500 -- (-1575.041) [-1572.200] (-1576.953) (-1572.313) * (-1576.450) (-1569.213) (-1570.170) [-1573.970] -- 0:02:54
198000 -- (-1567.292) (-1576.277) (-1575.368) [-1565.795] * (-1574.786) (-1575.536) [-1570.003] (-1573.174) -- 0:02:54
198500 -- (-1571.451) (-1567.187) (-1576.157) [-1577.050] * (-1571.935) [-1571.656] (-1572.647) (-1572.441) -- 0:02:53
199000 -- (-1576.497) (-1574.478) [-1573.221] (-1573.830) * (-1575.955) (-1573.276) (-1573.843) [-1574.606] -- 0:02:53
199500 -- (-1574.000) (-1568.954) [-1575.545] (-1569.188) * (-1577.057) [-1571.067] (-1572.323) (-1584.510) -- 0:02:52
200000 -- (-1570.908) [-1565.789] (-1583.360) (-1569.284) * [-1574.770] (-1570.264) (-1572.743) (-1573.675) -- 0:02:52
Average standard deviation of split frequencies: 0.010963
200500 -- (-1567.934) (-1578.073) [-1567.458] (-1576.771) * (-1571.264) (-1573.851) [-1576.052] (-1575.080) -- 0:02:51
201000 -- [-1573.396] (-1569.946) (-1573.405) (-1571.006) * (-1574.618) [-1569.935] (-1572.649) (-1579.740) -- 0:02:50
201500 -- (-1568.239) (-1574.768) (-1570.829) [-1569.812] * (-1576.785) (-1577.047) (-1574.951) [-1569.948] -- 0:02:54
202000 -- (-1570.297) (-1572.684) (-1568.148) [-1572.735] * (-1567.832) [-1573.391] (-1570.386) (-1567.970) -- 0:02:53
202500 -- (-1574.671) (-1569.734) (-1574.508) [-1573.575] * (-1569.034) [-1573.066] (-1571.345) (-1569.151) -- 0:02:53
203000 -- (-1573.839) [-1568.787] (-1568.729) (-1571.185) * (-1571.201) (-1571.760) [-1571.453] (-1573.446) -- 0:02:52
203500 -- [-1568.366] (-1571.117) (-1574.024) (-1574.853) * (-1569.977) (-1568.069) [-1569.237] (-1577.826) -- 0:02:52
204000 -- (-1571.712) (-1574.236) (-1571.660) [-1572.707] * (-1576.524) (-1572.147) (-1571.509) [-1570.082] -- 0:02:51
204500 -- (-1570.928) (-1570.899) (-1581.828) [-1575.333] * [-1565.680] (-1589.246) (-1571.232) (-1569.247) -- 0:02:51
205000 -- (-1576.667) (-1570.701) (-1571.705) [-1571.533] * (-1566.389) (-1585.508) [-1565.993] (-1573.290) -- 0:02:54
Average standard deviation of split frequencies: 0.008009
205500 -- (-1571.526) (-1566.681) [-1571.160] (-1567.927) * (-1574.629) (-1578.892) (-1574.358) [-1568.508] -- 0:02:53
206000 -- (-1579.946) [-1567.933] (-1570.312) (-1566.807) * (-1571.334) (-1572.132) (-1573.628) [-1567.066] -- 0:02:53
206500 -- (-1576.592) (-1572.083) [-1570.076] (-1571.754) * [-1573.554] (-1576.313) (-1580.678) (-1563.785) -- 0:02:52
207000 -- [-1572.278] (-1573.795) (-1568.873) (-1567.894) * (-1570.723) [-1573.549] (-1565.010) (-1578.569) -- 0:02:52
207500 -- (-1572.722) (-1575.192) [-1569.297] (-1572.826) * [-1566.073] (-1569.257) (-1574.505) (-1570.657) -- 0:02:51
208000 -- (-1568.349) [-1576.824] (-1573.423) (-1573.548) * (-1566.395) (-1572.136) [-1568.872] (-1572.720) -- 0:02:51
208500 -- (-1573.633) [-1570.607] (-1570.970) (-1577.207) * (-1571.452) (-1575.128) [-1568.685] (-1571.514) -- 0:02:50
209000 -- [-1568.393] (-1572.983) (-1573.832) (-1568.168) * (-1573.508) (-1567.714) [-1576.621] (-1586.240) -- 0:02:50
209500 -- (-1577.211) (-1577.590) (-1567.547) [-1567.144] * (-1574.384) (-1567.253) (-1571.297) [-1570.240] -- 0:02:53
210000 -- (-1570.786) (-1574.775) [-1568.655] (-1570.726) * (-1572.144) [-1572.407] (-1573.166) (-1573.038) -- 0:02:53
Average standard deviation of split frequencies: 0.005594
210500 -- (-1572.647) [-1569.635] (-1574.214) (-1574.936) * [-1574.234] (-1579.988) (-1572.750) (-1573.281) -- 0:02:52
211000 -- (-1571.126) [-1566.154] (-1575.327) (-1583.729) * (-1574.455) [-1573.916] (-1581.926) (-1565.821) -- 0:02:52
211500 -- (-1568.811) [-1572.998] (-1567.857) (-1584.462) * (-1573.318) [-1579.318] (-1566.427) (-1574.679) -- 0:02:51
212000 -- (-1571.607) (-1578.298) [-1567.685] (-1581.529) * (-1569.168) (-1570.383) (-1568.477) [-1567.809] -- 0:02:50
212500 -- [-1563.968] (-1569.105) (-1571.586) (-1567.128) * (-1567.326) [-1570.825] (-1570.138) (-1577.668) -- 0:02:50
213000 -- (-1570.538) [-1570.580] (-1575.859) (-1567.359) * (-1570.858) (-1565.339) [-1573.610] (-1569.913) -- 0:02:49
213500 -- (-1571.238) (-1567.691) (-1571.827) [-1571.442] * (-1569.372) (-1574.772) (-1570.698) [-1568.415] -- 0:02:49
214000 -- (-1569.093) (-1566.764) (-1567.757) [-1567.455] * (-1568.734) [-1571.539] (-1572.810) (-1571.930) -- 0:02:48
214500 -- (-1572.377) (-1569.701) [-1567.224] (-1572.922) * (-1568.982) [-1575.564] (-1567.233) (-1574.499) -- 0:02:52
215000 -- (-1571.225) (-1574.644) (-1568.360) [-1572.056] * (-1575.777) (-1572.402) [-1566.794] (-1570.339) -- 0:02:51
Average standard deviation of split frequencies: 0.004365
215500 -- (-1573.202) (-1569.992) [-1578.787] (-1576.267) * [-1570.528] (-1574.585) (-1576.054) (-1586.843) -- 0:02:51
216000 -- (-1576.398) (-1569.621) [-1574.984] (-1575.221) * [-1563.289] (-1572.737) (-1575.408) (-1570.955) -- 0:02:50
216500 -- (-1578.316) [-1571.762] (-1581.531) (-1570.415) * (-1576.342) [-1574.463] (-1572.344) (-1575.568) -- 0:02:50
217000 -- (-1571.934) (-1582.191) [-1568.519] (-1569.408) * (-1572.151) (-1574.657) [-1571.789] (-1565.214) -- 0:02:49
217500 -- (-1571.692) (-1568.029) [-1569.000] (-1570.133) * (-1571.142) (-1580.256) (-1579.421) [-1567.927] -- 0:02:49
218000 -- [-1566.828] (-1570.381) (-1563.885) (-1570.389) * (-1575.699) (-1574.137) (-1570.332) [-1567.021] -- 0:02:48
218500 -- (-1573.672) (-1574.506) [-1572.154] (-1572.611) * (-1574.887) (-1575.970) [-1573.375] (-1565.987) -- 0:02:48
219000 -- (-1578.572) (-1565.501) [-1570.387] (-1568.075) * (-1573.069) (-1569.465) (-1568.904) [-1569.475] -- 0:02:47
219500 -- (-1569.944) (-1579.624) (-1579.137) [-1569.533] * (-1569.987) (-1575.875) [-1569.539] (-1574.837) -- 0:02:50
220000 -- (-1572.262) (-1571.402) [-1571.678] (-1569.213) * (-1569.947) (-1566.072) [-1569.230] (-1573.301) -- 0:02:50
Average standard deviation of split frequencies: 0.005341
220500 -- (-1581.411) (-1581.277) (-1574.496) [-1570.769] * (-1571.916) (-1566.219) (-1577.288) [-1570.526] -- 0:02:49
221000 -- (-1572.885) (-1575.400) (-1578.441) [-1569.870] * (-1574.294) (-1574.672) [-1574.152] (-1566.459) -- 0:02:49
221500 -- (-1573.347) (-1580.548) (-1573.861) [-1569.201] * (-1574.885) [-1572.027] (-1569.646) (-1572.807) -- 0:02:48
222000 -- [-1571.710] (-1568.399) (-1570.982) (-1571.985) * [-1570.635] (-1570.509) (-1567.852) (-1572.612) -- 0:02:48
222500 -- [-1567.125] (-1581.308) (-1571.680) (-1570.959) * [-1568.635] (-1577.912) (-1568.179) (-1567.051) -- 0:02:47
223000 -- (-1568.065) (-1580.523) (-1569.319) [-1567.165] * [-1569.487] (-1573.754) (-1578.239) (-1573.914) -- 0:02:47
223500 -- (-1572.419) (-1578.019) (-1568.642) [-1566.204] * (-1568.330) (-1575.835) [-1568.356] (-1572.732) -- 0:02:46
224000 -- [-1571.549] (-1590.661) (-1578.845) (-1569.795) * (-1577.730) (-1572.388) [-1575.486] (-1570.198) -- 0:02:46
224500 -- (-1572.184) (-1581.551) (-1572.228) [-1570.357] * (-1579.295) [-1568.890] (-1573.175) (-1578.328) -- 0:02:49
225000 -- (-1575.639) (-1574.340) [-1575.296] (-1571.349) * (-1575.221) (-1569.986) [-1572.202] (-1578.013) -- 0:02:48
Average standard deviation of split frequencies: 0.006258
225500 -- (-1574.633) (-1572.718) (-1577.795) [-1567.239] * (-1574.740) [-1567.701] (-1565.681) (-1575.307) -- 0:02:48
226000 -- (-1567.135) [-1574.347] (-1573.671) (-1576.802) * (-1574.549) (-1573.890) [-1568.028] (-1567.046) -- 0:02:47
226500 -- [-1575.752] (-1578.474) (-1567.211) (-1571.010) * [-1575.861] (-1579.853) (-1574.443) (-1575.912) -- 0:02:47
227000 -- (-1574.838) (-1573.562) [-1571.189] (-1577.650) * (-1572.140) (-1574.991) [-1573.496] (-1570.321) -- 0:02:46
227500 -- (-1572.724) (-1575.950) [-1570.277] (-1574.479) * (-1569.625) (-1569.825) (-1571.205) [-1564.643] -- 0:02:46
228000 -- (-1567.621) (-1573.113) [-1572.624] (-1571.638) * (-1576.158) (-1575.602) (-1578.464) [-1567.768] -- 0:02:45
228500 -- (-1579.954) (-1574.308) (-1566.005) [-1568.929] * (-1577.482) [-1571.664] (-1579.896) (-1566.107) -- 0:02:45
229000 -- [-1575.296] (-1572.785) (-1577.120) (-1577.909) * (-1571.305) (-1576.348) [-1564.255] (-1579.765) -- 0:02:44
229500 -- [-1570.433] (-1571.291) (-1575.054) (-1579.615) * (-1580.568) (-1571.415) [-1567.013] (-1572.076) -- 0:02:47
230000 -- (-1572.715) (-1573.705) [-1568.194] (-1581.494) * [-1574.514] (-1577.281) (-1566.257) (-1569.905) -- 0:02:47
Average standard deviation of split frequencies: 0.005790
230500 -- [-1575.658] (-1575.645) (-1568.383) (-1574.478) * [-1570.598] (-1570.391) (-1573.744) (-1578.510) -- 0:02:46
231000 -- (-1573.870) [-1571.946] (-1565.187) (-1570.017) * [-1568.385] (-1568.765) (-1567.009) (-1577.497) -- 0:02:46
231500 -- (-1569.441) (-1570.809) [-1571.385] (-1571.021) * (-1578.903) [-1566.830] (-1574.433) (-1574.266) -- 0:02:45
232000 -- [-1574.936] (-1579.653) (-1568.977) (-1573.422) * [-1579.017] (-1568.900) (-1570.508) (-1578.684) -- 0:02:45
232500 -- [-1575.399] (-1574.304) (-1573.484) (-1579.058) * (-1572.666) [-1564.564] (-1569.147) (-1577.942) -- 0:02:45
233000 -- (-1576.101) (-1573.962) (-1576.841) [-1573.112] * [-1575.257] (-1569.709) (-1579.853) (-1578.890) -- 0:02:44
233500 -- (-1574.397) [-1572.216] (-1575.270) (-1572.728) * (-1571.676) [-1567.610] (-1571.271) (-1574.876) -- 0:02:44
234000 -- (-1576.646) (-1572.674) [-1577.419] (-1569.724) * (-1581.990) (-1570.932) [-1570.304] (-1578.251) -- 0:02:43
234500 -- (-1569.307) (-1574.544) (-1574.416) [-1567.871] * (-1582.791) (-1567.270) [-1568.706] (-1569.578) -- 0:02:46
235000 -- (-1572.423) (-1567.437) [-1570.183] (-1568.426) * (-1572.767) (-1567.897) (-1570.163) [-1567.182] -- 0:02:46
Average standard deviation of split frequencies: 0.008323
235500 -- (-1570.693) (-1564.687) (-1577.411) [-1564.320] * (-1568.503) (-1567.699) [-1568.932] (-1576.825) -- 0:02:45
236000 -- (-1574.446) (-1573.282) [-1571.910] (-1567.518) * (-1571.514) (-1567.502) [-1571.927] (-1574.143) -- 0:02:45
236500 -- (-1570.106) [-1575.389] (-1577.100) (-1569.765) * (-1578.124) (-1576.181) [-1575.327] (-1568.956) -- 0:02:44
237000 -- (-1567.538) (-1576.691) (-1570.438) [-1568.815] * (-1572.171) (-1570.944) [-1577.114] (-1575.774) -- 0:02:44
237500 -- [-1573.251] (-1577.335) (-1575.210) (-1571.049) * (-1567.183) (-1564.836) (-1568.815) [-1567.461] -- 0:02:43
238000 -- (-1568.546) [-1567.737] (-1574.653) (-1567.444) * (-1573.076) [-1571.753] (-1568.100) (-1572.845) -- 0:02:43
238500 -- [-1573.299] (-1569.640) (-1569.858) (-1570.159) * [-1572.360] (-1572.727) (-1569.011) (-1570.632) -- 0:02:46
239000 -- [-1572.211] (-1565.334) (-1570.684) (-1572.380) * (-1567.232) (-1573.405) (-1571.872) [-1566.224] -- 0:02:45
239500 -- (-1567.840) [-1574.035] (-1573.030) (-1578.153) * (-1576.886) (-1578.473) (-1573.815) [-1568.880] -- 0:02:45
240000 -- (-1565.394) (-1574.103) (-1570.905) [-1573.873] * (-1568.347) (-1579.151) (-1574.320) [-1570.070] -- 0:02:44
Average standard deviation of split frequencies: 0.005876
240500 -- (-1568.832) (-1569.940) (-1570.417) [-1575.153] * [-1570.923] (-1570.608) (-1579.371) (-1565.359) -- 0:02:44
241000 -- (-1569.389) [-1572.317] (-1570.513) (-1577.383) * (-1573.402) [-1575.079] (-1573.607) (-1566.467) -- 0:02:43
241500 -- (-1569.841) (-1574.587) [-1568.433] (-1575.900) * [-1568.332] (-1570.265) (-1570.724) (-1574.592) -- 0:02:43
242000 -- (-1567.225) (-1572.440) [-1573.792] (-1577.852) * (-1573.256) [-1574.848] (-1573.466) (-1580.041) -- 0:02:42
242500 -- (-1571.136) [-1567.995] (-1567.162) (-1578.573) * (-1564.411) (-1578.565) [-1576.276] (-1567.096) -- 0:02:45
243000 -- (-1569.850) (-1577.637) [-1571.313] (-1570.053) * (-1580.336) (-1573.711) (-1576.612) [-1571.742] -- 0:02:45
243500 -- (-1567.820) [-1565.596] (-1572.613) (-1569.101) * (-1568.362) (-1575.925) (-1571.164) [-1575.362] -- 0:02:44
244000 -- (-1567.982) [-1566.863] (-1570.271) (-1571.353) * (-1570.289) (-1581.478) [-1566.614] (-1577.839) -- 0:02:44
244500 -- (-1577.804) (-1570.391) (-1575.354) [-1569.856] * (-1572.191) [-1577.025] (-1574.327) (-1573.659) -- 0:02:43
245000 -- (-1576.780) (-1570.841) [-1572.087] (-1571.008) * [-1566.614] (-1576.465) (-1567.287) (-1572.525) -- 0:02:43
Average standard deviation of split frequencies: 0.005749
245500 -- [-1569.912] (-1575.583) (-1570.516) (-1571.342) * (-1573.629) [-1570.316] (-1572.690) (-1574.703) -- 0:02:42
246000 -- (-1570.396) (-1572.682) (-1567.406) [-1564.861] * [-1569.418] (-1570.526) (-1571.834) (-1578.467) -- 0:02:42
246500 -- (-1574.357) [-1573.304] (-1568.972) (-1571.131) * (-1573.055) [-1572.646] (-1569.199) (-1569.227) -- 0:02:42
247000 -- (-1573.252) (-1577.367) [-1577.977] (-1570.515) * (-1569.703) (-1566.645) (-1568.249) [-1570.341] -- 0:02:41
247500 -- (-1575.835) (-1577.239) [-1572.936] (-1570.488) * [-1572.454] (-1573.397) (-1570.903) (-1573.271) -- 0:02:44
248000 -- (-1566.775) [-1572.745] (-1572.631) (-1574.334) * (-1574.615) (-1571.201) (-1573.115) [-1573.180] -- 0:02:43
248500 -- [-1567.882] (-1574.208) (-1571.500) (-1568.680) * (-1571.461) (-1574.328) (-1571.498) [-1568.083] -- 0:02:43
249000 -- [-1579.960] (-1571.097) (-1567.649) (-1575.155) * [-1570.160] (-1577.318) (-1566.760) (-1572.777) -- 0:02:42
249500 -- (-1569.132) (-1578.937) [-1568.242] (-1580.494) * (-1566.495) (-1568.692) (-1565.846) [-1573.398] -- 0:02:42
250000 -- (-1572.033) (-1578.739) (-1576.466) [-1572.884] * (-1568.521) (-1570.507) (-1565.584) [-1572.647] -- 0:02:42
Average standard deviation of split frequencies: 0.001567
250500 -- (-1570.894) [-1575.731] (-1572.436) (-1573.529) * (-1580.971) (-1569.829) [-1563.756] (-1568.213) -- 0:02:41
251000 -- (-1568.068) (-1572.465) (-1569.963) [-1572.343] * (-1570.659) (-1575.087) (-1571.218) [-1572.461] -- 0:02:41
251500 -- (-1568.866) [-1575.839] (-1569.468) (-1576.731) * [-1569.869] (-1568.054) (-1566.867) (-1573.395) -- 0:02:40
252000 -- (-1579.425) (-1579.593) [-1572.440] (-1567.864) * (-1568.254) [-1574.215] (-1567.280) (-1571.747) -- 0:02:40
252500 -- (-1576.305) (-1573.134) (-1571.478) [-1570.493] * (-1568.871) (-1571.835) [-1574.957] (-1569.620) -- 0:02:42
253000 -- [-1572.275] (-1569.541) (-1576.445) (-1566.837) * (-1571.055) [-1568.064] (-1575.576) (-1575.695) -- 0:02:42
253500 -- (-1574.845) (-1568.025) (-1575.831) [-1569.493] * (-1568.036) [-1569.795] (-1578.387) (-1567.144) -- 0:02:41
254000 -- [-1574.928] (-1574.199) (-1572.990) (-1573.321) * (-1570.391) [-1564.103] (-1575.332) (-1569.315) -- 0:02:41
254500 -- (-1576.866) (-1576.857) (-1575.211) [-1570.484] * (-1570.455) (-1568.524) [-1573.387] (-1574.613) -- 0:02:41
255000 -- [-1572.172] (-1579.928) (-1573.022) (-1569.238) * (-1574.193) (-1570.821) (-1573.961) [-1575.833] -- 0:02:40
Average standard deviation of split frequencies: 0.003990
255500 -- (-1573.282) (-1569.617) (-1571.761) [-1569.385] * (-1578.903) (-1570.093) (-1573.643) [-1569.212] -- 0:02:40
256000 -- [-1571.148] (-1567.633) (-1579.330) (-1573.387) * [-1575.518] (-1571.316) (-1574.672) (-1576.251) -- 0:02:39
256500 -- (-1567.820) [-1568.985] (-1567.947) (-1573.020) * (-1574.534) (-1572.241) (-1578.602) [-1570.597] -- 0:02:39
257000 -- (-1577.035) [-1569.204] (-1566.660) (-1571.079) * (-1570.184) (-1570.825) [-1570.315] (-1566.509) -- 0:02:41
257500 -- (-1575.436) [-1571.265] (-1575.312) (-1575.675) * (-1575.895) (-1570.205) (-1575.219) [-1573.989] -- 0:02:41
258000 -- (-1575.743) (-1578.250) (-1567.568) [-1572.826] * (-1575.131) [-1573.802] (-1572.566) (-1567.217) -- 0:02:41
258500 -- (-1572.987) [-1570.222] (-1577.140) (-1569.448) * (-1572.339) (-1569.087) [-1567.131] (-1569.274) -- 0:02:40
259000 -- [-1571.221] (-1572.889) (-1571.643) (-1573.961) * (-1573.058) (-1573.315) (-1571.479) [-1565.357] -- 0:02:40
259500 -- [-1570.536] (-1568.283) (-1575.041) (-1567.835) * (-1569.562) (-1572.326) [-1570.756] (-1573.123) -- 0:02:39
260000 -- (-1575.050) (-1571.854) [-1569.789] (-1574.109) * [-1568.282] (-1571.727) (-1576.253) (-1575.048) -- 0:02:39
Average standard deviation of split frequencies: 0.002713
260500 -- (-1569.475) [-1567.381] (-1579.265) (-1571.880) * (-1566.120) (-1573.363) (-1566.617) [-1567.148] -- 0:02:38
261000 -- [-1570.410] (-1564.547) (-1582.851) (-1577.617) * (-1568.660) (-1577.908) [-1571.634] (-1575.466) -- 0:02:38
261500 -- [-1568.048] (-1575.938) (-1573.418) (-1569.343) * [-1572.306] (-1572.637) (-1580.385) (-1570.788) -- 0:02:38
262000 -- (-1578.233) [-1574.346] (-1576.354) (-1584.983) * (-1573.905) (-1570.420) (-1580.110) [-1567.733] -- 0:02:40
262500 -- (-1569.764) (-1567.774) [-1574.369] (-1577.320) * (-1572.548) [-1572.180] (-1579.854) (-1567.178) -- 0:02:40
263000 -- (-1574.980) (-1566.060) (-1573.717) [-1573.566] * (-1567.389) [-1568.094] (-1575.079) (-1571.361) -- 0:02:39
263500 -- [-1567.323] (-1570.781) (-1580.031) (-1570.859) * [-1569.187] (-1572.811) (-1573.470) (-1579.986) -- 0:02:39
264000 -- (-1569.755) (-1568.877) [-1571.680] (-1575.466) * (-1578.521) [-1574.106] (-1575.498) (-1574.654) -- 0:02:38
264500 -- (-1568.371) (-1576.478) (-1573.681) [-1571.285] * (-1569.698) [-1574.268] (-1572.960) (-1582.605) -- 0:02:38
265000 -- (-1579.060) (-1585.152) [-1570.388] (-1570.847) * (-1570.084) (-1568.765) (-1577.787) [-1577.080] -- 0:02:38
Average standard deviation of split frequencies: 0.003249
265500 -- (-1582.506) (-1581.972) (-1567.456) [-1574.137] * (-1570.245) [-1570.422] (-1572.064) (-1573.536) -- 0:02:37
266000 -- (-1573.810) (-1575.684) [-1571.192] (-1569.985) * (-1571.955) (-1576.895) (-1571.849) [-1571.901] -- 0:02:37
266500 -- (-1571.659) [-1574.532] (-1572.230) (-1568.696) * [-1570.371] (-1576.403) (-1572.225) (-1570.839) -- 0:02:36
267000 -- (-1565.815) (-1572.187) [-1566.028] (-1575.114) * (-1569.194) (-1568.182) [-1570.523] (-1571.383) -- 0:02:39
267500 -- (-1571.153) (-1570.067) [-1568.094] (-1570.263) * [-1571.873] (-1574.155) (-1578.884) (-1577.941) -- 0:02:38
268000 -- [-1574.095] (-1573.028) (-1571.061) (-1584.167) * (-1576.276) (-1574.024) (-1572.695) [-1574.174] -- 0:02:38
268500 -- (-1578.968) (-1576.105) [-1568.948] (-1575.565) * (-1565.881) [-1570.381] (-1571.069) (-1570.154) -- 0:02:38
269000 -- (-1575.908) (-1568.420) (-1582.568) [-1564.969] * [-1570.018] (-1574.373) (-1574.480) (-1571.308) -- 0:02:37
269500 -- (-1570.134) [-1568.967] (-1568.631) (-1573.517) * (-1568.312) [-1576.259] (-1570.217) (-1571.193) -- 0:02:37
270000 -- [-1567.252] (-1577.296) (-1573.694) (-1573.225) * (-1578.362) (-1572.254) (-1576.741) [-1571.687] -- 0:02:36
Average standard deviation of split frequencies: 0.003193
270500 -- [-1565.464] (-1569.199) (-1573.174) (-1572.128) * (-1569.960) (-1580.761) [-1571.041] (-1569.999) -- 0:02:36
271000 -- [-1571.467] (-1570.076) (-1575.706) (-1573.142) * (-1573.515) (-1577.479) [-1569.557] (-1569.583) -- 0:02:36
271500 -- (-1575.153) [-1570.103] (-1574.281) (-1578.580) * (-1571.501) (-1571.900) [-1570.740] (-1576.914) -- 0:02:35
272000 -- (-1574.325) (-1572.573) (-1572.866) [-1577.367] * (-1582.130) (-1566.508) [-1568.452] (-1572.515) -- 0:02:37
272500 -- (-1571.411) [-1570.829] (-1572.504) (-1579.121) * (-1572.394) (-1571.063) [-1570.467] (-1577.277) -- 0:02:37
273000 -- (-1579.203) [-1571.000] (-1575.675) (-1584.995) * (-1576.253) [-1567.056] (-1568.772) (-1567.610) -- 0:02:37
273500 -- (-1573.709) [-1568.429] (-1577.640) (-1570.747) * (-1576.800) (-1568.137) (-1572.878) [-1570.095] -- 0:02:36
274000 -- (-1570.697) [-1570.822] (-1568.240) (-1581.186) * (-1574.581) (-1566.819) [-1566.454] (-1571.065) -- 0:02:36
274500 -- (-1572.457) (-1571.245) (-1570.934) [-1568.711] * (-1575.363) (-1573.527) [-1565.844] (-1571.373) -- 0:02:35
275000 -- (-1575.935) (-1577.273) (-1569.187) [-1568.923] * (-1568.869) (-1572.476) (-1572.434) [-1573.690] -- 0:02:35
Average standard deviation of split frequencies: 0.003416
275500 -- [-1573.422] (-1576.100) (-1571.764) (-1568.638) * [-1571.955] (-1567.180) (-1569.136) (-1571.645) -- 0:02:35
276000 -- (-1568.943) [-1579.976] (-1575.287) (-1570.720) * [-1571.424] (-1575.154) (-1567.607) (-1575.478) -- 0:02:34
276500 -- (-1568.665) [-1570.381] (-1577.704) (-1572.238) * (-1569.861) (-1572.863) [-1571.280] (-1576.895) -- 0:02:36
277000 -- [-1571.339] (-1576.890) (-1574.596) (-1570.823) * (-1575.557) (-1569.283) [-1571.628] (-1574.061) -- 0:02:36
277500 -- [-1566.448] (-1575.022) (-1575.138) (-1574.708) * (-1572.262) (-1572.342) (-1570.058) [-1568.994] -- 0:02:36
278000 -- (-1574.962) (-1570.780) (-1571.512) [-1568.513] * [-1573.225] (-1576.276) (-1572.809) (-1567.839) -- 0:02:35
278500 -- (-1566.529) (-1568.109) [-1572.606] (-1564.217) * (-1576.311) [-1568.883] (-1572.266) (-1572.188) -- 0:02:35
279000 -- (-1573.680) [-1573.488] (-1575.236) (-1578.616) * [-1571.266] (-1570.967) (-1567.556) (-1567.766) -- 0:02:35
279500 -- (-1576.382) [-1571.568] (-1575.371) (-1568.627) * (-1571.827) (-1573.048) (-1576.360) [-1568.673] -- 0:02:34
280000 -- (-1576.832) [-1570.423] (-1574.235) (-1567.359) * (-1566.287) [-1566.452] (-1574.892) (-1571.295) -- 0:02:34
Average standard deviation of split frequencies: 0.003919
280500 -- (-1568.602) (-1572.506) [-1574.113] (-1565.766) * [-1569.002] (-1568.987) (-1568.372) (-1569.530) -- 0:02:33
281000 -- (-1570.642) [-1573.939] (-1571.618) (-1567.103) * (-1572.298) [-1569.947] (-1569.406) (-1574.252) -- 0:02:33
281500 -- (-1574.552) (-1569.181) (-1575.251) [-1572.030] * (-1571.027) (-1568.181) (-1576.032) [-1568.143] -- 0:02:35
282000 -- (-1567.256) (-1572.857) (-1575.886) [-1564.705] * (-1567.983) [-1574.714] (-1568.268) (-1571.733) -- 0:02:35
282500 -- (-1568.979) (-1569.632) [-1575.054] (-1569.283) * (-1571.572) (-1570.321) [-1566.382] (-1570.816) -- 0:02:34
283000 -- [-1566.540] (-1570.349) (-1579.257) (-1572.033) * (-1572.733) (-1576.027) [-1565.236] (-1564.178) -- 0:02:34
283500 -- (-1569.444) (-1575.330) (-1574.864) [-1568.972] * (-1572.632) (-1571.294) (-1572.958) [-1571.063] -- 0:02:34
284000 -- (-1564.780) (-1573.617) [-1578.151] (-1569.486) * (-1572.177) [-1571.307] (-1571.917) (-1571.009) -- 0:02:33
284500 -- (-1568.227) (-1571.919) (-1579.561) [-1568.744] * [-1563.941] (-1581.207) (-1571.426) (-1565.943) -- 0:02:33
285000 -- [-1565.260] (-1573.655) (-1576.316) (-1569.209) * (-1570.986) (-1572.490) [-1571.229] (-1575.943) -- 0:02:33
Average standard deviation of split frequencies: 0.003571
285500 -- (-1571.936) (-1570.897) (-1573.538) [-1569.260] * (-1570.203) (-1569.193) [-1573.457] (-1571.474) -- 0:02:32
286000 -- (-1568.806) [-1572.390] (-1575.118) (-1568.706) * [-1573.933] (-1572.429) (-1565.959) (-1572.620) -- 0:02:32
286500 -- (-1574.074) (-1577.345) [-1568.331] (-1575.548) * [-1568.036] (-1572.482) (-1573.638) (-1570.539) -- 0:02:34
287000 -- (-1571.020) (-1573.633) (-1574.239) [-1572.784] * [-1570.388] (-1570.579) (-1570.685) (-1580.280) -- 0:02:34
287500 -- (-1574.220) (-1570.933) (-1579.916) [-1573.891] * (-1571.270) (-1571.412) [-1572.656] (-1570.742) -- 0:02:33
288000 -- [-1570.465] (-1577.346) (-1570.714) (-1572.701) * (-1571.313) (-1575.262) [-1572.834] (-1568.613) -- 0:02:33
288500 -- [-1576.489] (-1573.788) (-1575.119) (-1567.007) * (-1571.238) (-1584.930) [-1568.695] (-1570.890) -- 0:02:32
289000 -- [-1570.683] (-1572.674) (-1573.788) (-1573.416) * [-1572.892] (-1572.994) (-1576.324) (-1572.446) -- 0:02:32
289500 -- (-1577.378) (-1568.027) [-1577.513] (-1571.745) * (-1574.916) [-1569.215] (-1573.070) (-1576.847) -- 0:02:32
290000 -- (-1572.971) (-1572.698) [-1576.802] (-1568.343) * (-1577.726) (-1575.663) (-1576.841) [-1568.023] -- 0:02:31
Average standard deviation of split frequencies: 0.004865
290500 -- [-1573.996] (-1580.164) (-1575.207) (-1579.322) * (-1573.699) (-1572.316) (-1566.435) [-1567.918] -- 0:02:31
291000 -- [-1563.545] (-1571.789) (-1577.939) (-1567.276) * (-1572.928) [-1569.850] (-1569.456) (-1573.091) -- 0:02:33
291500 -- (-1574.702) (-1580.149) (-1579.913) [-1566.726] * [-1564.803] (-1567.179) (-1568.782) (-1571.546) -- 0:02:33
292000 -- (-1569.681) [-1574.382] (-1573.842) (-1574.273) * [-1568.464] (-1576.570) (-1567.669) (-1570.034) -- 0:02:32
292500 -- (-1570.891) (-1569.348) [-1572.684] (-1576.989) * (-1570.359) (-1575.274) (-1583.616) [-1569.745] -- 0:02:32
293000 -- (-1569.014) (-1566.215) (-1570.270) [-1567.614] * [-1565.475] (-1570.635) (-1576.805) (-1573.658) -- 0:02:32
293500 -- (-1573.927) (-1568.108) (-1572.223) [-1567.961] * (-1566.739) (-1571.316) [-1568.303] (-1570.535) -- 0:02:31
294000 -- (-1574.854) (-1571.761) (-1577.919) [-1566.051] * [-1571.767] (-1574.357) (-1577.636) (-1581.436) -- 0:02:31
294500 -- (-1570.258) (-1567.575) [-1567.869] (-1574.233) * (-1568.679) (-1577.751) [-1579.377] (-1577.212) -- 0:02:30
295000 -- (-1572.835) [-1567.595] (-1571.369) (-1575.302) * (-1568.496) (-1579.934) (-1579.959) [-1573.726] -- 0:02:30
Average standard deviation of split frequencies: 0.005839
295500 -- (-1569.735) [-1572.006] (-1571.653) (-1566.613) * (-1568.178) (-1574.478) (-1575.122) [-1573.413] -- 0:02:30
296000 -- (-1573.609) [-1576.662] (-1578.063) (-1574.543) * (-1570.297) [-1577.038] (-1571.507) (-1577.049) -- 0:02:32
296500 -- (-1575.112) (-1568.785) (-1573.107) [-1572.869] * [-1566.886] (-1567.922) (-1572.662) (-1571.624) -- 0:02:31
297000 -- (-1572.503) (-1577.238) (-1569.537) [-1567.778] * (-1569.887) [-1581.736] (-1570.558) (-1571.981) -- 0:02:31
297500 -- (-1581.620) [-1574.489] (-1573.047) (-1571.008) * (-1576.660) (-1574.517) (-1573.550) [-1567.606] -- 0:02:31
298000 -- (-1576.130) [-1564.863] (-1569.678) (-1570.397) * (-1577.761) (-1564.388) [-1569.028] (-1570.930) -- 0:02:30
298500 -- (-1571.843) [-1572.137] (-1576.003) (-1570.630) * (-1576.171) [-1566.364] (-1573.745) (-1568.282) -- 0:02:30
299000 -- (-1571.269) (-1576.381) (-1574.808) [-1567.949] * (-1568.923) (-1573.038) [-1570.015] (-1578.271) -- 0:02:30
299500 -- (-1574.016) (-1568.840) [-1574.113] (-1573.152) * (-1571.832) [-1571.429] (-1568.598) (-1578.660) -- 0:02:29
300000 -- (-1576.181) (-1572.393) [-1568.836] (-1576.136) * (-1567.590) [-1567.795] (-1574.335) (-1575.553) -- 0:02:29
Average standard deviation of split frequencies: 0.005749
300500 -- (-1567.727) (-1566.490) [-1569.630] (-1574.592) * (-1573.241) (-1573.283) [-1566.628] (-1575.719) -- 0:02:28
301000 -- (-1570.384) (-1575.660) [-1574.569] (-1572.752) * (-1574.536) [-1575.490] (-1569.144) (-1567.099) -- 0:02:30
301500 -- (-1572.537) (-1566.823) (-1573.919) [-1570.475] * [-1569.291] (-1566.951) (-1579.631) (-1572.603) -- 0:02:30
302000 -- (-1583.271) (-1569.426) [-1570.813] (-1570.731) * (-1570.016) (-1572.813) [-1571.476] (-1570.492) -- 0:02:30
302500 -- (-1573.597) (-1588.413) [-1564.714] (-1575.825) * (-1574.818) (-1565.184) (-1565.834) [-1567.374] -- 0:02:29
303000 -- (-1565.580) [-1578.624] (-1569.319) (-1576.729) * (-1571.692) (-1571.745) (-1568.464) [-1570.959] -- 0:02:29
303500 -- (-1568.063) [-1568.527] (-1574.056) (-1574.232) * (-1570.500) [-1575.153] (-1573.574) (-1575.682) -- 0:02:29
304000 -- (-1572.949) (-1569.080) [-1576.227] (-1568.371) * [-1567.147] (-1571.567) (-1578.870) (-1565.104) -- 0:02:28
304500 -- (-1572.766) [-1570.271] (-1569.874) (-1573.479) * (-1568.796) [-1569.634] (-1571.412) (-1567.641) -- 0:02:28
305000 -- (-1581.175) (-1571.613) [-1568.916] (-1574.029) * [-1574.449] (-1568.716) (-1580.295) (-1567.407) -- 0:02:28
Average standard deviation of split frequencies: 0.006162
305500 -- (-1588.850) [-1566.032] (-1567.544) (-1565.837) * (-1569.245) [-1574.112] (-1579.377) (-1574.817) -- 0:02:27
306000 -- (-1578.157) (-1570.075) (-1568.430) [-1567.887] * (-1577.747) (-1573.455) (-1569.595) [-1570.711] -- 0:02:29
306500 -- (-1568.387) [-1571.618] (-1570.715) (-1568.502) * [-1569.979] (-1578.898) (-1571.064) (-1573.269) -- 0:02:29
307000 -- (-1569.090) (-1574.907) (-1570.767) [-1569.901] * [-1568.816] (-1571.095) (-1570.265) (-1573.117) -- 0:02:28
307500 -- (-1569.544) (-1575.066) (-1570.165) [-1567.507] * (-1571.186) [-1580.632] (-1569.008) (-1564.646) -- 0:02:28
308000 -- (-1569.395) [-1566.647] (-1569.219) (-1577.786) * (-1570.093) [-1567.823] (-1571.563) (-1570.555) -- 0:02:28
308500 -- (-1570.631) [-1576.204] (-1574.149) (-1569.338) * [-1568.784] (-1575.566) (-1566.646) (-1575.760) -- 0:02:27
309000 -- (-1570.290) [-1568.016] (-1578.539) (-1570.450) * (-1568.181) (-1572.252) (-1575.268) [-1566.821] -- 0:02:27
309500 -- (-1570.684) [-1569.475] (-1569.564) (-1573.809) * (-1570.442) (-1567.127) [-1566.882] (-1580.476) -- 0:02:27
310000 -- [-1567.457] (-1568.531) (-1571.354) (-1577.763) * (-1574.344) (-1571.796) (-1575.346) [-1571.153] -- 0:02:26
Average standard deviation of split frequencies: 0.005564
310500 -- [-1569.370] (-1573.244) (-1570.580) (-1567.850) * (-1569.347) (-1572.542) [-1568.002] (-1570.787) -- 0:02:28
311000 -- (-1574.050) [-1567.252] (-1575.320) (-1569.312) * (-1578.394) [-1572.107] (-1568.044) (-1584.373) -- 0:02:28
311500 -- (-1573.499) [-1568.129] (-1577.081) (-1575.062) * [-1573.219] (-1570.321) (-1573.684) (-1584.745) -- 0:02:28
312000 -- (-1576.054) (-1566.546) (-1577.248) [-1565.931] * (-1582.018) (-1572.708) [-1572.607] (-1574.744) -- 0:02:27
312500 -- (-1575.650) [-1570.634] (-1575.283) (-1574.881) * [-1569.809] (-1572.728) (-1577.445) (-1581.376) -- 0:02:27
313000 -- (-1569.966) [-1569.884] (-1578.087) (-1573.368) * (-1570.408) [-1567.960] (-1570.960) (-1578.759) -- 0:02:27
313500 -- (-1567.686) (-1567.797) (-1563.524) [-1572.671] * (-1568.886) (-1578.367) [-1571.400] (-1573.968) -- 0:02:26
314000 -- (-1574.166) (-1570.263) [-1565.625] (-1566.980) * (-1565.033) [-1569.003] (-1576.265) (-1573.615) -- 0:02:26
314500 -- (-1575.511) (-1572.415) [-1565.784] (-1578.052) * (-1570.244) (-1574.190) (-1572.972) [-1570.806] -- 0:02:26
315000 -- [-1571.131] (-1566.475) (-1569.847) (-1575.239) * (-1570.536) [-1568.234] (-1572.564) (-1573.595) -- 0:02:25
Average standard deviation of split frequencies: 0.006464
315500 -- (-1583.891) (-1567.815) [-1571.423] (-1571.578) * (-1565.852) (-1566.845) [-1571.322] (-1571.482) -- 0:02:27
316000 -- (-1576.340) [-1570.697] (-1572.749) (-1573.405) * (-1567.440) [-1569.085] (-1572.574) (-1570.788) -- 0:02:27
316500 -- (-1577.898) [-1564.177] (-1564.339) (-1571.901) * (-1572.165) (-1572.235) (-1572.174) [-1578.706] -- 0:02:26
317000 -- (-1573.829) [-1563.107] (-1572.309) (-1571.054) * (-1576.118) (-1572.968) (-1576.458) [-1574.035] -- 0:02:26
317500 -- [-1570.503] (-1568.109) (-1569.791) (-1576.031) * [-1570.754] (-1574.228) (-1572.812) (-1575.767) -- 0:02:26
318000 -- (-1574.351) (-1575.470) [-1566.274] (-1571.182) * (-1575.413) [-1570.325] (-1576.359) (-1577.721) -- 0:02:25
318500 -- (-1572.601) (-1575.271) [-1566.988] (-1574.084) * (-1567.077) [-1568.078] (-1567.482) (-1568.148) -- 0:02:25
319000 -- (-1569.865) (-1573.930) [-1568.459] (-1570.196) * (-1574.465) [-1565.154] (-1572.044) (-1571.697) -- 0:02:25
319500 -- (-1579.492) (-1570.617) [-1566.850] (-1579.788) * (-1568.529) (-1570.204) [-1567.965] (-1572.493) -- 0:02:24
320000 -- [-1575.003] (-1572.226) (-1577.969) (-1577.655) * (-1565.349) (-1573.302) [-1570.785] (-1575.302) -- 0:02:24
Average standard deviation of split frequencies: 0.005880
320500 -- (-1570.755) (-1574.244) [-1568.242] (-1575.116) * (-1573.783) (-1570.717) [-1568.290] (-1568.387) -- 0:02:26
321000 -- (-1571.502) [-1570.604] (-1570.020) (-1576.734) * (-1570.480) (-1565.227) [-1570.268] (-1571.507) -- 0:02:25
321500 -- (-1578.481) (-1578.534) [-1565.727] (-1581.456) * [-1571.523] (-1574.592) (-1574.036) (-1569.043) -- 0:02:25
322000 -- (-1568.272) (-1574.291) [-1576.249] (-1596.391) * (-1575.159) [-1575.528] (-1580.817) (-1570.780) -- 0:02:25
322500 -- (-1567.525) (-1573.678) [-1571.359] (-1587.182) * (-1575.059) [-1571.463] (-1576.056) (-1566.670) -- 0:02:24
323000 -- (-1575.582) (-1581.284) (-1578.416) [-1579.048] * (-1572.719) [-1565.989] (-1572.317) (-1569.669) -- 0:02:24
323500 -- (-1570.569) [-1572.377] (-1573.641) (-1564.487) * [-1571.030] (-1575.775) (-1571.969) (-1574.212) -- 0:02:24
324000 -- (-1577.371) (-1580.562) [-1569.664] (-1574.676) * (-1573.429) (-1575.371) [-1575.365] (-1573.012) -- 0:02:23
324500 -- (-1574.709) [-1569.877] (-1569.113) (-1569.539) * (-1572.215) (-1568.907) (-1576.242) [-1569.716] -- 0:02:23
325000 -- (-1573.589) [-1574.006] (-1571.393) (-1572.533) * (-1570.510) (-1569.451) [-1572.395] (-1570.618) -- 0:02:25
Average standard deviation of split frequencies: 0.005784
325500 -- (-1573.880) (-1568.047) (-1569.726) [-1573.075] * (-1576.476) (-1570.508) [-1567.794] (-1565.329) -- 0:02:25
326000 -- (-1582.872) (-1576.168) [-1573.683] (-1574.044) * (-1573.425) (-1574.099) [-1576.375] (-1571.160) -- 0:02:24
326500 -- [-1569.136] (-1569.924) (-1573.390) (-1572.377) * (-1576.472) (-1572.889) [-1569.134] (-1577.223) -- 0:02:24
327000 -- [-1569.744] (-1569.402) (-1568.217) (-1574.921) * [-1575.042] (-1573.846) (-1566.340) (-1576.226) -- 0:02:24
327500 -- [-1573.372] (-1574.156) (-1579.266) (-1574.757) * [-1566.644] (-1574.466) (-1569.280) (-1571.131) -- 0:02:23
328000 -- (-1574.684) [-1564.282] (-1580.231) (-1567.187) * [-1568.346] (-1574.320) (-1570.837) (-1575.363) -- 0:02:23
328500 -- [-1575.158] (-1570.007) (-1572.176) (-1577.303) * (-1571.814) [-1569.448] (-1569.903) (-1570.353) -- 0:02:23
329000 -- [-1579.777] (-1571.616) (-1568.453) (-1574.343) * [-1576.103] (-1565.000) (-1572.830) (-1571.685) -- 0:02:22
329500 -- (-1572.350) (-1575.476) (-1572.337) [-1572.868] * (-1572.418) (-1582.753) (-1568.573) [-1571.762] -- 0:02:22
330000 -- [-1572.319] (-1576.164) (-1567.705) (-1572.572) * (-1573.262) (-1577.617) [-1570.443] (-1568.839) -- 0:02:24
Average standard deviation of split frequencies: 0.005702
330500 -- [-1572.414] (-1583.478) (-1571.949) (-1567.306) * (-1575.762) (-1572.072) (-1567.853) [-1569.660] -- 0:02:23
331000 -- [-1569.349] (-1572.524) (-1573.725) (-1564.800) * [-1569.273] (-1575.030) (-1572.879) (-1569.053) -- 0:02:23
331500 -- [-1567.981] (-1571.771) (-1574.188) (-1568.290) * (-1572.014) (-1574.829) [-1575.138] (-1571.348) -- 0:02:23
332000 -- [-1569.317] (-1574.584) (-1570.987) (-1578.282) * (-1575.919) (-1567.898) (-1568.234) [-1571.325] -- 0:02:22
332500 -- (-1570.542) [-1569.525] (-1571.124) (-1580.897) * [-1565.471] (-1570.498) (-1570.182) (-1581.109) -- 0:02:22
333000 -- (-1567.166) [-1568.156] (-1571.797) (-1574.571) * (-1573.304) (-1574.524) [-1569.480] (-1575.796) -- 0:02:22
333500 -- (-1571.019) (-1564.885) (-1569.164) [-1571.852] * [-1573.139] (-1579.334) (-1584.905) (-1570.276) -- 0:02:21
334000 -- [-1570.188] (-1576.527) (-1575.520) (-1566.475) * (-1571.818) (-1570.013) (-1564.611) [-1569.378] -- 0:02:21
334500 -- (-1576.503) [-1572.104] (-1567.897) (-1567.586) * (-1576.010) (-1570.849) (-1577.381) [-1567.363] -- 0:02:21
335000 -- [-1575.621] (-1570.439) (-1572.675) (-1566.826) * (-1573.364) (-1568.572) (-1582.189) [-1565.162] -- 0:02:22
Average standard deviation of split frequencies: 0.005612
335500 -- (-1575.302) (-1572.276) (-1582.833) [-1569.440] * [-1570.108] (-1573.177) (-1572.110) (-1571.497) -- 0:02:22
336000 -- (-1573.062) (-1580.336) [-1570.131] (-1573.767) * (-1572.833) (-1566.989) (-1577.016) [-1572.738] -- 0:02:22
336500 -- (-1570.724) [-1572.169] (-1572.034) (-1574.137) * (-1573.061) [-1567.873] (-1570.198) (-1574.548) -- 0:02:21
337000 -- (-1577.040) [-1568.322] (-1567.643) (-1571.100) * (-1571.909) (-1577.680) (-1564.963) [-1571.880] -- 0:02:21
337500 -- (-1568.031) (-1572.612) [-1574.872] (-1572.706) * [-1574.546] (-1568.694) (-1564.725) (-1570.465) -- 0:02:21
338000 -- (-1570.909) (-1570.566) [-1571.080] (-1584.555) * (-1569.543) [-1567.446] (-1567.299) (-1567.525) -- 0:02:21
338500 -- [-1576.782] (-1575.895) (-1577.085) (-1571.484) * [-1569.743] (-1580.245) (-1569.981) (-1576.688) -- 0:02:20
339000 -- (-1573.512) (-1577.273) [-1572.739] (-1575.581) * (-1569.276) (-1575.020) (-1580.991) [-1566.975] -- 0:02:20
339500 -- (-1570.001) (-1573.550) [-1566.419] (-1582.719) * [-1571.540] (-1576.371) (-1570.147) (-1569.027) -- 0:02:20
340000 -- [-1571.254] (-1570.675) (-1576.602) (-1571.491) * (-1575.788) (-1570.254) (-1569.173) [-1568.940] -- 0:02:21
Average standard deviation of split frequencies: 0.007380
340500 -- (-1566.887) (-1572.696) (-1570.807) [-1562.558] * [-1573.009] (-1569.608) (-1572.474) (-1575.720) -- 0:02:21
341000 -- (-1572.974) (-1572.470) (-1573.940) [-1569.213] * (-1573.507) (-1565.752) (-1572.234) [-1567.592] -- 0:02:21
341500 -- (-1577.533) [-1567.867] (-1576.798) (-1566.546) * (-1576.268) (-1565.542) (-1568.231) [-1570.345] -- 0:02:20
342000 -- (-1583.258) [-1565.065] (-1570.786) (-1572.633) * (-1570.997) (-1570.557) (-1569.045) [-1566.569] -- 0:02:20
342500 -- (-1569.823) (-1577.356) [-1569.465] (-1567.109) * (-1574.726) [-1569.874] (-1573.618) (-1571.246) -- 0:02:20
343000 -- [-1569.854] (-1571.040) (-1572.606) (-1574.847) * [-1570.196] (-1570.881) (-1575.900) (-1574.406) -- 0:02:19
343500 -- (-1569.208) (-1571.570) (-1575.748) [-1576.696] * (-1581.721) (-1572.046) (-1575.420) [-1569.680] -- 0:02:19
344000 -- [-1571.865] (-1568.474) (-1576.709) (-1576.885) * [-1572.319] (-1570.597) (-1574.162) (-1570.248) -- 0:02:19
344500 -- (-1578.290) [-1571.815] (-1569.043) (-1571.544) * (-1566.252) [-1565.724] (-1569.477) (-1576.118) -- 0:02:20
345000 -- (-1572.352) (-1576.504) [-1568.690] (-1568.562) * (-1572.136) (-1574.206) (-1567.528) [-1571.496] -- 0:02:20
Average standard deviation of split frequencies: 0.007266
345500 -- [-1569.946] (-1575.288) (-1572.269) (-1568.410) * (-1573.510) (-1574.315) (-1566.561) [-1570.078] -- 0:02:20
346000 -- (-1577.261) (-1573.043) [-1569.258] (-1568.774) * (-1569.411) (-1575.078) [-1570.571] (-1571.147) -- 0:02:19
346500 -- [-1576.616] (-1578.386) (-1586.544) (-1575.760) * (-1573.700) (-1568.579) (-1570.123) [-1567.045] -- 0:02:19
347000 -- [-1576.512] (-1572.483) (-1578.386) (-1565.623) * (-1574.210) [-1565.774] (-1567.585) (-1569.376) -- 0:02:19
347500 -- (-1568.900) (-1577.162) [-1566.592] (-1568.029) * [-1572.071] (-1572.023) (-1569.633) (-1573.003) -- 0:02:18
348000 -- (-1572.246) (-1569.213) (-1568.565) [-1568.630] * [-1565.944] (-1566.995) (-1573.585) (-1574.613) -- 0:02:18
348500 -- (-1571.853) (-1573.052) [-1567.500] (-1570.874) * (-1573.495) [-1571.067] (-1568.714) (-1573.937) -- 0:02:18
349000 -- (-1566.096) (-1579.238) (-1570.111) [-1569.707] * (-1578.059) (-1575.648) (-1570.814) [-1567.390] -- 0:02:18
349500 -- (-1569.448) (-1569.347) [-1570.989] (-1573.956) * (-1576.845) [-1571.238] (-1572.964) (-1571.879) -- 0:02:19
350000 -- [-1569.896] (-1568.265) (-1570.698) (-1572.404) * (-1574.445) [-1568.490] (-1567.114) (-1567.957) -- 0:02:19
Average standard deviation of split frequencies: 0.006497
350500 -- [-1572.880] (-1570.230) (-1570.816) (-1576.142) * (-1568.453) (-1568.648) [-1575.392] (-1569.922) -- 0:02:18
351000 -- (-1580.805) [-1569.681] (-1572.097) (-1568.102) * (-1576.091) (-1573.271) [-1570.823] (-1566.871) -- 0:02:18
351500 -- (-1574.047) [-1568.456] (-1567.094) (-1569.803) * (-1577.038) (-1573.985) [-1569.373] (-1570.154) -- 0:02:18
352000 -- [-1568.257] (-1574.404) (-1579.860) (-1567.967) * (-1573.912) (-1573.027) [-1567.120] (-1573.120) -- 0:02:18
352500 -- [-1568.016] (-1566.915) (-1576.143) (-1577.704) * (-1576.467) [-1572.618] (-1569.123) (-1573.704) -- 0:02:17
353000 -- (-1573.729) (-1579.746) (-1572.855) [-1569.934] * (-1577.845) [-1565.557] (-1570.188) (-1576.237) -- 0:02:17
353500 -- (-1566.566) (-1570.931) (-1570.313) [-1574.041] * (-1580.446) [-1569.402] (-1573.334) (-1570.272) -- 0:02:17
354000 -- [-1572.664] (-1565.932) (-1572.551) (-1575.005) * (-1579.244) [-1565.253] (-1569.686) (-1567.879) -- 0:02:16
354500 -- [-1574.013] (-1571.441) (-1569.161) (-1574.130) * [-1565.158] (-1572.724) (-1570.337) (-1572.262) -- 0:02:18
355000 -- (-1578.511) [-1565.862] (-1574.585) (-1565.725) * (-1580.105) (-1576.307) [-1571.741] (-1572.850) -- 0:02:18
Average standard deviation of split frequencies: 0.006842
355500 -- (-1564.237) (-1575.769) (-1573.990) [-1570.435] * (-1571.994) (-1574.149) [-1571.374] (-1568.617) -- 0:02:17
356000 -- [-1566.802] (-1569.244) (-1578.198) (-1569.321) * (-1583.702) [-1572.127] (-1569.677) (-1576.285) -- 0:02:17
356500 -- (-1572.864) (-1580.306) [-1576.825] (-1574.570) * (-1574.241) (-1572.754) (-1569.243) [-1568.507] -- 0:02:17
357000 -- (-1572.873) (-1571.829) (-1572.924) [-1570.565] * (-1573.512) (-1582.656) [-1580.140] (-1573.343) -- 0:02:16
357500 -- (-1578.650) [-1572.714] (-1568.403) (-1576.764) * (-1573.169) (-1577.327) (-1591.219) [-1570.991] -- 0:02:16
358000 -- (-1571.024) (-1577.010) (-1566.020) [-1565.803] * (-1568.191) [-1567.904] (-1570.983) (-1571.562) -- 0:02:16
358500 -- (-1570.338) (-1573.861) [-1569.643] (-1573.289) * (-1569.034) (-1574.930) [-1569.275] (-1568.441) -- 0:02:15
359000 -- (-1569.544) (-1571.754) (-1570.017) [-1566.901] * (-1571.207) (-1565.341) (-1571.194) [-1568.028] -- 0:02:15
359500 -- (-1568.273) [-1568.086] (-1570.567) (-1577.199) * (-1578.324) (-1571.787) [-1572.744] (-1581.565) -- 0:02:17
360000 -- [-1567.364] (-1567.615) (-1575.104) (-1568.692) * [-1574.242] (-1569.483) (-1569.149) (-1569.825) -- 0:02:16
Average standard deviation of split frequencies: 0.008060
360500 -- [-1570.331] (-1578.469) (-1578.944) (-1571.454) * (-1571.278) [-1570.424] (-1575.932) (-1569.782) -- 0:02:16
361000 -- [-1574.883] (-1580.904) (-1569.955) (-1570.736) * (-1568.945) [-1571.011] (-1573.056) (-1574.435) -- 0:02:16
361500 -- (-1572.874) (-1579.631) (-1575.869) [-1572.309] * (-1574.143) (-1572.271) (-1568.765) [-1568.221] -- 0:02:16
362000 -- (-1574.571) [-1569.901] (-1575.855) (-1574.918) * (-1576.475) [-1571.739] (-1573.341) (-1569.861) -- 0:02:15
362500 -- (-1580.418) [-1571.069] (-1569.352) (-1582.270) * (-1569.278) (-1580.066) [-1572.731] (-1572.271) -- 0:02:15
363000 -- (-1573.641) (-1566.992) (-1571.986) [-1572.618] * (-1571.950) [-1567.886] (-1575.062) (-1575.400) -- 0:02:15
363500 -- (-1572.024) (-1569.527) (-1570.462) [-1568.941] * [-1572.689] (-1571.780) (-1571.516) (-1579.034) -- 0:02:14
364000 -- (-1567.412) (-1567.331) [-1574.916] (-1570.864) * (-1564.576) [-1575.513] (-1574.937) (-1580.566) -- 0:02:16
364500 -- [-1567.239] (-1567.595) (-1580.502) (-1571.732) * [-1570.753] (-1572.779) (-1568.243) (-1572.351) -- 0:02:15
365000 -- [-1566.639] (-1574.081) (-1572.659) (-1572.139) * (-1573.138) (-1578.041) [-1565.906] (-1574.369) -- 0:02:15
Average standard deviation of split frequencies: 0.008587
365500 -- (-1569.954) [-1569.633] (-1574.240) (-1574.295) * [-1572.110] (-1573.502) (-1576.237) (-1574.785) -- 0:02:15
366000 -- [-1570.519] (-1573.635) (-1565.252) (-1570.037) * (-1571.985) (-1572.499) (-1572.996) [-1567.226] -- 0:02:15
366500 -- (-1572.318) (-1572.607) [-1570.349] (-1567.675) * (-1573.625) (-1575.789) [-1565.179] (-1573.803) -- 0:02:14
367000 -- [-1565.405] (-1573.197) (-1565.985) (-1570.222) * (-1568.231) (-1575.006) (-1573.457) [-1566.282] -- 0:02:14
367500 -- (-1575.412) [-1573.996] (-1585.424) (-1566.665) * (-1571.273) (-1569.422) (-1572.706) [-1570.206] -- 0:02:14
368000 -- (-1570.056) (-1569.703) [-1571.803] (-1571.614) * (-1577.915) (-1573.577) [-1573.290] (-1576.956) -- 0:02:13
368500 -- [-1571.214] (-1580.993) (-1578.404) (-1566.742) * (-1571.588) [-1577.765] (-1569.484) (-1568.910) -- 0:02:13
369000 -- (-1572.764) [-1575.035] (-1577.054) (-1571.681) * (-1579.429) (-1569.129) [-1571.758] (-1570.569) -- 0:02:15
369500 -- (-1577.641) [-1567.773] (-1565.294) (-1574.487) * (-1576.468) (-1571.379) [-1570.434] (-1571.013) -- 0:02:14
370000 -- (-1570.299) [-1564.101] (-1575.398) (-1567.518) * (-1568.079) [-1567.542] (-1571.095) (-1580.257) -- 0:02:14
Average standard deviation of split frequencies: 0.008690
370500 -- [-1571.228] (-1570.874) (-1573.552) (-1571.658) * (-1575.737) (-1579.164) [-1563.737] (-1581.710) -- 0:02:14
371000 -- [-1571.180] (-1567.099) (-1576.272) (-1573.993) * (-1573.233) [-1575.442] (-1575.856) (-1573.689) -- 0:02:13
371500 -- [-1577.236] (-1571.582) (-1575.903) (-1569.060) * [-1577.416] (-1567.527) (-1568.833) (-1572.248) -- 0:02:13
372000 -- (-1573.288) (-1574.204) [-1566.588] (-1567.779) * (-1573.619) [-1570.711] (-1572.476) (-1572.499) -- 0:02:13
372500 -- [-1568.227] (-1572.091) (-1565.711) (-1569.088) * (-1577.586) (-1570.507) (-1576.933) [-1566.442] -- 0:02:13
373000 -- [-1569.595] (-1570.132) (-1570.379) (-1577.791) * (-1571.022) (-1574.586) [-1571.079] (-1565.629) -- 0:02:12
373500 -- (-1567.692) (-1576.421) [-1569.344] (-1571.343) * (-1576.062) (-1575.170) (-1575.934) [-1573.279] -- 0:02:12
374000 -- (-1574.839) [-1566.956] (-1570.905) (-1566.178) * (-1571.741) (-1574.001) (-1574.270) [-1566.590] -- 0:02:13
374500 -- [-1566.558] (-1569.640) (-1574.183) (-1578.592) * (-1571.556) [-1573.818] (-1566.751) (-1571.165) -- 0:02:13
375000 -- [-1569.329] (-1568.616) (-1567.109) (-1572.601) * (-1569.509) [-1575.829] (-1570.178) (-1572.335) -- 0:02:13
Average standard deviation of split frequencies: 0.007522
375500 -- [-1574.547] (-1570.586) (-1563.507) (-1577.459) * [-1566.509] (-1584.820) (-1571.828) (-1570.698) -- 0:02:13
376000 -- [-1572.361] (-1572.312) (-1579.466) (-1574.115) * (-1570.924) (-1574.462) (-1569.711) [-1570.646] -- 0:02:12
376500 -- (-1573.973) (-1569.036) (-1574.267) [-1567.721] * (-1571.593) (-1574.481) [-1567.324] (-1572.948) -- 0:02:12
377000 -- [-1577.571] (-1569.610) (-1574.427) (-1573.771) * (-1570.910) (-1574.952) (-1570.088) [-1568.206] -- 0:02:12
377500 -- (-1574.728) (-1572.504) (-1573.723) [-1569.108] * (-1571.859) [-1567.699] (-1568.595) (-1574.685) -- 0:02:11
378000 -- [-1568.157] (-1568.284) (-1568.462) (-1572.648) * (-1576.853) (-1576.086) [-1574.188] (-1566.255) -- 0:02:11
378500 -- (-1571.884) (-1569.496) (-1564.995) [-1568.185] * [-1567.380] (-1571.552) (-1581.064) (-1567.619) -- 0:02:11
379000 -- (-1573.830) (-1580.554) [-1567.353] (-1587.061) * (-1566.558) (-1569.739) (-1583.193) [-1572.058] -- 0:02:12
379500 -- (-1575.957) (-1576.316) (-1567.071) [-1574.284] * [-1570.833] (-1570.889) (-1572.975) (-1570.559) -- 0:02:12
380000 -- (-1571.663) (-1571.831) [-1566.822] (-1574.106) * (-1573.849) (-1569.494) (-1569.674) [-1567.726] -- 0:02:12
Average standard deviation of split frequencies: 0.006811
380500 -- (-1572.924) [-1572.564] (-1569.224) (-1570.024) * [-1569.706] (-1566.331) (-1568.840) (-1573.901) -- 0:02:11
381000 -- (-1571.578) (-1568.330) [-1570.207] (-1571.535) * (-1569.722) (-1572.651) [-1570.554] (-1572.816) -- 0:02:11
381500 -- (-1572.202) (-1570.501) [-1568.208] (-1570.581) * (-1572.577) (-1568.830) [-1570.965] (-1576.170) -- 0:02:11
382000 -- (-1568.913) [-1574.981] (-1579.288) (-1580.835) * (-1572.089) (-1570.266) (-1574.201) [-1577.394] -- 0:02:11
382500 -- (-1573.093) (-1570.656) (-1578.288) [-1567.764] * [-1570.836] (-1566.149) (-1572.109) (-1570.901) -- 0:02:10
383000 -- (-1576.598) (-1572.883) [-1570.261] (-1566.873) * [-1569.623] (-1570.301) (-1567.895) (-1581.290) -- 0:02:10
383500 -- (-1577.753) (-1577.575) [-1571.429] (-1574.715) * (-1568.280) (-1568.779) (-1570.294) [-1574.304] -- 0:02:11
384000 -- (-1575.261) (-1571.464) (-1576.848) [-1569.603] * [-1571.466] (-1577.737) (-1569.053) (-1567.034) -- 0:02:11
384500 -- (-1578.064) (-1565.661) (-1572.459) [-1567.407] * (-1573.690) (-1566.574) (-1565.444) [-1575.839] -- 0:02:11
385000 -- (-1577.494) (-1569.432) [-1569.001] (-1576.969) * (-1571.727) [-1564.692] (-1572.267) (-1577.755) -- 0:02:10
Average standard deviation of split frequencies: 0.008549
385500 -- (-1572.259) (-1565.103) (-1570.236) [-1579.271] * (-1575.083) [-1564.556] (-1565.647) (-1569.254) -- 0:02:10
386000 -- (-1579.012) [-1565.009] (-1568.635) (-1575.307) * (-1566.775) (-1569.721) [-1574.377] (-1573.181) -- 0:02:10
386500 -- (-1572.663) (-1567.787) (-1581.950) [-1567.710] * (-1570.472) [-1573.638] (-1570.521) (-1574.884) -- 0:02:10
387000 -- (-1575.553) (-1573.286) [-1576.394] (-1583.985) * [-1567.621] (-1570.299) (-1570.209) (-1570.300) -- 0:02:09
387500 -- (-1570.915) (-1575.067) [-1569.016] (-1576.160) * (-1568.747) (-1568.975) [-1566.480] (-1572.455) -- 0:02:09
388000 -- [-1572.240] (-1568.249) (-1569.605) (-1568.095) * (-1570.927) (-1577.170) [-1569.114] (-1568.478) -- 0:02:09
388500 -- (-1581.378) (-1574.506) (-1571.164) [-1573.855] * (-1569.500) [-1576.295] (-1580.865) (-1566.479) -- 0:02:10
389000 -- [-1569.159] (-1565.820) (-1571.974) (-1569.542) * (-1573.337) (-1571.577) [-1569.355] (-1573.624) -- 0:02:10
389500 -- (-1570.386) (-1563.873) [-1573.674] (-1573.635) * [-1575.636] (-1571.622) (-1571.123) (-1576.757) -- 0:02:10
390000 -- (-1572.443) [-1567.430] (-1572.889) (-1574.033) * (-1569.385) (-1567.441) [-1568.575] (-1577.710) -- 0:02:09
Average standard deviation of split frequencies: 0.008849
390500 -- (-1572.487) (-1569.479) (-1577.344) [-1572.372] * (-1567.426) (-1565.481) [-1565.903] (-1576.533) -- 0:02:09
391000 -- [-1571.418] (-1566.237) (-1573.999) (-1589.912) * (-1577.848) (-1565.099) [-1570.616] (-1574.751) -- 0:02:09
391500 -- (-1574.655) [-1565.568] (-1570.043) (-1566.350) * (-1568.696) (-1578.734) [-1570.850] (-1571.556) -- 0:02:09
392000 -- (-1576.783) (-1572.183) (-1576.685) [-1567.398] * (-1570.341) [-1570.932] (-1575.371) (-1574.882) -- 0:02:08
392500 -- (-1572.353) (-1566.750) (-1568.181) [-1570.513] * (-1575.384) (-1571.041) [-1574.199] (-1573.467) -- 0:02:08
393000 -- (-1577.750) (-1573.032) (-1580.030) [-1571.090] * (-1575.650) (-1580.906) (-1572.285) [-1570.769] -- 0:02:08
393500 -- [-1571.628] (-1573.126) (-1577.169) (-1571.899) * (-1580.807) (-1573.897) [-1565.207] (-1572.118) -- 0:02:09
394000 -- (-1571.080) [-1569.559] (-1568.728) (-1571.798) * [-1570.241] (-1570.564) (-1569.959) (-1575.662) -- 0:02:09
394500 -- (-1572.281) (-1573.617) [-1571.200] (-1571.376) * (-1575.982) (-1567.297) (-1570.004) [-1573.181] -- 0:02:08
395000 -- [-1567.449] (-1576.833) (-1574.762) (-1574.342) * (-1570.897) (-1575.539) (-1575.230) [-1571.465] -- 0:02:08
Average standard deviation of split frequencies: 0.007341
395500 -- (-1572.919) (-1573.386) (-1570.951) [-1569.827] * (-1565.087) (-1568.254) (-1572.664) [-1572.247] -- 0:02:08
396000 -- (-1574.019) (-1577.068) (-1576.517) [-1566.257] * (-1574.081) (-1568.992) (-1576.697) [-1571.211] -- 0:02:08
396500 -- (-1568.753) (-1572.097) (-1572.155) [-1569.357] * (-1568.962) (-1579.790) [-1577.671] (-1569.678) -- 0:02:07
397000 -- (-1568.603) (-1567.276) (-1572.155) [-1572.437] * (-1565.921) (-1577.239) (-1570.820) [-1570.749] -- 0:02:07
397500 -- [-1571.475] (-1569.000) (-1581.731) (-1570.841) * [-1574.149] (-1572.064) (-1574.142) (-1573.114) -- 0:02:07
398000 -- [-1569.162] (-1575.985) (-1575.328) (-1574.417) * [-1569.567] (-1578.319) (-1581.398) (-1572.921) -- 0:02:07
398500 -- (-1566.787) (-1574.430) [-1571.945] (-1568.979) * (-1571.471) [-1570.105] (-1573.976) (-1567.486) -- 0:02:08
399000 -- (-1567.270) [-1574.464] (-1575.609) (-1573.967) * (-1573.763) (-1575.841) (-1572.375) [-1572.378] -- 0:02:08
399500 -- [-1566.786] (-1572.208) (-1572.954) (-1569.441) * (-1570.050) (-1572.032) (-1580.622) [-1574.080] -- 0:02:07
400000 -- [-1573.298] (-1572.840) (-1575.348) (-1570.502) * (-1579.224) (-1575.568) [-1569.206] (-1570.599) -- 0:02:07
Average standard deviation of split frequencies: 0.006471
400500 -- (-1585.966) (-1572.265) [-1574.255] (-1573.922) * (-1569.677) (-1568.719) [-1571.450] (-1577.071) -- 0:02:07
401000 -- (-1576.816) (-1573.299) (-1571.572) [-1570.213] * (-1567.771) [-1570.138] (-1575.077) (-1573.750) -- 0:02:06
401500 -- (-1568.950) (-1578.364) [-1572.083] (-1571.500) * (-1568.916) (-1577.378) [-1571.940] (-1574.213) -- 0:02:06
402000 -- (-1588.414) (-1580.114) (-1569.479) [-1568.702] * (-1571.858) (-1569.034) (-1581.252) [-1572.577] -- 0:02:06
402500 -- (-1575.202) (-1570.868) (-1578.357) [-1565.944] * (-1567.213) (-1580.906) [-1568.424] (-1579.299) -- 0:02:06
403000 -- (-1577.176) [-1569.167] (-1575.238) (-1575.073) * (-1569.329) (-1563.972) [-1573.975] (-1571.432) -- 0:02:07
403500 -- (-1575.850) [-1573.906] (-1570.078) (-1574.965) * (-1577.005) [-1571.533] (-1578.068) (-1577.934) -- 0:02:07
404000 -- (-1581.306) (-1571.123) (-1572.637) [-1568.029] * (-1584.569) (-1570.519) (-1569.731) [-1571.258] -- 0:02:06
404500 -- (-1580.993) (-1574.368) [-1571.135] (-1570.968) * (-1578.860) [-1571.807] (-1570.328) (-1574.273) -- 0:02:06
405000 -- (-1571.691) (-1573.629) [-1568.855] (-1574.238) * (-1574.533) (-1571.937) (-1576.777) [-1567.696] -- 0:02:06
Average standard deviation of split frequencies: 0.007547
405500 -- [-1569.982] (-1567.815) (-1571.031) (-1576.301) * (-1573.653) (-1569.395) [-1573.361] (-1583.924) -- 0:02:06
406000 -- (-1573.503) [-1568.969] (-1571.189) (-1571.642) * [-1572.423] (-1576.061) (-1573.053) (-1572.711) -- 0:02:05
406500 -- (-1568.851) (-1572.984) (-1567.531) [-1573.548] * (-1571.457) [-1573.699] (-1574.100) (-1574.303) -- 0:02:05
407000 -- (-1573.360) (-1575.980) [-1570.501] (-1585.366) * (-1573.321) [-1573.342] (-1577.286) (-1565.922) -- 0:02:05
407500 -- (-1576.087) (-1571.912) (-1567.388) [-1569.870] * (-1581.685) (-1569.293) (-1574.380) [-1566.938] -- 0:02:05
408000 -- (-1576.272) (-1568.266) (-1579.510) [-1571.756] * (-1578.237) [-1574.627] (-1578.175) (-1574.264) -- 0:02:06
408500 -- [-1572.839] (-1573.779) (-1576.358) (-1572.695) * (-1576.406) (-1567.034) [-1571.928] (-1575.920) -- 0:02:05
409000 -- (-1575.373) (-1576.323) (-1574.729) [-1566.246] * [-1578.380] (-1571.103) (-1575.869) (-1571.498) -- 0:02:05
409500 -- [-1574.132] (-1580.212) (-1577.820) (-1575.495) * (-1572.514) (-1576.402) [-1568.978] (-1570.025) -- 0:02:05
410000 -- (-1574.466) (-1586.169) (-1587.933) [-1574.711] * (-1571.273) (-1576.229) [-1568.229] (-1571.867) -- 0:02:05
Average standard deviation of split frequencies: 0.007270
410500 -- (-1569.657) (-1577.016) (-1592.951) [-1569.184] * [-1565.033] (-1568.165) (-1567.574) (-1575.707) -- 0:02:04
411000 -- [-1570.766] (-1568.569) (-1588.824) (-1568.005) * (-1568.527) (-1576.753) [-1567.468] (-1576.758) -- 0:02:04
411500 -- (-1571.945) (-1572.678) (-1577.661) [-1573.398] * [-1574.990] (-1578.073) (-1571.337) (-1572.890) -- 0:02:04
412000 -- (-1573.049) (-1576.417) [-1569.470] (-1573.095) * (-1571.458) (-1571.929) (-1570.735) [-1569.284] -- 0:02:04
412500 -- (-1576.245) (-1574.571) [-1568.791] (-1568.249) * [-1573.041] (-1572.001) (-1573.658) (-1571.678) -- 0:02:03
413000 -- (-1573.195) [-1567.473] (-1577.981) (-1564.760) * (-1571.033) (-1573.213) (-1565.956) [-1570.172] -- 0:02:05
413500 -- (-1574.345) (-1567.091) [-1572.625] (-1574.924) * (-1571.301) [-1570.878] (-1568.951) (-1571.492) -- 0:02:04
414000 -- (-1581.783) [-1571.168] (-1569.369) (-1575.184) * (-1588.940) [-1570.022] (-1579.485) (-1566.136) -- 0:02:04
414500 -- (-1577.676) (-1577.424) (-1573.905) [-1567.010] * [-1566.240] (-1576.520) (-1568.859) (-1576.057) -- 0:02:04
415000 -- (-1578.060) [-1565.809] (-1574.701) (-1567.237) * (-1581.063) [-1569.454] (-1567.025) (-1567.976) -- 0:02:04
Average standard deviation of split frequencies: 0.008499
415500 -- (-1574.372) (-1565.760) [-1567.691] (-1567.015) * (-1566.741) (-1569.251) (-1567.828) [-1569.051] -- 0:02:03
416000 -- [-1569.951] (-1565.084) (-1570.294) (-1575.176) * (-1569.814) [-1574.029] (-1571.997) (-1569.766) -- 0:02:03
416500 -- (-1583.416) (-1570.536) [-1574.868] (-1571.636) * (-1570.058) [-1567.445] (-1575.459) (-1573.493) -- 0:02:03
417000 -- (-1567.471) (-1572.640) [-1571.620] (-1573.594) * (-1569.768) (-1569.490) (-1573.275) [-1567.816] -- 0:02:03
417500 -- (-1570.689) (-1571.608) (-1570.252) [-1568.906] * (-1572.755) (-1575.571) (-1569.224) [-1565.029] -- 0:02:04
418000 -- (-1573.299) [-1566.257] (-1574.449) (-1568.249) * [-1573.326] (-1571.730) (-1573.461) (-1570.637) -- 0:02:03
418500 -- (-1575.380) [-1569.196] (-1571.201) (-1565.743) * (-1571.812) (-1576.966) (-1579.637) [-1573.193] -- 0:02:03
419000 -- (-1573.557) (-1570.593) (-1576.178) [-1568.895] * (-1573.230) (-1568.777) (-1573.385) [-1579.638] -- 0:02:03
419500 -- (-1570.881) (-1572.934) (-1579.632) [-1568.418] * (-1569.175) [-1566.922] (-1568.971) (-1573.705) -- 0:02:03
420000 -- (-1569.216) (-1583.159) (-1576.964) [-1564.135] * (-1571.748) [-1572.984] (-1579.344) (-1570.114) -- 0:02:02
Average standard deviation of split frequencies: 0.008031
420500 -- (-1570.593) [-1571.372] (-1571.643) (-1573.563) * (-1578.601) (-1570.186) [-1564.377] (-1570.420) -- 0:02:02
421000 -- [-1574.221] (-1576.934) (-1575.971) (-1573.959) * (-1570.349) (-1569.295) (-1572.291) [-1568.600] -- 0:02:02
421500 -- (-1568.688) (-1584.696) (-1576.459) [-1569.876] * (-1572.896) [-1571.303] (-1573.374) (-1574.099) -- 0:02:02
422000 -- (-1573.508) (-1575.853) (-1569.594) [-1571.995] * (-1573.525) (-1570.389) [-1566.396] (-1578.685) -- 0:02:01
422500 -- (-1579.086) (-1571.074) (-1569.331) [-1576.620] * (-1582.884) (-1566.656) (-1568.312) [-1568.456] -- 0:02:03
423000 -- (-1586.867) (-1572.637) (-1573.422) [-1570.596] * (-1571.425) [-1564.702] (-1567.290) (-1572.877) -- 0:02:02
423500 -- (-1576.669) (-1567.972) (-1571.510) [-1574.186] * [-1568.632] (-1570.672) (-1568.672) (-1575.891) -- 0:02:02
424000 -- (-1573.529) (-1572.964) [-1571.602] (-1569.715) * (-1586.730) [-1570.354] (-1567.642) (-1578.340) -- 0:02:02
424500 -- [-1567.515] (-1568.120) (-1578.861) (-1576.328) * [-1569.436] (-1569.203) (-1584.799) (-1571.654) -- 0:02:02
425000 -- [-1569.030] (-1568.266) (-1573.706) (-1570.991) * (-1574.812) [-1581.098] (-1575.534) (-1575.764) -- 0:02:01
Average standard deviation of split frequencies: 0.009590
425500 -- [-1571.531] (-1574.596) (-1578.493) (-1571.251) * [-1575.411] (-1567.034) (-1568.395) (-1575.413) -- 0:02:01
426000 -- (-1575.269) (-1572.442) (-1588.781) [-1573.480] * (-1573.866) [-1569.100] (-1571.756) (-1576.075) -- 0:02:01
426500 -- [-1564.272] (-1571.315) (-1576.510) (-1575.906) * (-1574.013) [-1566.085] (-1580.938) (-1572.287) -- 0:02:01
427000 -- (-1572.185) (-1573.813) (-1577.512) [-1574.188] * [-1572.702] (-1565.688) (-1567.163) (-1569.829) -- 0:02:00
427500 -- (-1573.139) (-1575.230) [-1575.460] (-1573.127) * (-1573.757) (-1582.469) (-1565.737) [-1573.393] -- 0:02:01
428000 -- (-1575.137) (-1574.869) (-1572.041) [-1576.192] * [-1571.186] (-1569.528) (-1568.626) (-1574.500) -- 0:02:01
428500 -- [-1566.647] (-1571.402) (-1569.525) (-1574.105) * (-1569.263) (-1572.181) (-1567.598) [-1569.030] -- 0:02:01
429000 -- (-1569.068) (-1578.183) (-1565.324) [-1570.891] * [-1573.916] (-1570.609) (-1579.287) (-1571.717) -- 0:02:01
429500 -- (-1573.300) [-1571.425] (-1569.354) (-1571.887) * (-1572.466) (-1574.056) (-1570.871) [-1575.400] -- 0:02:00
430000 -- [-1570.200] (-1573.205) (-1567.034) (-1569.390) * [-1572.800] (-1577.713) (-1572.570) (-1574.240) -- 0:02:00
Average standard deviation of split frequencies: 0.008757
430500 -- [-1570.890] (-1568.264) (-1570.410) (-1575.808) * (-1567.386) (-1576.303) [-1571.865] (-1569.431) -- 0:02:00
431000 -- (-1566.991) (-1570.115) (-1570.446) [-1572.367] * [-1569.304] (-1578.228) (-1574.671) (-1570.840) -- 0:02:00
431500 -- (-1568.006) (-1568.430) [-1564.979] (-1566.024) * (-1571.095) (-1567.288) [-1568.880] (-1575.088) -- 0:01:59
432000 -- [-1567.746] (-1570.925) (-1568.443) (-1576.262) * [-1567.367] (-1570.447) (-1576.376) (-1573.820) -- 0:01:59
432500 -- (-1575.755) [-1566.922] (-1574.612) (-1568.956) * (-1568.145) (-1564.957) [-1564.851] (-1573.059) -- 0:02:00
433000 -- [-1568.883] (-1575.177) (-1574.744) (-1575.084) * (-1568.858) (-1578.189) [-1569.682] (-1571.521) -- 0:02:00
433500 -- (-1570.249) [-1577.254] (-1581.767) (-1569.099) * (-1573.842) (-1578.204) [-1569.184] (-1574.847) -- 0:02:00
434000 -- (-1569.869) (-1571.061) [-1578.510] (-1569.893) * (-1566.905) (-1574.056) [-1567.991] (-1571.379) -- 0:01:59
434500 -- (-1566.760) (-1571.196) [-1569.637] (-1567.503) * (-1583.185) (-1567.188) (-1573.416) [-1568.933] -- 0:01:59
435000 -- (-1570.928) (-1574.687) (-1565.727) [-1566.813] * (-1572.781) (-1567.980) [-1567.288] (-1572.245) -- 0:01:59
Average standard deviation of split frequencies: 0.008289
435500 -- [-1570.699] (-1578.963) (-1569.093) (-1570.292) * [-1570.654] (-1572.023) (-1571.864) (-1572.125) -- 0:01:59
436000 -- (-1571.729) (-1576.372) (-1569.551) [-1564.328] * [-1574.813] (-1578.362) (-1568.298) (-1570.942) -- 0:01:59
436500 -- [-1570.502] (-1573.580) (-1570.583) (-1571.131) * [-1566.548] (-1575.541) (-1568.774) (-1565.824) -- 0:01:58
437000 -- (-1578.202) [-1567.228] (-1576.372) (-1575.627) * (-1570.433) [-1572.314] (-1571.372) (-1567.687) -- 0:01:59
437500 -- (-1572.421) (-1577.046) (-1568.870) [-1571.011] * (-1581.790) (-1577.637) [-1566.590] (-1571.444) -- 0:01:59
438000 -- (-1576.649) (-1568.848) [-1572.938] (-1569.554) * [-1569.273] (-1577.473) (-1570.727) (-1571.698) -- 0:01:59
438500 -- (-1583.054) [-1569.255] (-1574.418) (-1569.859) * (-1584.983) (-1581.181) (-1572.885) [-1571.014] -- 0:01:59
439000 -- (-1571.510) (-1566.656) (-1574.679) [-1570.366] * (-1579.901) (-1571.407) (-1584.466) [-1570.155] -- 0:01:58
439500 -- (-1566.166) (-1568.124) (-1585.200) [-1569.798] * (-1575.078) [-1574.498] (-1575.478) (-1575.768) -- 0:01:58
440000 -- (-1571.589) (-1572.126) [-1570.848] (-1572.090) * (-1571.482) (-1571.724) [-1567.318] (-1573.737) -- 0:01:58
Average standard deviation of split frequencies: 0.008380
440500 -- (-1575.506) (-1573.212) [-1571.142] (-1572.715) * (-1571.065) (-1566.778) [-1569.101] (-1572.836) -- 0:01:58
441000 -- (-1567.091) (-1569.856) (-1569.601) [-1573.057] * [-1568.978] (-1573.268) (-1569.487) (-1574.166) -- 0:01:57
441500 -- (-1571.794) [-1569.053] (-1577.658) (-1571.039) * (-1567.300) (-1566.380) (-1572.564) [-1576.195] -- 0:01:57
442000 -- [-1571.302] (-1572.652) (-1578.635) (-1591.032) * (-1569.083) [-1564.288] (-1575.320) (-1574.531) -- 0:01:58
442500 -- [-1565.662] (-1577.736) (-1570.353) (-1578.340) * (-1574.785) (-1570.098) [-1571.686] (-1577.989) -- 0:01:58
443000 -- (-1577.604) (-1570.695) (-1570.876) [-1568.694] * (-1571.460) (-1566.518) [-1565.425] (-1586.402) -- 0:01:58
443500 -- (-1576.677) [-1576.154] (-1565.769) (-1580.125) * (-1572.132) (-1575.006) [-1569.317] (-1566.434) -- 0:01:57
444000 -- (-1575.333) (-1569.893) (-1573.193) [-1568.750] * [-1567.986] (-1571.205) (-1572.190) (-1571.851) -- 0:01:57
444500 -- (-1568.203) (-1567.621) (-1573.959) [-1573.416] * (-1575.292) (-1572.980) [-1573.272] (-1568.885) -- 0:01:57
445000 -- (-1572.745) [-1575.672] (-1566.785) (-1566.960) * (-1576.229) (-1570.900) [-1570.495] (-1570.914) -- 0:01:57
Average standard deviation of split frequencies: 0.008456
445500 -- (-1570.368) (-1573.612) [-1572.803] (-1567.663) * (-1580.263) (-1569.577) (-1568.252) [-1570.210] -- 0:01:56
446000 -- (-1567.124) (-1575.739) [-1575.672] (-1578.031) * (-1568.695) [-1575.546] (-1572.682) (-1576.512) -- 0:01:56
446500 -- (-1568.714) [-1567.042] (-1572.637) (-1571.906) * (-1575.602) (-1570.997) (-1577.466) [-1574.336] -- 0:01:56
447000 -- (-1568.496) (-1568.324) [-1566.142] (-1576.989) * (-1570.887) (-1580.261) [-1575.442] (-1584.234) -- 0:01:57
447500 -- (-1570.339) (-1578.760) [-1567.298] (-1572.249) * (-1570.112) (-1578.629) (-1575.819) [-1570.289] -- 0:01:57
448000 -- (-1567.675) (-1575.726) (-1574.539) [-1566.973] * (-1571.003) [-1570.259] (-1574.173) (-1577.338) -- 0:01:57
448500 -- [-1571.320] (-1571.451) (-1568.871) (-1571.719) * (-1570.899) (-1573.872) (-1568.758) [-1576.100] -- 0:01:56
449000 -- (-1570.263) (-1579.974) [-1574.448] (-1569.626) * (-1570.969) (-1572.244) (-1567.877) [-1566.042] -- 0:01:56
449500 -- (-1567.274) [-1571.431] (-1585.423) (-1570.768) * (-1569.262) [-1563.799] (-1567.995) (-1571.157) -- 0:01:56
450000 -- (-1572.962) (-1576.858) [-1565.774] (-1571.660) * (-1574.108) [-1570.962] (-1574.012) (-1569.214) -- 0:01:56
Average standard deviation of split frequencies: 0.010111
450500 -- (-1573.935) (-1568.334) (-1568.466) [-1573.006] * (-1573.242) (-1572.498) (-1565.643) [-1573.537] -- 0:01:55
451000 -- (-1574.509) (-1577.665) (-1574.576) [-1569.661] * (-1578.653) [-1570.316] (-1571.391) (-1572.239) -- 0:01:55
451500 -- (-1567.764) (-1573.956) [-1571.758] (-1579.413) * (-1580.470) (-1573.424) (-1575.693) [-1568.870] -- 0:01:55
452000 -- (-1573.469) (-1569.348) [-1566.066] (-1576.234) * (-1569.693) (-1575.737) (-1573.596) [-1572.475] -- 0:01:56
452500 -- [-1570.196] (-1566.569) (-1577.289) (-1575.646) * (-1569.826) (-1577.709) [-1568.567] (-1573.776) -- 0:01:56
453000 -- [-1572.019] (-1578.157) (-1569.902) (-1575.303) * (-1571.857) [-1571.185] (-1568.513) (-1570.618) -- 0:01:55
453500 -- [-1565.579] (-1575.427) (-1567.006) (-1583.545) * (-1568.094) (-1568.984) (-1576.278) [-1570.898] -- 0:01:55
454000 -- (-1567.472) [-1570.479] (-1570.773) (-1572.523) * (-1568.717) (-1574.134) [-1573.524] (-1568.242) -- 0:01:55
454500 -- (-1566.114) [-1568.314] (-1569.123) (-1578.970) * (-1580.581) (-1575.655) (-1575.180) [-1565.407] -- 0:01:55
455000 -- [-1571.144] (-1576.906) (-1572.108) (-1573.855) * [-1569.871] (-1573.107) (-1573.385) (-1571.932) -- 0:01:54
Average standard deviation of split frequencies: 0.008959
455500 -- (-1567.318) [-1573.125] (-1574.017) (-1574.629) * (-1566.515) (-1571.575) (-1571.250) [-1570.822] -- 0:01:54
456000 -- (-1572.228) [-1567.390] (-1573.544) (-1573.795) * (-1568.433) (-1574.418) (-1574.673) [-1568.730] -- 0:01:54
456500 -- [-1570.590] (-1575.718) (-1567.889) (-1565.752) * (-1573.884) (-1576.240) [-1569.664] (-1572.645) -- 0:01:54
457000 -- (-1572.283) (-1568.542) (-1572.325) [-1571.890] * [-1568.323] (-1574.839) (-1573.224) (-1570.742) -- 0:01:55
457500 -- [-1567.110] (-1574.704) (-1575.008) (-1568.228) * (-1564.956) (-1570.250) (-1572.568) [-1572.239] -- 0:01:55
458000 -- (-1574.742) [-1576.408] (-1579.489) (-1566.847) * (-1567.362) (-1572.058) (-1571.375) [-1570.669] -- 0:01:54
458500 -- [-1573.480] (-1573.428) (-1578.785) (-1568.370) * (-1577.037) [-1569.942] (-1569.259) (-1575.124) -- 0:01:54
459000 -- [-1569.437] (-1573.810) (-1571.180) (-1574.655) * (-1571.100) (-1568.431) (-1575.072) [-1574.542] -- 0:01:54
459500 -- (-1570.022) (-1568.404) (-1584.693) [-1573.773] * [-1567.686] (-1566.426) (-1575.132) (-1574.285) -- 0:01:54
460000 -- (-1579.176) (-1571.199) [-1572.685] (-1582.139) * (-1580.913) (-1572.528) [-1569.807] (-1577.228) -- 0:01:53
Average standard deviation of split frequencies: 0.008698
460500 -- (-1570.437) (-1577.488) [-1563.996] (-1572.348) * (-1567.546) [-1572.574] (-1574.272) (-1574.519) -- 0:01:53
461000 -- (-1579.326) (-1572.355) [-1568.496] (-1575.164) * (-1581.467) [-1569.478] (-1571.125) (-1571.515) -- 0:01:53
461500 -- [-1568.228] (-1571.592) (-1567.829) (-1576.033) * [-1570.606] (-1574.465) (-1576.173) (-1569.509) -- 0:01:54
462000 -- [-1580.271] (-1581.077) (-1570.356) (-1573.882) * (-1574.795) (-1566.630) [-1572.372] (-1577.676) -- 0:01:54
462500 -- (-1573.473) (-1577.788) [-1568.461] (-1567.224) * (-1575.662) (-1577.387) (-1570.677) [-1569.049] -- 0:01:53
463000 -- (-1576.240) (-1584.321) (-1576.395) [-1575.168] * (-1571.473) [-1568.753] (-1568.165) (-1580.360) -- 0:01:53
463500 -- [-1572.985] (-1570.659) (-1568.611) (-1573.431) * (-1570.909) [-1571.063] (-1568.584) (-1571.245) -- 0:01:53
464000 -- [-1566.405] (-1570.124) (-1568.488) (-1570.926) * [-1571.732] (-1578.430) (-1565.284) (-1568.901) -- 0:01:53
464500 -- (-1571.028) (-1565.234) (-1576.667) [-1575.862] * (-1576.267) [-1575.145] (-1570.716) (-1568.543) -- 0:01:52
465000 -- [-1568.541] (-1568.333) (-1569.536) (-1574.752) * (-1571.027) (-1574.780) [-1570.071] (-1566.864) -- 0:01:52
Average standard deviation of split frequencies: 0.007924
465500 -- (-1570.937) [-1569.818] (-1570.334) (-1569.369) * (-1573.305) (-1575.345) (-1573.853) [-1564.505] -- 0:01:52
466000 -- (-1569.941) (-1574.603) [-1569.021] (-1574.125) * [-1571.847] (-1581.107) (-1576.710) (-1571.994) -- 0:01:52
466500 -- [-1576.168] (-1572.658) (-1576.452) (-1570.844) * (-1572.596) (-1573.418) (-1575.343) [-1568.054] -- 0:01:53
467000 -- (-1578.330) (-1576.151) [-1564.136] (-1577.850) * (-1567.919) (-1572.377) [-1571.887] (-1569.114) -- 0:01:52
467500 -- (-1572.245) (-1576.377) [-1571.029] (-1572.453) * [-1564.210] (-1575.165) (-1574.672) (-1565.446) -- 0:01:52
468000 -- [-1571.298] (-1577.140) (-1576.288) (-1576.201) * (-1571.451) (-1576.332) [-1574.404] (-1571.509) -- 0:01:52
468500 -- (-1579.073) (-1577.623) [-1568.300] (-1575.829) * (-1568.793) (-1565.001) (-1573.202) [-1568.123] -- 0:01:52
469000 -- [-1568.640] (-1576.997) (-1571.713) (-1570.227) * (-1571.394) [-1564.447] (-1572.454) (-1571.351) -- 0:01:52
469500 -- (-1578.214) [-1568.889] (-1571.722) (-1569.949) * (-1570.894) [-1566.993] (-1571.254) (-1570.826) -- 0:01:51
470000 -- (-1574.001) (-1578.178) [-1572.968] (-1572.398) * (-1569.691) [-1571.409] (-1576.891) (-1574.911) -- 0:01:51
Average standard deviation of split frequencies: 0.007178
470500 -- (-1573.948) (-1581.700) [-1568.756] (-1572.728) * (-1577.320) (-1569.764) [-1572.445] (-1568.533) -- 0:01:51
471000 -- (-1567.174) (-1571.386) (-1581.427) [-1569.070] * (-1567.095) (-1566.767) [-1573.175] (-1574.638) -- 0:01:51
471500 -- [-1566.886] (-1572.370) (-1580.024) (-1569.134) * (-1568.065) [-1579.101] (-1571.202) (-1574.928) -- 0:01:52
472000 -- [-1570.488] (-1567.864) (-1576.261) (-1581.115) * (-1571.777) (-1570.690) (-1570.816) [-1577.211] -- 0:01:51
472500 -- (-1572.280) (-1568.825) [-1572.506] (-1570.454) * (-1569.457) (-1568.453) [-1572.074] (-1574.423) -- 0:01:51
473000 -- (-1572.044) (-1572.638) (-1569.835) [-1567.432] * [-1576.014] (-1576.072) (-1568.387) (-1573.517) -- 0:01:51
473500 -- (-1571.665) (-1572.009) [-1576.235] (-1568.250) * (-1573.126) (-1571.455) (-1579.632) [-1565.599] -- 0:01:51
474000 -- (-1569.660) (-1574.935) [-1571.480] (-1571.153) * (-1572.696) (-1568.530) [-1575.544] (-1571.809) -- 0:01:50
474500 -- (-1575.319) (-1580.724) (-1569.048) [-1569.440] * [-1578.311] (-1568.519) (-1578.009) (-1572.387) -- 0:01:50
475000 -- (-1568.173) [-1570.206] (-1569.760) (-1574.850) * (-1576.910) (-1579.702) (-1580.167) [-1571.949] -- 0:01:50
Average standard deviation of split frequencies: 0.005942
475500 -- (-1572.869) (-1573.375) (-1573.535) [-1567.026] * (-1573.624) [-1575.018] (-1580.970) (-1582.202) -- 0:01:50
476000 -- (-1573.358) (-1573.705) [-1569.047] (-1575.717) * (-1570.668) (-1572.392) (-1568.954) [-1572.161] -- 0:01:51
476500 -- (-1584.648) [-1570.187] (-1572.436) (-1579.563) * (-1567.142) (-1572.132) (-1570.778) [-1575.293] -- 0:01:50
477000 -- (-1569.135) (-1571.728) (-1569.925) [-1574.371] * [-1569.641] (-1576.702) (-1576.280) (-1571.867) -- 0:01:50
477500 -- [-1572.888] (-1577.574) (-1573.360) (-1575.815) * (-1570.256) (-1579.428) [-1570.624] (-1571.432) -- 0:01:50
478000 -- (-1569.788) (-1579.245) (-1570.336) [-1573.074] * (-1570.675) (-1573.304) [-1568.728] (-1568.792) -- 0:01:50
478500 -- [-1573.732] (-1574.465) (-1571.226) (-1572.208) * [-1569.111] (-1568.034) (-1575.761) (-1571.400) -- 0:01:50
479000 -- (-1576.904) (-1567.017) (-1567.314) [-1567.384] * (-1568.974) (-1569.936) (-1569.389) [-1573.706] -- 0:01:49
479500 -- (-1578.582) (-1575.244) [-1567.948] (-1564.671) * (-1572.972) (-1571.818) (-1566.655) [-1576.971] -- 0:01:49
480000 -- (-1569.950) (-1566.762) [-1568.081] (-1571.128) * (-1568.020) (-1568.942) [-1566.045] (-1575.150) -- 0:01:49
Average standard deviation of split frequencies: 0.005557
480500 -- (-1572.430) (-1567.943) (-1568.759) [-1573.359] * (-1577.338) (-1571.506) (-1567.213) [-1567.586] -- 0:01:49
481000 -- (-1567.287) (-1568.667) [-1574.056] (-1572.499) * (-1570.081) [-1568.662] (-1570.814) (-1576.004) -- 0:01:50
481500 -- [-1575.252] (-1571.363) (-1572.736) (-1571.306) * (-1577.944) (-1569.852) [-1566.840] (-1566.106) -- 0:01:49
482000 -- (-1567.950) (-1570.423) (-1574.128) [-1573.385] * [-1568.583] (-1568.858) (-1572.054) (-1571.809) -- 0:01:49
482500 -- (-1581.648) (-1579.830) (-1572.022) [-1569.467] * [-1568.845] (-1573.116) (-1570.836) (-1571.194) -- 0:01:49
483000 -- (-1568.082) (-1573.852) (-1581.632) [-1566.712] * (-1570.091) (-1570.206) (-1578.889) [-1567.905] -- 0:01:49
483500 -- (-1568.001) (-1577.568) (-1578.408) [-1568.460] * (-1571.182) (-1573.522) (-1572.135) [-1565.518] -- 0:01:48
484000 -- (-1568.394) [-1573.196] (-1573.939) (-1565.262) * (-1574.092) (-1568.720) [-1568.586] (-1566.763) -- 0:01:48
484500 -- (-1573.525) (-1575.153) (-1574.222) [-1569.658] * (-1573.704) (-1568.847) (-1581.275) [-1571.921] -- 0:01:48
485000 -- [-1565.348] (-1575.078) (-1576.870) (-1579.567) * (-1579.088) [-1569.538] (-1569.026) (-1571.238) -- 0:01:48
Average standard deviation of split frequencies: 0.004527
485500 -- (-1574.823) [-1576.425] (-1573.551) (-1566.759) * (-1573.701) [-1566.026] (-1575.054) (-1571.070) -- 0:01:48
486000 -- (-1573.109) [-1572.999] (-1569.928) (-1575.124) * [-1569.953] (-1573.297) (-1570.001) (-1585.916) -- 0:01:48
486500 -- (-1569.763) (-1569.900) (-1570.997) [-1572.096] * (-1567.480) (-1571.431) (-1571.113) [-1567.312] -- 0:01:48
487000 -- (-1570.751) (-1570.231) (-1576.436) [-1574.528] * (-1568.184) (-1570.906) [-1574.295] (-1568.735) -- 0:01:48
487500 -- (-1573.340) (-1571.048) (-1572.639) [-1571.523] * (-1575.857) [-1571.161] (-1572.594) (-1568.947) -- 0:01:48
488000 -- (-1569.153) (-1567.709) (-1569.665) [-1569.920] * [-1573.744] (-1577.316) (-1579.377) (-1577.388) -- 0:01:48
488500 -- (-1566.852) (-1568.302) [-1570.479] (-1582.371) * [-1567.432] (-1563.249) (-1578.678) (-1577.078) -- 0:01:47
489000 -- (-1577.359) (-1569.387) [-1575.803] (-1567.734) * [-1577.291] (-1572.326) (-1581.090) (-1578.180) -- 0:01:47
489500 -- (-1590.820) (-1573.392) (-1572.832) [-1568.604] * [-1570.114] (-1572.225) (-1571.184) (-1573.776) -- 0:01:47
490000 -- [-1574.884] (-1566.701) (-1574.134) (-1570.206) * (-1572.485) [-1567.199] (-1573.443) (-1574.893) -- 0:01:47
Average standard deviation of split frequencies: 0.004163
490500 -- [-1579.091] (-1579.379) (-1567.850) (-1569.196) * (-1569.752) [-1568.679] (-1570.331) (-1572.567) -- 0:01:46
491000 -- (-1584.118) (-1575.098) (-1569.825) [-1575.289] * (-1570.784) [-1570.822] (-1570.936) (-1573.894) -- 0:01:47
491500 -- (-1573.563) (-1571.650) [-1569.358] (-1582.273) * (-1570.485) [-1566.108] (-1571.566) (-1574.232) -- 0:01:47
492000 -- (-1574.276) (-1582.740) [-1575.534] (-1578.014) * (-1570.357) [-1567.027] (-1572.724) (-1575.464) -- 0:01:47
492500 -- (-1572.877) (-1571.718) (-1568.721) [-1566.725] * (-1573.318) (-1566.427) (-1570.002) [-1571.427] -- 0:01:47
493000 -- (-1577.962) [-1566.806] (-1575.746) (-1575.661) * [-1573.254] (-1570.924) (-1578.966) (-1577.752) -- 0:01:46
493500 -- (-1581.629) [-1568.241] (-1572.978) (-1567.119) * [-1570.271] (-1574.586) (-1571.115) (-1576.425) -- 0:01:46
494000 -- (-1573.974) (-1567.700) [-1573.907] (-1570.238) * (-1574.111) [-1574.723] (-1569.261) (-1568.653) -- 0:01:46
494500 -- (-1571.506) (-1564.373) (-1573.205) [-1570.414] * (-1576.504) (-1572.556) [-1569.922] (-1570.707) -- 0:01:46
495000 -- [-1575.415] (-1569.157) (-1575.459) (-1570.068) * [-1570.741] (-1574.437) (-1571.323) (-1576.135) -- 0:01:46
Average standard deviation of split frequencies: 0.005227
495500 -- (-1576.038) (-1567.513) (-1572.866) [-1574.549] * (-1573.672) (-1577.289) (-1571.511) [-1572.004] -- 0:01:45
496000 -- (-1567.756) (-1570.015) [-1575.278] (-1574.757) * (-1571.296) (-1569.441) [-1564.252] (-1577.226) -- 0:01:46
496500 -- [-1568.168] (-1571.901) (-1573.346) (-1575.027) * [-1572.840] (-1565.137) (-1572.074) (-1572.243) -- 0:01:46
497000 -- [-1571.527] (-1570.761) (-1566.568) (-1570.233) * (-1580.631) [-1577.196] (-1570.192) (-1573.670) -- 0:01:46
497500 -- (-1572.297) (-1574.949) (-1571.477) [-1567.498] * (-1570.893) (-1570.303) [-1571.802] (-1576.925) -- 0:01:46
498000 -- (-1569.741) (-1571.598) (-1571.669) [-1569.875] * (-1577.008) (-1572.479) [-1573.735] (-1577.597) -- 0:01:45
498500 -- [-1577.161] (-1572.766) (-1573.802) (-1575.548) * (-1567.431) (-1569.111) [-1568.594] (-1577.452) -- 0:01:45
499000 -- (-1574.457) [-1570.485] (-1580.974) (-1576.408) * [-1575.030] (-1574.421) (-1575.293) (-1567.832) -- 0:01:45
499500 -- [-1569.161] (-1579.676) (-1571.304) (-1579.620) * (-1572.594) [-1576.998] (-1568.510) (-1574.272) -- 0:01:45
500000 -- (-1577.114) (-1568.592) [-1569.532] (-1580.527) * [-1572.984] (-1576.944) (-1576.702) (-1570.619) -- 0:01:45
Average standard deviation of split frequencies: 0.005963
500500 -- (-1567.694) [-1567.397] (-1569.501) (-1567.037) * (-1576.631) [-1570.888] (-1578.641) (-1569.855) -- 0:01:45
501000 -- (-1569.542) [-1573.135] (-1571.739) (-1573.266) * (-1568.607) (-1575.752) [-1575.808] (-1572.416) -- 0:01:45
501500 -- (-1575.886) [-1572.700] (-1569.179) (-1576.404) * (-1566.497) (-1573.730) (-1572.941) [-1582.352] -- 0:01:45
502000 -- [-1574.981] (-1572.765) (-1569.571) (-1567.054) * (-1573.088) (-1574.015) [-1569.196] (-1581.561) -- 0:01:45
502500 -- (-1565.614) [-1568.118] (-1573.151) (-1572.869) * (-1573.192) (-1576.311) [-1572.167] (-1574.152) -- 0:01:44
503000 -- [-1569.872] (-1565.908) (-1569.639) (-1576.874) * (-1573.230) (-1569.874) (-1569.977) [-1570.713] -- 0:01:44
503500 -- (-1578.776) (-1566.148) (-1572.964) [-1565.718] * (-1579.670) (-1582.034) [-1567.988] (-1570.303) -- 0:01:44
504000 -- (-1569.180) (-1574.207) [-1578.465] (-1574.621) * (-1580.963) [-1571.743] (-1580.403) (-1567.812) -- 0:01:44
504500 -- (-1569.983) [-1568.554] (-1574.484) (-1571.258) * (-1574.054) (-1574.080) (-1575.020) [-1572.762] -- 0:01:44
505000 -- [-1571.287] (-1575.040) (-1571.178) (-1570.812) * (-1578.355) (-1572.960) [-1571.812] (-1578.748) -- 0:01:43
Average standard deviation of split frequencies: 0.005279
505500 -- [-1566.962] (-1569.947) (-1571.427) (-1570.160) * (-1577.176) (-1565.382) (-1573.118) [-1572.358] -- 0:01:44
506000 -- (-1569.464) (-1567.608) (-1567.589) [-1570.787] * (-1572.296) (-1567.447) [-1567.066] (-1570.503) -- 0:01:44
506500 -- (-1566.982) (-1567.328) [-1575.257] (-1568.798) * (-1568.752) [-1575.961] (-1570.003) (-1573.205) -- 0:01:44
507000 -- [-1566.817] (-1581.783) (-1577.367) (-1567.149) * (-1569.751) [-1570.275] (-1577.354) (-1580.157) -- 0:01:44
507500 -- (-1580.532) [-1566.331] (-1571.610) (-1573.910) * (-1573.719) [-1568.061] (-1578.202) (-1571.299) -- 0:01:43
508000 -- [-1569.337] (-1574.866) (-1575.376) (-1574.812) * [-1574.778] (-1565.961) (-1576.274) (-1573.191) -- 0:01:43
508500 -- (-1571.910) [-1570.117] (-1569.315) (-1568.535) * (-1571.650) [-1570.564] (-1578.932) (-1574.160) -- 0:01:43
509000 -- (-1573.003) (-1569.361) (-1571.776) [-1567.297] * (-1576.820) (-1573.723) [-1568.764] (-1565.519) -- 0:01:43
509500 -- (-1595.989) (-1568.740) (-1571.345) [-1570.224] * (-1568.527) (-1572.339) (-1571.725) [-1574.762] -- 0:01:43
510000 -- (-1599.769) (-1576.548) (-1569.783) [-1571.885] * (-1573.004) [-1574.536] (-1577.508) (-1570.251) -- 0:01:42
Average standard deviation of split frequencies: 0.004923
510500 -- (-1581.481) (-1566.940) [-1572.095] (-1573.560) * (-1572.664) (-1575.351) [-1569.927] (-1572.089) -- 0:01:43
511000 -- (-1578.040) (-1577.367) [-1566.467] (-1570.713) * (-1574.181) (-1575.216) (-1581.897) [-1567.406] -- 0:01:43
511500 -- (-1575.419) (-1572.496) [-1574.519] (-1570.790) * (-1570.465) (-1575.604) [-1572.633] (-1571.680) -- 0:01:43
512000 -- [-1571.245] (-1571.044) (-1567.880) (-1568.501) * (-1569.923) (-1571.016) [-1572.453] (-1571.679) -- 0:01:42
512500 -- (-1569.186) (-1575.239) [-1571.578] (-1567.597) * (-1576.341) (-1581.797) [-1571.608] (-1576.035) -- 0:01:42
513000 -- (-1581.032) (-1573.461) (-1565.982) [-1569.459] * (-1573.091) [-1567.415] (-1568.529) (-1580.699) -- 0:01:42
513500 -- (-1584.055) (-1570.712) [-1566.348] (-1577.014) * (-1569.870) [-1568.946] (-1572.311) (-1576.402) -- 0:01:42
514000 -- [-1572.624] (-1572.134) (-1570.567) (-1575.962) * (-1574.619) [-1570.950] (-1568.498) (-1576.160) -- 0:01:42
514500 -- (-1575.598) [-1567.783] (-1573.187) (-1593.447) * [-1568.344] (-1575.515) (-1572.505) (-1570.820) -- 0:01:41
515000 -- (-1571.720) [-1569.367] (-1573.213) (-1571.470) * (-1572.664) (-1571.580) [-1572.760] (-1571.680) -- 0:01:41
Average standard deviation of split frequencies: 0.005481
515500 -- [-1574.298] (-1572.967) (-1575.767) (-1579.023) * (-1577.007) [-1569.816] (-1574.369) (-1578.275) -- 0:01:42
516000 -- [-1575.143] (-1572.744) (-1574.127) (-1575.473) * (-1574.208) (-1567.495) [-1569.897] (-1571.019) -- 0:01:42
516500 -- (-1567.795) (-1577.186) (-1574.562) [-1568.222] * (-1570.074) [-1571.039] (-1574.708) (-1571.803) -- 0:01:42
517000 -- (-1572.945) (-1568.201) (-1582.067) [-1567.075] * (-1566.497) (-1566.949) [-1566.644] (-1573.123) -- 0:01:41
517500 -- (-1572.710) (-1569.181) (-1565.443) [-1576.272] * [-1569.014] (-1567.459) (-1573.238) (-1569.989) -- 0:01:41
518000 -- (-1576.271) (-1567.169) (-1573.899) [-1567.441] * (-1572.217) [-1567.717] (-1578.012) (-1570.550) -- 0:01:41
518500 -- (-1576.609) [-1568.976] (-1574.822) (-1569.152) * (-1574.405) (-1567.375) (-1574.099) [-1568.455] -- 0:01:41
519000 -- (-1571.978) (-1570.822) (-1574.107) [-1570.941] * [-1569.136] (-1567.343) (-1568.930) (-1573.066) -- 0:01:41
519500 -- (-1572.574) [-1574.090] (-1575.164) (-1570.873) * [-1567.433] (-1575.153) (-1575.851) (-1579.668) -- 0:01:40
520000 -- [-1570.217] (-1578.155) (-1577.707) (-1569.789) * (-1564.646) [-1569.906] (-1570.881) (-1572.536) -- 0:01:41
Average standard deviation of split frequencies: 0.004527
520500 -- (-1570.824) [-1569.694] (-1574.977) (-1568.206) * (-1572.424) [-1564.635] (-1571.005) (-1577.638) -- 0:01:41
521000 -- [-1571.360] (-1567.696) (-1579.073) (-1589.652) * (-1573.671) (-1569.012) (-1570.442) [-1573.264] -- 0:01:41
521500 -- (-1573.219) (-1574.461) (-1574.314) [-1574.580] * (-1579.895) [-1572.618] (-1577.368) (-1573.248) -- 0:01:40
522000 -- [-1566.518] (-1576.079) (-1572.213) (-1569.299) * (-1568.181) (-1568.869) (-1569.552) [-1574.058] -- 0:01:40
522500 -- [-1567.853] (-1574.982) (-1569.267) (-1570.218) * (-1565.799) (-1573.733) (-1574.574) [-1574.767] -- 0:01:40
523000 -- (-1568.399) (-1569.272) (-1569.694) [-1571.594] * [-1570.165] (-1571.744) (-1568.766) (-1569.949) -- 0:01:40
523500 -- (-1564.665) (-1575.596) (-1573.599) [-1570.691] * (-1583.166) (-1574.626) [-1573.384] (-1572.045) -- 0:01:40
524000 -- (-1577.142) [-1575.090] (-1574.401) (-1571.176) * (-1571.718) (-1571.988) [-1572.731] (-1569.210) -- 0:01:39
524500 -- [-1567.056] (-1577.977) (-1569.493) (-1569.386) * (-1573.071) (-1576.073) (-1571.240) [-1567.577] -- 0:01:39
525000 -- (-1572.272) (-1572.720) (-1569.597) [-1576.488] * (-1573.621) [-1569.395] (-1582.975) (-1568.735) -- 0:01:40
Average standard deviation of split frequencies: 0.004630
525500 -- (-1566.307) (-1576.558) [-1569.262] (-1572.683) * (-1573.068) [-1571.023] (-1574.286) (-1570.796) -- 0:01:40
526000 -- (-1578.859) (-1571.930) (-1570.923) [-1571.758] * [-1565.862] (-1567.027) (-1577.122) (-1573.423) -- 0:01:40
526500 -- (-1572.400) [-1569.454] (-1578.974) (-1569.986) * (-1572.105) [-1577.708] (-1576.243) (-1579.490) -- 0:01:39
527000 -- (-1567.465) (-1580.151) [-1568.115] (-1573.012) * (-1576.584) (-1575.754) (-1567.758) [-1568.472] -- 0:01:39
527500 -- (-1565.356) (-1573.544) [-1569.017] (-1574.729) * [-1572.582] (-1574.356) (-1572.261) (-1580.984) -- 0:01:39
528000 -- [-1572.379] (-1572.920) (-1573.738) (-1578.779) * (-1575.427) (-1563.268) [-1566.283] (-1571.759) -- 0:01:39
528500 -- (-1566.420) [-1571.490] (-1576.188) (-1578.908) * (-1576.126) [-1568.080] (-1573.607) (-1579.167) -- 0:01:39
529000 -- (-1578.191) (-1573.379) (-1571.596) [-1574.546] * (-1575.019) (-1571.540) (-1574.777) [-1573.561] -- 0:01:38
529500 -- (-1576.047) (-1578.317) (-1577.881) [-1575.377] * (-1578.091) [-1572.756] (-1575.156) (-1576.966) -- 0:01:38
530000 -- (-1568.518) (-1578.757) (-1574.262) [-1567.286] * (-1573.217) (-1576.390) (-1569.783) [-1570.600] -- 0:01:39
Average standard deviation of split frequencies: 0.005182
530500 -- (-1573.249) (-1578.011) (-1573.383) [-1573.619] * (-1579.516) (-1582.358) [-1575.593] (-1567.867) -- 0:01:39
531000 -- (-1581.207) (-1577.243) [-1570.612] (-1575.630) * [-1572.335] (-1570.414) (-1573.976) (-1576.370) -- 0:01:38
531500 -- [-1567.035] (-1578.702) (-1577.458) (-1570.165) * [-1569.733] (-1578.350) (-1572.506) (-1567.069) -- 0:01:38
532000 -- [-1566.870] (-1571.814) (-1572.486) (-1571.252) * (-1565.872) [-1576.543] (-1571.415) (-1573.242) -- 0:01:38
532500 -- (-1565.504) (-1570.071) [-1567.143] (-1569.619) * (-1572.832) (-1575.286) [-1568.999] (-1569.679) -- 0:01:38
533000 -- (-1566.772) [-1575.425] (-1567.527) (-1569.821) * (-1571.106) [-1568.555] (-1573.887) (-1572.655) -- 0:01:38
533500 -- (-1570.567) [-1575.614] (-1569.899) (-1572.553) * (-1569.836) [-1566.808] (-1577.026) (-1580.566) -- 0:01:37
534000 -- (-1569.976) (-1569.433) (-1571.464) [-1571.636] * (-1568.485) [-1569.889] (-1573.089) (-1571.837) -- 0:01:37
534500 -- (-1573.486) (-1575.711) (-1570.351) [-1572.743] * (-1569.174) (-1578.397) (-1573.081) [-1569.284] -- 0:01:37
535000 -- (-1576.850) (-1579.284) (-1577.571) [-1567.953] * (-1568.497) [-1569.912] (-1574.583) (-1572.001) -- 0:01:38
Average standard deviation of split frequencies: 0.006303
535500 -- (-1575.874) (-1570.814) (-1571.095) [-1568.768] * [-1565.499] (-1571.496) (-1577.651) (-1570.388) -- 0:01:38
536000 -- (-1575.518) [-1572.709] (-1573.229) (-1569.391) * (-1572.567) [-1572.411] (-1573.518) (-1577.549) -- 0:01:37
536500 -- (-1581.079) (-1579.267) [-1569.715] (-1578.309) * (-1569.970) [-1568.740] (-1570.779) (-1575.488) -- 0:01:37
537000 -- [-1574.365] (-1578.278) (-1565.272) (-1576.167) * (-1570.000) [-1574.739] (-1565.246) (-1574.064) -- 0:01:37
537500 -- (-1575.156) [-1570.897] (-1570.626) (-1575.588) * (-1569.625) [-1569.057] (-1574.001) (-1577.443) -- 0:01:37
538000 -- (-1570.371) [-1569.710] (-1571.839) (-1570.804) * (-1570.167) [-1573.824] (-1580.635) (-1573.242) -- 0:01:37
538500 -- (-1569.955) (-1570.730) [-1578.227] (-1568.223) * (-1576.267) (-1581.232) (-1579.704) [-1568.259] -- 0:01:36
539000 -- (-1582.142) [-1570.091] (-1579.264) (-1571.962) * (-1585.847) (-1565.216) [-1571.853] (-1565.988) -- 0:01:36
539500 -- (-1575.603) (-1568.797) (-1577.390) [-1575.317] * (-1571.958) (-1574.591) (-1580.130) [-1567.459] -- 0:01:36
540000 -- [-1579.396] (-1576.320) (-1570.900) (-1572.901) * (-1573.754) (-1568.887) [-1569.699] (-1583.907) -- 0:01:37
Average standard deviation of split frequencies: 0.007120
540500 -- [-1573.341] (-1566.843) (-1578.481) (-1575.185) * (-1571.888) (-1569.776) (-1570.499) [-1565.008] -- 0:01:36
541000 -- (-1572.878) (-1579.678) [-1574.497] (-1571.269) * [-1570.123] (-1575.109) (-1566.023) (-1570.576) -- 0:01:36
541500 -- (-1571.945) (-1576.511) (-1574.396) [-1570.635] * [-1570.608] (-1569.772) (-1570.578) (-1568.480) -- 0:01:36
542000 -- (-1574.259) (-1576.739) [-1568.494] (-1567.615) * (-1575.499) (-1574.273) (-1574.621) [-1573.531] -- 0:01:36
542500 -- [-1569.264] (-1576.379) (-1565.088) (-1576.749) * (-1580.994) [-1567.285] (-1584.429) (-1568.811) -- 0:01:36
543000 -- [-1566.516] (-1577.177) (-1569.348) (-1569.536) * (-1574.669) [-1572.469] (-1577.513) (-1568.747) -- 0:01:35
543500 -- (-1570.881) [-1576.465] (-1573.418) (-1572.106) * (-1571.077) (-1571.116) [-1567.469] (-1582.431) -- 0:01:35
544000 -- (-1577.492) (-1566.093) [-1573.395] (-1569.926) * (-1571.649) (-1574.676) (-1573.170) [-1570.571] -- 0:01:35
544500 -- (-1576.303) (-1573.446) (-1570.893) [-1572.503] * [-1568.629] (-1574.331) (-1572.675) (-1574.062) -- 0:01:36
545000 -- (-1571.617) (-1581.468) [-1571.631] (-1568.681) * (-1569.291) [-1568.503] (-1573.245) (-1568.254) -- 0:01:36
Average standard deviation of split frequencies: 0.008346
545500 -- (-1576.748) (-1569.772) [-1570.809] (-1572.961) * [-1568.499] (-1574.339) (-1565.958) (-1577.569) -- 0:01:35
546000 -- (-1567.510) [-1569.589] (-1572.037) (-1585.242) * (-1578.326) (-1575.462) (-1570.373) [-1569.756] -- 0:01:35
546500 -- [-1567.449] (-1571.182) (-1574.949) (-1572.104) * (-1564.081) (-1574.672) (-1582.435) [-1566.897] -- 0:01:35
547000 -- [-1566.186] (-1566.182) (-1569.699) (-1572.334) * (-1571.477) [-1571.719] (-1572.407) (-1572.423) -- 0:01:35
547500 -- (-1567.698) (-1579.489) [-1575.372] (-1567.827) * (-1566.781) (-1565.659) (-1570.111) [-1571.454] -- 0:01:35
548000 -- (-1573.690) (-1579.884) (-1580.621) [-1568.561] * (-1571.176) (-1566.304) [-1573.170] (-1570.702) -- 0:01:34
548500 -- (-1572.388) (-1574.922) (-1578.648) [-1571.614] * [-1569.378] (-1573.153) (-1572.003) (-1573.664) -- 0:01:34
549000 -- [-1572.751] (-1571.262) (-1569.570) (-1579.470) * (-1572.487) (-1574.040) (-1572.230) [-1569.778] -- 0:01:34
549500 -- (-1577.158) (-1569.349) (-1570.650) [-1568.528] * [-1571.230] (-1580.624) (-1571.929) (-1575.634) -- 0:01:35
550000 -- (-1566.752) [-1567.251] (-1575.653) (-1578.746) * (-1573.922) (-1569.519) (-1574.185) [-1569.220] -- 0:01:34
Average standard deviation of split frequencies: 0.008133
550500 -- (-1577.531) (-1575.072) (-1577.111) [-1572.594] * (-1575.967) (-1568.281) [-1569.535] (-1572.472) -- 0:01:34
551000 -- (-1582.972) [-1568.881] (-1574.025) (-1570.480) * [-1565.058] (-1579.425) (-1577.098) (-1574.206) -- 0:01:34
551500 -- (-1573.520) [-1567.025] (-1568.171) (-1580.962) * (-1571.896) [-1570.740] (-1576.137) (-1571.060) -- 0:01:34
552000 -- (-1568.405) (-1576.436) (-1574.519) [-1569.951] * (-1566.974) (-1571.865) (-1574.024) [-1570.182] -- 0:01:34
552500 -- [-1569.793] (-1575.870) (-1585.628) (-1571.375) * (-1575.011) (-1575.644) (-1572.264) [-1570.476] -- 0:01:33
553000 -- (-1570.838) (-1573.992) (-1576.256) [-1571.120] * (-1584.850) (-1565.248) (-1568.673) [-1569.473] -- 0:01:33
553500 -- (-1574.562) [-1567.393] (-1570.906) (-1574.417) * (-1570.163) (-1568.786) (-1572.239) [-1568.995] -- 0:01:33
554000 -- (-1575.102) [-1570.637] (-1576.832) (-1567.289) * (-1570.867) [-1567.588] (-1568.886) (-1571.100) -- 0:01:33
554500 -- [-1571.120] (-1571.633) (-1572.870) (-1576.660) * (-1571.232) [-1570.465] (-1571.119) (-1571.856) -- 0:01:34
555000 -- (-1578.876) [-1566.625] (-1571.717) (-1566.194) * (-1568.199) [-1575.740] (-1579.072) (-1575.574) -- 0:01:33
Average standard deviation of split frequencies: 0.008902
555500 -- [-1569.404] (-1570.413) (-1580.287) (-1570.554) * (-1570.726) (-1582.100) (-1578.206) [-1569.298] -- 0:01:33
556000 -- (-1580.056) [-1565.843] (-1572.278) (-1567.545) * [-1574.325] (-1575.109) (-1575.285) (-1570.292) -- 0:01:33
556500 -- (-1576.143) [-1567.594] (-1573.319) (-1576.182) * (-1566.464) [-1567.859] (-1577.174) (-1573.348) -- 0:01:33
557000 -- [-1570.921] (-1568.313) (-1568.944) (-1571.694) * (-1569.954) (-1568.062) (-1571.783) [-1568.165] -- 0:01:33
557500 -- (-1567.439) [-1567.775] (-1573.899) (-1571.636) * [-1566.773] (-1569.941) (-1573.978) (-1573.297) -- 0:01:32
558000 -- (-1579.866) (-1570.574) (-1567.180) [-1567.081] * (-1573.410) (-1571.298) [-1566.117] (-1567.877) -- 0:01:32
558500 -- (-1570.847) (-1575.542) [-1568.725] (-1567.305) * [-1566.054] (-1574.999) (-1566.849) (-1569.812) -- 0:01:32
559000 -- [-1576.482] (-1565.397) (-1574.667) (-1571.084) * (-1572.681) (-1567.054) [-1565.048] (-1580.292) -- 0:01:33
559500 -- (-1571.532) [-1565.505] (-1571.403) (-1568.530) * (-1567.774) [-1566.720] (-1566.646) (-1573.351) -- 0:01:32
560000 -- [-1570.030] (-1573.319) (-1574.077) (-1574.762) * (-1576.745) (-1576.301) (-1566.010) [-1572.761] -- 0:01:32
Average standard deviation of split frequencies: 0.007847
560500 -- (-1573.109) (-1567.132) (-1573.742) [-1570.384] * (-1571.404) [-1572.253] (-1573.961) (-1573.266) -- 0:01:32
561000 -- (-1572.357) (-1572.219) [-1574.765] (-1574.363) * [-1576.603] (-1578.177) (-1573.095) (-1572.897) -- 0:01:32
561500 -- (-1572.141) (-1574.378) [-1577.056] (-1574.438) * [-1570.651] (-1568.194) (-1567.377) (-1572.333) -- 0:01:32
562000 -- (-1580.117) (-1572.170) [-1573.976] (-1572.455) * [-1571.570] (-1572.300) (-1573.569) (-1576.656) -- 0:01:31
562500 -- (-1575.611) (-1579.825) [-1574.423] (-1574.240) * (-1568.859) (-1569.549) [-1568.897] (-1576.408) -- 0:01:31
563000 -- (-1574.212) (-1573.911) [-1572.404] (-1570.536) * (-1579.576) (-1577.767) [-1568.275] (-1580.317) -- 0:01:31
563500 -- (-1578.254) (-1580.502) (-1570.825) [-1572.550] * (-1575.729) (-1570.180) (-1565.932) [-1568.286] -- 0:01:31
564000 -- (-1572.183) (-1569.614) (-1579.352) [-1570.555] * (-1571.529) (-1571.393) (-1567.067) [-1572.146] -- 0:01:31
564500 -- (-1573.352) (-1582.863) (-1570.451) [-1578.140] * [-1567.586] (-1568.056) (-1567.884) (-1576.262) -- 0:01:31
565000 -- (-1567.603) (-1574.871) (-1574.365) [-1573.044] * (-1574.882) (-1566.961) [-1569.708] (-1572.107) -- 0:01:31
Average standard deviation of split frequencies: 0.007912
565500 -- (-1568.420) [-1570.808] (-1571.874) (-1569.778) * (-1569.308) [-1567.512] (-1576.865) (-1575.014) -- 0:01:31
566000 -- (-1575.862) (-1568.962) (-1581.336) [-1570.515] * [-1570.765] (-1568.436) (-1571.458) (-1571.739) -- 0:01:31
566500 -- (-1571.881) [-1569.304] (-1573.666) (-1572.716) * (-1572.144) (-1570.273) [-1569.329] (-1575.527) -- 0:01:31
567000 -- (-1568.412) [-1566.584] (-1571.152) (-1573.220) * (-1578.546) [-1573.368] (-1570.639) (-1579.949) -- 0:01:30
567500 -- (-1574.086) (-1574.208) (-1568.924) [-1572.501] * [-1572.384] (-1567.762) (-1577.344) (-1570.655) -- 0:01:30
568000 -- (-1572.640) (-1567.262) (-1575.419) [-1576.296] * (-1565.241) (-1583.581) [-1570.254] (-1572.410) -- 0:01:30
568500 -- [-1570.954] (-1568.274) (-1574.837) (-1572.828) * (-1570.560) (-1579.228) [-1570.049] (-1571.750) -- 0:01:30
569000 -- (-1571.136) [-1572.441] (-1567.028) (-1566.260) * (-1572.576) (-1569.890) [-1572.077] (-1572.470) -- 0:01:30
569500 -- (-1571.483) (-1566.949) (-1576.563) [-1569.329] * (-1567.237) (-1565.900) [-1564.966] (-1573.583) -- 0:01:30
570000 -- [-1573.997] (-1568.193) (-1569.630) (-1578.038) * (-1568.187) (-1568.099) [-1573.328] (-1580.718) -- 0:01:30
Average standard deviation of split frequencies: 0.007848
570500 -- [-1569.382] (-1566.202) (-1574.223) (-1575.717) * [-1576.940] (-1569.016) (-1575.441) (-1572.940) -- 0:01:30
571000 -- (-1569.552) (-1568.911) (-1573.813) [-1566.365] * (-1575.058) (-1569.215) [-1571.550] (-1575.019) -- 0:01:30
571500 -- (-1576.009) [-1566.451] (-1574.892) (-1571.092) * (-1574.968) [-1570.747] (-1581.198) (-1569.158) -- 0:01:29
572000 -- (-1570.623) [-1567.871] (-1581.755) (-1574.207) * (-1578.593) (-1573.617) (-1567.883) [-1574.147] -- 0:01:29
572500 -- [-1571.044] (-1564.890) (-1574.677) (-1580.708) * (-1575.119) (-1567.004) [-1569.568] (-1576.868) -- 0:01:29
573000 -- (-1573.804) (-1572.118) [-1569.614] (-1589.887) * (-1574.272) (-1581.805) (-1575.241) [-1569.110] -- 0:01:29
573500 -- (-1570.333) [-1566.744] (-1573.764) (-1566.969) * (-1567.486) (-1576.287) (-1566.634) [-1570.880] -- 0:01:29
574000 -- [-1572.468] (-1564.393) (-1567.488) (-1573.355) * [-1568.825] (-1575.665) (-1570.023) (-1575.278) -- 0:01:29
574500 -- (-1574.914) (-1579.235) [-1573.717] (-1569.107) * (-1572.523) (-1569.978) (-1567.521) [-1574.470] -- 0:01:29
575000 -- [-1568.651] (-1568.574) (-1576.282) (-1570.049) * (-1568.591) [-1565.950] (-1569.191) (-1577.573) -- 0:01:29
Average standard deviation of split frequencies: 0.006274
575500 -- (-1569.081) (-1572.415) [-1573.206] (-1569.545) * (-1574.257) [-1569.726] (-1569.151) (-1570.105) -- 0:01:29
576000 -- (-1576.983) (-1568.607) [-1566.514] (-1568.272) * (-1573.423) [-1567.684] (-1574.572) (-1575.293) -- 0:01:29
576500 -- (-1580.024) (-1568.515) [-1567.431] (-1569.189) * (-1571.201) [-1565.701] (-1568.251) (-1589.974) -- 0:01:28
577000 -- [-1574.627] (-1570.820) (-1569.664) (-1572.519) * (-1569.402) (-1571.672) [-1573.138] (-1578.486) -- 0:01:28
577500 -- (-1570.234) (-1569.553) (-1568.202) [-1571.108] * (-1575.198) (-1568.982) (-1571.609) [-1567.772] -- 0:01:28
578000 -- (-1576.323) [-1568.668] (-1565.907) (-1570.475) * (-1575.487) (-1567.707) [-1574.496] (-1573.085) -- 0:01:28
578500 -- (-1574.114) (-1573.758) (-1574.233) [-1565.007] * (-1576.944) (-1572.413) (-1578.700) [-1574.872] -- 0:01:28
579000 -- (-1569.480) (-1583.355) (-1571.679) [-1566.831] * [-1568.613] (-1572.660) (-1575.679) (-1572.734) -- 0:01:28
579500 -- [-1571.624] (-1568.473) (-1570.445) (-1570.501) * [-1570.446] (-1570.373) (-1581.416) (-1575.971) -- 0:01:28
580000 -- [-1580.017] (-1576.523) (-1578.801) (-1572.916) * (-1570.112) (-1576.054) (-1583.769) [-1570.839] -- 0:01:28
Average standard deviation of split frequencies: 0.006089
580500 -- (-1574.289) (-1575.528) [-1568.461] (-1574.913) * (-1579.152) (-1581.991) [-1572.665] (-1568.481) -- 0:01:28
581000 -- (-1566.037) (-1581.033) [-1568.369] (-1574.278) * [-1572.650] (-1578.014) (-1580.449) (-1569.475) -- 0:01:27
581500 -- (-1568.965) (-1569.672) (-1570.733) [-1571.982] * (-1569.250) [-1575.477] (-1576.591) (-1574.206) -- 0:01:27
582000 -- (-1572.716) (-1567.839) (-1569.753) [-1565.036] * [-1570.311] (-1576.915) (-1563.716) (-1569.483) -- 0:01:27
582500 -- (-1582.399) (-1567.644) [-1570.916] (-1580.329) * (-1568.108) [-1565.556] (-1572.759) (-1577.187) -- 0:01:27
583000 -- (-1574.239) (-1568.865) (-1570.130) [-1569.905] * (-1571.516) (-1570.494) (-1572.915) [-1565.115] -- 0:01:27
583500 -- (-1583.138) [-1574.852] (-1579.046) (-1570.290) * (-1569.026) [-1569.140] (-1581.238) (-1572.185) -- 0:01:27
584000 -- [-1573.698] (-1573.569) (-1571.233) (-1573.733) * (-1572.185) (-1576.361) [-1571.080] (-1565.998) -- 0:01:27
584500 -- (-1582.138) [-1563.669] (-1563.830) (-1573.071) * (-1574.052) (-1570.522) (-1572.988) [-1567.733] -- 0:01:27
585000 -- (-1569.001) [-1568.879] (-1568.352) (-1573.400) * (-1579.083) [-1567.102] (-1576.133) (-1574.613) -- 0:01:27
Average standard deviation of split frequencies: 0.005363
585500 -- [-1576.740] (-1574.131) (-1570.820) (-1576.876) * (-1574.215) [-1571.533] (-1576.309) (-1573.499) -- 0:01:27
586000 -- (-1571.552) (-1565.486) (-1572.135) [-1567.524] * [-1570.246] (-1571.143) (-1576.886) (-1570.041) -- 0:01:26
586500 -- (-1571.745) (-1571.519) [-1566.602] (-1565.537) * (-1569.414) (-1566.150) [-1573.961] (-1567.415) -- 0:01:26
587000 -- (-1570.683) (-1569.133) [-1571.134] (-1576.036) * (-1573.909) [-1571.772] (-1578.462) (-1570.055) -- 0:01:26
587500 -- [-1566.806] (-1576.575) (-1571.219) (-1577.945) * [-1569.998] (-1567.034) (-1569.633) (-1580.003) -- 0:01:26
588000 -- (-1574.880) [-1574.289] (-1574.382) (-1578.065) * [-1569.217] (-1569.196) (-1580.047) (-1579.051) -- 0:01:26
588500 -- (-1585.940) [-1563.967] (-1571.730) (-1571.488) * [-1573.429] (-1577.423) (-1573.648) (-1569.269) -- 0:01:26
589000 -- (-1572.301) (-1569.269) (-1574.427) [-1570.328] * (-1569.582) (-1583.236) (-1574.170) [-1571.649] -- 0:01:26
589500 -- (-1573.611) (-1571.504) (-1573.060) [-1572.322] * (-1568.684) [-1567.025] (-1584.206) (-1575.645) -- 0:01:26
590000 -- (-1575.903) (-1568.712) (-1573.730) [-1571.635] * (-1574.672) (-1568.288) (-1577.516) [-1572.495] -- 0:01:26
Average standard deviation of split frequencies: 0.005055
590500 -- (-1568.174) (-1577.706) [-1570.831] (-1570.938) * (-1570.073) (-1582.876) (-1574.514) [-1573.625] -- 0:01:25
591000 -- [-1571.810] (-1573.711) (-1568.014) (-1573.920) * [-1572.442] (-1589.792) (-1576.197) (-1570.664) -- 0:01:25
591500 -- [-1567.423] (-1571.274) (-1576.101) (-1577.078) * [-1569.470] (-1577.459) (-1577.611) (-1572.174) -- 0:01:25
592000 -- (-1574.387) (-1565.028) (-1567.946) [-1570.541] * (-1570.559) (-1577.084) [-1578.969] (-1571.881) -- 0:01:25
592500 -- (-1578.869) [-1575.011] (-1566.718) (-1575.989) * (-1575.139) (-1573.723) (-1579.972) [-1574.677] -- 0:01:25
593000 -- (-1568.888) (-1573.964) (-1566.925) [-1567.242] * [-1569.947] (-1571.332) (-1572.633) (-1579.995) -- 0:01:25
593500 -- (-1574.229) (-1572.734) (-1569.293) [-1568.749] * (-1573.232) (-1573.859) (-1571.302) [-1571.834] -- 0:01:25
594000 -- (-1574.164) [-1570.281] (-1577.381) (-1568.806) * (-1569.264) (-1565.347) (-1570.548) [-1567.872] -- 0:01:25
594500 -- (-1573.321) (-1573.677) [-1568.174] (-1571.170) * (-1582.475) (-1572.111) (-1568.108) [-1572.887] -- 0:01:25
595000 -- (-1574.566) (-1579.099) [-1571.700] (-1567.754) * (-1573.161) (-1566.851) [-1570.103] (-1572.024) -- 0:01:25
Average standard deviation of split frequencies: 0.004746
595500 -- (-1573.415) (-1570.971) (-1575.303) [-1568.627] * (-1568.974) [-1572.324] (-1565.458) (-1576.039) -- 0:01:24
596000 -- (-1580.868) (-1571.840) [-1568.347] (-1569.930) * (-1570.506) [-1566.657] (-1567.640) (-1576.348) -- 0:01:24
596500 -- (-1566.601) (-1576.071) [-1574.842] (-1584.938) * (-1571.925) [-1570.727] (-1570.020) (-1573.599) -- 0:01:24
597000 -- (-1569.015) [-1576.557] (-1574.573) (-1572.190) * (-1579.757) (-1570.337) (-1574.479) [-1565.814] -- 0:01:24
597500 -- (-1575.897) [-1576.636] (-1575.128) (-1585.030) * (-1570.934) [-1576.680] (-1576.288) (-1570.987) -- 0:01:24
598000 -- (-1572.068) (-1571.156) [-1568.521] (-1569.116) * (-1573.756) [-1566.000] (-1578.439) (-1567.791) -- 0:01:24
598500 -- (-1569.845) [-1584.285] (-1571.425) (-1569.209) * (-1576.998) (-1569.880) [-1574.118] (-1573.871) -- 0:01:24
599000 -- (-1582.972) (-1580.515) [-1570.468] (-1574.014) * (-1568.009) [-1567.841] (-1575.327) (-1572.433) -- 0:01:24
599500 -- [-1571.605] (-1572.136) (-1572.379) (-1567.085) * (-1574.886) [-1575.423] (-1568.510) (-1570.275) -- 0:01:24
600000 -- (-1572.372) [-1574.408] (-1572.997) (-1569.489) * [-1572.812] (-1576.960) (-1573.470) (-1568.848) -- 0:01:24
Average standard deviation of split frequencies: 0.005101
600500 -- (-1579.580) (-1570.472) (-1573.674) [-1567.844] * (-1574.742) (-1565.556) (-1569.846) [-1574.444] -- 0:01:23
601000 -- (-1572.861) (-1576.746) (-1579.586) [-1569.195] * [-1573.700] (-1572.820) (-1566.462) (-1577.488) -- 0:01:23
601500 -- (-1568.512) (-1571.505) (-1580.925) [-1571.270] * (-1572.667) (-1582.980) (-1570.832) [-1569.436] -- 0:01:23
602000 -- (-1572.024) (-1577.036) [-1571.253] (-1573.101) * (-1577.700) (-1579.142) [-1568.851] (-1569.796) -- 0:01:23
602500 -- [-1567.179] (-1569.366) (-1567.553) (-1576.699) * (-1577.173) (-1574.052) [-1567.835] (-1586.164) -- 0:01:23
603000 -- (-1567.936) (-1567.207) (-1574.149) [-1567.097] * (-1573.571) (-1578.225) (-1567.135) [-1577.143] -- 0:01:22
603500 -- (-1569.401) (-1567.894) (-1566.271) [-1569.038] * [-1568.276] (-1572.019) (-1574.326) (-1571.233) -- 0:01:23
604000 -- [-1575.318] (-1577.525) (-1566.486) (-1572.367) * (-1577.655) (-1571.332) (-1571.868) [-1570.181] -- 0:01:23
604500 -- (-1568.971) [-1568.318] (-1580.218) (-1569.091) * (-1570.364) (-1577.730) [-1578.915] (-1575.858) -- 0:01:23
605000 -- [-1565.383] (-1574.666) (-1575.008) (-1573.060) * (-1566.490) [-1572.154] (-1567.079) (-1569.343) -- 0:01:22
Average standard deviation of split frequencies: 0.005316
605500 -- (-1569.447) (-1579.223) [-1563.618] (-1570.804) * [-1570.891] (-1581.926) (-1572.780) (-1570.558) -- 0:01:22
606000 -- [-1572.164] (-1571.690) (-1571.600) (-1579.630) * (-1571.448) (-1571.411) (-1577.056) [-1566.121] -- 0:01:22
606500 -- (-1570.908) (-1571.468) [-1569.202] (-1577.110) * [-1567.511] (-1565.617) (-1569.682) (-1570.272) -- 0:01:22
607000 -- (-1570.797) [-1571.398] (-1575.905) (-1571.801) * (-1572.260) [-1566.982] (-1572.592) (-1576.546) -- 0:01:22
607500 -- (-1575.530) [-1569.747] (-1571.166) (-1575.315) * (-1568.497) [-1570.778] (-1577.306) (-1567.778) -- 0:01:22
608000 -- [-1568.366] (-1570.957) (-1574.802) (-1567.961) * (-1576.922) [-1564.574] (-1577.953) (-1577.967) -- 0:01:22
608500 -- (-1571.357) (-1567.252) (-1571.918) [-1571.398] * (-1576.946) (-1567.508) (-1572.610) [-1571.136] -- 0:01:22
609000 -- (-1573.832) (-1577.634) (-1577.259) [-1571.279] * (-1576.249) (-1576.817) (-1570.258) [-1570.591] -- 0:01:22
609500 -- (-1570.947) (-1572.803) (-1568.429) [-1572.175] * (-1568.701) [-1569.809] (-1569.333) (-1572.150) -- 0:01:22
610000 -- [-1570.271] (-1579.305) (-1569.034) (-1575.122) * (-1568.261) (-1569.336) [-1567.144] (-1573.185) -- 0:01:21
Average standard deviation of split frequencies: 0.004889
610500 -- (-1577.898) (-1573.463) [-1566.842] (-1577.626) * (-1571.495) (-1576.289) (-1568.202) [-1566.186] -- 0:01:21
611000 -- (-1572.026) (-1573.669) [-1571.883] (-1581.166) * (-1569.571) (-1574.546) [-1570.521] (-1571.492) -- 0:01:21
611500 -- (-1570.406) (-1570.218) (-1576.979) [-1570.776] * [-1567.559] (-1570.698) (-1575.286) (-1572.606) -- 0:01:21
612000 -- (-1571.421) [-1570.588] (-1582.378) (-1570.987) * (-1574.366) (-1567.208) (-1571.376) [-1571.062] -- 0:01:21
612500 -- (-1570.638) [-1568.760] (-1570.722) (-1578.083) * (-1578.055) (-1570.902) [-1571.243] (-1568.559) -- 0:01:20
613000 -- [-1569.995] (-1570.469) (-1568.735) (-1574.701) * (-1567.739) [-1565.572] (-1580.199) (-1571.014) -- 0:01:21
613500 -- (-1575.075) (-1576.460) (-1578.664) [-1573.124] * (-1569.295) (-1577.714) [-1569.999] (-1572.915) -- 0:01:21
614000 -- (-1570.401) [-1572.412] (-1569.674) (-1575.949) * (-1571.304) (-1565.664) [-1570.186] (-1579.304) -- 0:01:21
614500 -- [-1570.891] (-1575.372) (-1567.353) (-1570.976) * (-1570.180) [-1567.056] (-1574.514) (-1577.397) -- 0:01:20
615000 -- (-1572.319) (-1572.867) [-1566.650] (-1571.631) * [-1570.029] (-1571.022) (-1578.599) (-1569.661) -- 0:01:20
Average standard deviation of split frequencies: 0.004974
615500 -- (-1578.834) [-1567.808] (-1569.524) (-1571.322) * (-1568.374) [-1573.007] (-1576.822) (-1571.584) -- 0:01:20
616000 -- [-1564.277] (-1572.958) (-1581.317) (-1575.562) * [-1574.423] (-1572.244) (-1574.075) (-1573.501) -- 0:01:20
616500 -- [-1570.949] (-1573.323) (-1585.018) (-1576.703) * [-1571.893] (-1571.483) (-1581.136) (-1575.081) -- 0:01:20
617000 -- (-1572.393) (-1568.919) [-1579.929] (-1570.683) * [-1575.646] (-1577.511) (-1568.746) (-1570.758) -- 0:01:20
617500 -- (-1569.921) (-1571.765) [-1569.175] (-1571.358) * (-1576.868) (-1585.326) [-1574.428] (-1564.908) -- 0:01:19
618000 -- [-1572.324] (-1572.489) (-1570.628) (-1572.174) * (-1574.673) (-1572.458) (-1574.967) [-1571.906] -- 0:01:20
618500 -- [-1571.664] (-1578.773) (-1574.220) (-1570.622) * (-1572.130) (-1571.841) [-1568.470] (-1571.809) -- 0:01:20
619000 -- (-1577.258) (-1566.175) [-1570.391] (-1572.247) * (-1570.386) (-1578.839) (-1575.158) [-1567.666] -- 0:01:20
619500 -- (-1571.147) (-1576.492) [-1572.146] (-1570.676) * [-1569.200] (-1572.209) (-1569.531) (-1569.383) -- 0:01:19
620000 -- (-1574.040) (-1570.082) (-1574.358) [-1574.133] * (-1572.916) [-1563.462] (-1572.748) (-1569.897) -- 0:01:19
Average standard deviation of split frequencies: 0.005443
620500 -- (-1566.509) (-1570.394) [-1575.763] (-1576.211) * (-1578.360) (-1568.890) [-1567.789] (-1567.602) -- 0:01:19
621000 -- [-1569.092] (-1573.304) (-1571.792) (-1568.457) * [-1575.095] (-1567.273) (-1570.667) (-1578.084) -- 0:01:19
621500 -- (-1568.373) (-1572.718) [-1564.373] (-1570.607) * (-1570.362) (-1582.209) [-1572.278] (-1584.104) -- 0:01:19
622000 -- (-1575.108) (-1565.335) (-1574.712) [-1570.124] * (-1565.612) (-1570.413) (-1577.161) [-1573.103] -- 0:01:19
622500 -- (-1572.062) (-1573.286) [-1569.676] (-1574.532) * (-1569.791) (-1569.777) (-1574.389) [-1566.615] -- 0:01:18
623000 -- (-1569.921) (-1579.052) (-1571.453) [-1569.055] * (-1566.925) (-1574.723) [-1569.510] (-1574.471) -- 0:01:19
623500 -- (-1573.498) (-1571.942) (-1570.934) [-1568.792] * [-1565.259] (-1571.510) (-1572.745) (-1572.656) -- 0:01:19
624000 -- [-1568.602] (-1571.463) (-1569.916) (-1570.469) * (-1567.364) [-1573.158] (-1574.149) (-1577.455) -- 0:01:18
624500 -- (-1569.256) [-1570.351] (-1567.587) (-1570.339) * (-1572.577) [-1572.712] (-1582.389) (-1568.978) -- 0:01:18
625000 -- [-1568.310] (-1569.872) (-1571.847) (-1570.423) * (-1576.018) (-1574.705) [-1577.807] (-1573.941) -- 0:01:18
Average standard deviation of split frequencies: 0.005899
625500 -- (-1565.843) (-1568.932) (-1572.049) [-1570.278] * [-1567.882] (-1570.548) (-1576.455) (-1585.768) -- 0:01:18
626000 -- (-1575.919) (-1570.675) (-1575.864) [-1570.976] * (-1572.921) (-1567.351) [-1566.194] (-1574.226) -- 0:01:18
626500 -- (-1572.388) (-1576.233) (-1577.157) [-1568.927] * (-1568.002) (-1573.124) (-1576.349) [-1575.527] -- 0:01:18
627000 -- (-1570.457) [-1570.729] (-1571.808) (-1570.000) * (-1566.972) [-1575.323] (-1577.170) (-1577.697) -- 0:01:17
627500 -- (-1569.054) [-1570.384] (-1570.143) (-1572.013) * (-1571.873) (-1579.509) [-1575.497] (-1573.462) -- 0:01:17
628000 -- (-1578.419) (-1573.608) [-1572.284] (-1575.375) * (-1580.015) (-1569.051) [-1568.900] (-1576.856) -- 0:01:18
628500 -- [-1578.438] (-1577.958) (-1570.038) (-1579.387) * (-1581.982) [-1573.618] (-1570.053) (-1574.580) -- 0:01:18
629000 -- (-1574.346) (-1572.375) [-1575.393] (-1586.649) * (-1570.819) [-1570.430] (-1571.305) (-1566.485) -- 0:01:17
629500 -- (-1574.398) [-1568.453] (-1580.167) (-1578.293) * [-1567.864] (-1573.128) (-1572.318) (-1574.341) -- 0:01:17
630000 -- (-1571.750) (-1564.713) [-1573.674] (-1575.014) * (-1574.457) [-1569.892] (-1570.264) (-1568.926) -- 0:01:17
Average standard deviation of split frequencies: 0.007226
630500 -- (-1575.634) [-1567.770] (-1579.496) (-1565.404) * (-1571.022) (-1570.051) (-1567.432) [-1573.199] -- 0:01:17
631000 -- (-1580.095) (-1574.806) (-1571.729) [-1568.347] * (-1568.273) (-1576.741) (-1573.982) [-1568.291] -- 0:01:17
631500 -- (-1574.150) (-1574.134) (-1569.979) [-1568.256] * (-1568.393) [-1569.981] (-1568.782) (-1566.983) -- 0:01:17
632000 -- (-1571.915) [-1574.433] (-1568.710) (-1569.643) * (-1566.193) [-1572.986] (-1575.226) (-1574.667) -- 0:01:16
632500 -- (-1572.686) (-1579.604) [-1571.340] (-1575.051) * [-1577.179] (-1575.436) (-1569.755) (-1571.241) -- 0:01:16
633000 -- (-1577.636) (-1575.062) [-1567.617] (-1570.209) * (-1566.144) [-1567.100] (-1570.024) (-1571.673) -- 0:01:17
633500 -- (-1579.904) [-1567.041] (-1580.422) (-1571.158) * (-1571.623) [-1570.469] (-1571.939) (-1576.249) -- 0:01:16
634000 -- (-1569.533) (-1566.251) [-1568.729] (-1573.249) * (-1577.272) (-1580.620) [-1566.613] (-1571.113) -- 0:01:16
634500 -- (-1577.015) (-1574.959) [-1567.566] (-1567.938) * (-1567.246) [-1571.430] (-1573.392) (-1563.650) -- 0:01:16
635000 -- (-1574.223) (-1572.368) [-1573.135] (-1571.303) * [-1570.663] (-1571.403) (-1571.435) (-1577.142) -- 0:01:16
Average standard deviation of split frequencies: 0.007536
635500 -- [-1577.210] (-1573.914) (-1567.804) (-1575.086) * (-1568.504) (-1569.721) [-1565.377] (-1575.405) -- 0:01:16
636000 -- (-1579.887) (-1577.680) [-1567.928] (-1579.143) * (-1566.763) (-1566.753) (-1574.590) [-1568.437] -- 0:01:16
636500 -- (-1573.204) (-1580.725) [-1569.300] (-1568.214) * (-1575.520) (-1575.305) (-1572.162) [-1569.627] -- 0:01:15
637000 -- (-1575.948) (-1575.487) [-1569.272] (-1568.604) * (-1564.319) (-1577.174) (-1572.828) [-1573.788] -- 0:01:15
637500 -- [-1568.933] (-1569.721) (-1572.651) (-1571.139) * (-1567.567) [-1571.888] (-1590.128) (-1571.214) -- 0:01:16
638000 -- (-1578.031) (-1567.009) [-1573.520] (-1576.241) * [-1570.328] (-1578.612) (-1575.502) (-1581.514) -- 0:01:16
638500 -- [-1574.378] (-1568.064) (-1581.633) (-1576.748) * [-1568.573] (-1578.684) (-1576.437) (-1570.702) -- 0:01:15
639000 -- (-1578.356) (-1577.045) (-1572.045) [-1566.187] * [-1574.050] (-1571.033) (-1574.354) (-1570.715) -- 0:01:15
639500 -- [-1575.089] (-1578.261) (-1569.966) (-1569.658) * (-1571.165) [-1566.112] (-1576.785) (-1572.306) -- 0:01:15
640000 -- [-1575.651] (-1577.769) (-1572.058) (-1580.996) * [-1568.823] (-1575.268) (-1578.242) (-1571.639) -- 0:01:15
Average standard deviation of split frequencies: 0.007971
640500 -- (-1575.480) [-1567.517] (-1583.692) (-1573.585) * (-1571.062) [-1572.810] (-1583.532) (-1574.629) -- 0:01:15
641000 -- (-1572.227) (-1570.405) [-1564.504] (-1581.631) * (-1573.102) (-1572.695) (-1571.154) [-1573.848] -- 0:01:15
641500 -- [-1572.479] (-1567.347) (-1572.198) (-1585.476) * (-1572.356) [-1575.177] (-1566.081) (-1574.913) -- 0:01:14
642000 -- [-1570.485] (-1571.671) (-1570.364) (-1576.023) * [-1571.159] (-1570.995) (-1563.893) (-1567.766) -- 0:01:14
642500 -- [-1569.590] (-1573.215) (-1568.703) (-1575.149) * (-1568.053) (-1574.563) [-1567.289] (-1576.895) -- 0:01:15
643000 -- [-1570.549] (-1574.769) (-1571.764) (-1574.680) * (-1578.891) [-1570.221] (-1569.710) (-1566.894) -- 0:01:14
643500 -- [-1572.756] (-1570.498) (-1572.892) (-1571.655) * (-1568.835) [-1564.108] (-1567.147) (-1567.717) -- 0:01:14
644000 -- (-1564.227) (-1575.185) [-1571.971] (-1571.614) * [-1572.148] (-1566.228) (-1571.619) (-1578.183) -- 0:01:14
644500 -- (-1568.545) (-1573.520) [-1568.504] (-1570.572) * (-1571.636) [-1564.526] (-1580.438) (-1577.309) -- 0:01:14
645000 -- (-1567.978) (-1568.058) (-1569.660) [-1574.203] * (-1571.412) (-1568.158) [-1572.552] (-1573.306) -- 0:01:14
Average standard deviation of split frequencies: 0.007905
645500 -- (-1568.284) [-1564.944] (-1571.585) (-1579.390) * (-1568.894) [-1568.981] (-1565.468) (-1574.977) -- 0:01:14
646000 -- [-1567.674] (-1576.776) (-1566.212) (-1580.336) * (-1567.552) [-1568.175] (-1568.639) (-1573.178) -- 0:01:13
646500 -- (-1573.026) (-1572.921) [-1571.731] (-1587.053) * [-1572.060] (-1569.953) (-1577.967) (-1584.858) -- 0:01:13
647000 -- (-1565.327) (-1566.466) [-1569.403] (-1581.511) * (-1567.679) [-1568.411] (-1569.182) (-1583.536) -- 0:01:13
647500 -- (-1572.555) (-1568.324) [-1571.072] (-1583.452) * (-1573.002) [-1568.321] (-1567.613) (-1578.724) -- 0:01:14
648000 -- (-1576.498) [-1571.981] (-1571.893) (-1573.798) * [-1568.938] (-1566.247) (-1567.219) (-1575.570) -- 0:01:13
648500 -- [-1576.758] (-1571.178) (-1568.893) (-1575.621) * (-1576.171) (-1568.401) [-1566.204] (-1570.963) -- 0:01:13
649000 -- (-1570.397) (-1572.167) [-1570.164] (-1571.526) * (-1567.014) (-1571.410) [-1566.387] (-1570.770) -- 0:01:13
649500 -- (-1565.758) (-1571.271) (-1575.657) [-1570.742] * [-1569.757] (-1572.474) (-1567.207) (-1571.550) -- 0:01:13
650000 -- (-1567.102) (-1569.018) (-1581.687) [-1566.002] * (-1570.115) (-1570.800) [-1572.031] (-1570.328) -- 0:01:13
Average standard deviation of split frequencies: 0.007728
650500 -- [-1564.956] (-1578.084) (-1567.755) (-1569.776) * (-1571.059) (-1570.911) [-1570.461] (-1571.436) -- 0:01:13
651000 -- (-1577.952) [-1575.033] (-1571.475) (-1579.146) * (-1570.795) [-1579.663] (-1579.738) (-1568.749) -- 0:01:12
651500 -- [-1569.284] (-1567.714) (-1577.082) (-1578.519) * (-1574.021) (-1579.148) [-1569.540] (-1575.479) -- 0:01:12
652000 -- (-1575.073) [-1569.404] (-1576.332) (-1576.375) * (-1575.595) (-1573.420) [-1573.686] (-1576.281) -- 0:01:12
652500 -- (-1570.777) (-1576.893) (-1571.788) [-1573.250] * (-1574.211) [-1564.237] (-1571.914) (-1573.102) -- 0:01:12
653000 -- (-1568.765) (-1580.592) [-1573.100] (-1574.213) * (-1577.317) (-1566.534) (-1571.749) [-1579.465] -- 0:01:12
653500 -- [-1570.069] (-1573.622) (-1574.037) (-1575.958) * (-1569.297) (-1577.911) (-1576.444) [-1573.484] -- 0:01:12
654000 -- [-1566.915] (-1567.111) (-1570.106) (-1573.380) * [-1568.847] (-1574.868) (-1574.244) (-1572.926) -- 0:01:12
654500 -- (-1572.146) [-1572.980] (-1575.137) (-1572.164) * (-1577.085) (-1567.280) [-1569.077] (-1571.780) -- 0:01:12
655000 -- [-1570.183] (-1572.694) (-1573.570) (-1573.377) * (-1574.453) (-1571.411) (-1576.510) [-1576.597] -- 0:01:12
Average standard deviation of split frequencies: 0.007066
655500 -- [-1569.901] (-1573.596) (-1580.917) (-1569.233) * (-1576.329) [-1573.909] (-1564.906) (-1574.908) -- 0:01:12
656000 -- (-1563.855) (-1567.327) [-1568.279] (-1574.809) * [-1574.061] (-1580.198) (-1572.492) (-1571.301) -- 0:01:11
656500 -- [-1567.272] (-1577.683) (-1569.066) (-1575.347) * (-1578.950) (-1572.900) [-1567.363] (-1572.246) -- 0:01:12
657000 -- [-1568.757] (-1571.436) (-1572.966) (-1574.916) * (-1572.161) (-1580.551) (-1568.657) [-1571.090] -- 0:01:12
657500 -- (-1569.063) (-1573.998) [-1562.459] (-1569.125) * (-1576.311) (-1583.328) [-1565.533] (-1572.918) -- 0:01:11
658000 -- [-1567.498] (-1576.107) (-1569.198) (-1576.544) * (-1571.757) [-1572.595] (-1570.605) (-1572.796) -- 0:01:11
658500 -- (-1576.693) [-1574.293] (-1573.512) (-1569.405) * (-1571.484) (-1571.212) (-1567.326) [-1569.403] -- 0:01:11
659000 -- (-1570.435) (-1582.056) (-1575.171) [-1563.359] * (-1579.816) (-1572.251) [-1569.296] (-1571.318) -- 0:01:11
659500 -- (-1580.866) (-1571.152) (-1573.460) [-1575.949] * (-1569.733) (-1573.981) [-1567.023] (-1571.927) -- 0:01:11
660000 -- (-1581.413) [-1571.108] (-1568.632) (-1563.766) * (-1575.015) (-1577.905) (-1573.593) [-1571.931] -- 0:01:11
Average standard deviation of split frequencies: 0.007492
660500 -- (-1573.143) (-1582.992) (-1568.247) [-1565.819] * (-1574.073) [-1571.351] (-1572.709) (-1572.380) -- 0:01:10
661000 -- (-1570.722) (-1572.650) (-1567.995) [-1570.865] * (-1575.347) (-1569.501) (-1574.448) [-1572.277] -- 0:01:11
661500 -- [-1574.945] (-1570.828) (-1576.651) (-1575.247) * (-1571.450) (-1575.920) [-1572.194] (-1571.388) -- 0:01:11
662000 -- (-1568.414) (-1578.087) [-1570.584] (-1574.316) * (-1573.147) [-1570.297] (-1574.731) (-1567.169) -- 0:01:10
662500 -- (-1577.171) (-1566.905) (-1568.104) [-1577.330] * [-1576.956] (-1573.730) (-1576.640) (-1568.699) -- 0:01:10
663000 -- (-1570.853) [-1572.075] (-1577.701) (-1576.179) * (-1576.082) (-1568.345) (-1576.689) [-1566.914] -- 0:01:10
663500 -- (-1576.495) (-1572.591) (-1572.365) [-1575.324] * (-1574.237) (-1568.257) [-1568.762] (-1569.901) -- 0:01:10
664000 -- (-1568.840) (-1571.376) (-1571.807) [-1575.102] * (-1577.237) [-1575.074] (-1575.259) (-1578.402) -- 0:01:10
664500 -- [-1565.994] (-1570.570) (-1572.521) (-1572.477) * (-1576.667) (-1570.658) (-1572.405) [-1566.250] -- 0:01:10
665000 -- (-1567.426) (-1564.908) [-1569.993] (-1571.296) * (-1574.712) (-1567.474) (-1585.495) [-1566.034] -- 0:01:10
Average standard deviation of split frequencies: 0.006488
665500 -- (-1577.763) (-1570.438) [-1572.490] (-1572.310) * (-1569.158) (-1569.796) [-1567.367] (-1567.704) -- 0:01:10
666000 -- (-1574.952) (-1576.582) (-1573.420) [-1565.428] * (-1569.379) [-1568.581] (-1571.030) (-1570.733) -- 0:01:10
666500 -- [-1578.728] (-1571.283) (-1573.873) (-1571.094) * [-1573.545] (-1578.450) (-1572.418) (-1569.209) -- 0:01:10
667000 -- (-1567.882) (-1572.424) (-1574.725) [-1565.225] * (-1567.090) (-1565.606) (-1575.419) [-1568.553] -- 0:01:09
667500 -- (-1572.144) (-1567.406) [-1569.408] (-1576.829) * (-1570.807) (-1574.810) [-1567.050] (-1570.143) -- 0:01:09
668000 -- [-1575.790] (-1579.367) (-1581.334) (-1567.775) * [-1570.009] (-1565.909) (-1578.324) (-1572.254) -- 0:01:09
668500 -- (-1574.551) [-1573.800] (-1565.273) (-1579.594) * (-1570.654) [-1565.938] (-1578.793) (-1569.285) -- 0:01:09
669000 -- [-1566.240] (-1569.665) (-1571.817) (-1579.128) * [-1567.025] (-1575.622) (-1575.349) (-1571.366) -- 0:01:09
669500 -- [-1573.064] (-1570.776) (-1578.708) (-1586.708) * (-1567.256) [-1572.017] (-1572.630) (-1569.190) -- 0:01:09
670000 -- [-1569.681] (-1572.895) (-1572.097) (-1574.273) * (-1570.848) (-1576.632) (-1573.325) [-1565.671] -- 0:01:08
Average standard deviation of split frequencies: 0.007615
670500 -- [-1573.795] (-1577.845) (-1578.157) (-1573.090) * (-1572.148) (-1566.608) (-1569.316) [-1569.538] -- 0:01:09
671000 -- (-1575.516) [-1579.755] (-1571.250) (-1568.436) * (-1564.757) (-1575.041) (-1567.875) [-1575.563] -- 0:01:09
671500 -- (-1570.641) (-1577.107) (-1572.133) [-1566.655] * [-1567.098] (-1576.245) (-1572.427) (-1568.375) -- 0:01:08
672000 -- (-1570.934) (-1575.905) [-1567.791] (-1572.000) * (-1570.130) [-1576.826] (-1572.470) (-1566.349) -- 0:01:08
672500 -- (-1573.443) [-1570.445] (-1576.686) (-1574.811) * [-1569.859] (-1571.201) (-1568.698) (-1569.822) -- 0:01:08
673000 -- (-1575.110) [-1569.110] (-1569.656) (-1569.928) * [-1574.896] (-1569.866) (-1566.856) (-1571.686) -- 0:01:08
673500 -- (-1567.258) [-1571.047] (-1574.830) (-1580.045) * (-1572.413) [-1573.571] (-1571.553) (-1570.012) -- 0:01:08
674000 -- [-1567.936] (-1573.301) (-1577.514) (-1575.653) * (-1575.932) (-1572.831) [-1565.455] (-1571.261) -- 0:01:08
674500 -- (-1568.645) [-1570.986] (-1576.243) (-1569.789) * [-1568.328] (-1581.474) (-1571.507) (-1573.855) -- 0:01:08
675000 -- (-1570.356) (-1570.228) [-1566.039] (-1573.837) * (-1571.817) (-1571.356) [-1569.189] (-1567.663) -- 0:01:07
Average standard deviation of split frequencies: 0.007438
675500 -- [-1570.869] (-1569.665) (-1567.686) (-1568.720) * [-1570.492] (-1577.644) (-1572.868) (-1566.104) -- 0:01:08
676000 -- (-1573.293) (-1576.426) [-1568.226] (-1570.722) * (-1574.327) (-1570.341) (-1571.858) [-1570.194] -- 0:01:08
676500 -- (-1574.114) [-1574.649] (-1577.026) (-1569.078) * (-1576.274) (-1579.213) [-1569.342] (-1570.089) -- 0:01:07
677000 -- [-1570.811] (-1567.894) (-1567.910) (-1571.534) * [-1570.474] (-1573.100) (-1571.415) (-1571.375) -- 0:01:07
677500 -- (-1577.687) (-1578.163) [-1570.428] (-1586.730) * (-1574.425) (-1570.435) (-1580.096) [-1571.577] -- 0:01:07
678000 -- [-1564.911] (-1568.818) (-1565.491) (-1580.055) * (-1570.273) (-1569.170) [-1576.106] (-1576.153) -- 0:01:07
678500 -- (-1574.400) [-1567.709] (-1569.468) (-1574.284) * (-1565.352) (-1575.452) [-1567.556] (-1571.446) -- 0:01:07
679000 -- [-1570.639] (-1569.811) (-1567.437) (-1585.127) * (-1572.370) (-1572.863) [-1566.640] (-1573.496) -- 0:01:07
679500 -- (-1572.764) [-1566.384] (-1568.795) (-1575.891) * [-1568.774] (-1575.810) (-1572.592) (-1573.406) -- 0:01:06
680000 -- (-1574.170) (-1572.917) (-1571.571) [-1567.591] * (-1578.987) (-1578.132) (-1573.998) [-1575.373] -- 0:01:06
Average standard deviation of split frequencies: 0.007387
680500 -- (-1572.351) (-1570.232) [-1579.980] (-1576.290) * (-1569.982) (-1583.191) [-1577.666] (-1571.145) -- 0:01:07
681000 -- (-1572.665) (-1570.021) [-1570.625] (-1577.593) * (-1571.579) (-1578.536) (-1582.576) [-1567.162] -- 0:01:06
681500 -- (-1580.866) [-1572.580] (-1568.619) (-1574.281) * (-1572.141) [-1571.297] (-1583.077) (-1574.450) -- 0:01:06
682000 -- (-1570.495) [-1569.625] (-1563.296) (-1577.437) * (-1574.734) [-1574.650] (-1574.496) (-1567.774) -- 0:01:06
682500 -- (-1579.817) (-1574.778) (-1572.489) [-1570.780] * (-1569.393) [-1573.267] (-1574.629) (-1573.486) -- 0:01:06
683000 -- (-1570.669) [-1571.138] (-1574.458) (-1568.788) * (-1569.219) [-1573.490] (-1575.981) (-1574.448) -- 0:01:06
683500 -- [-1575.478] (-1575.865) (-1573.625) (-1573.275) * [-1567.978] (-1580.623) (-1567.639) (-1570.981) -- 0:01:06
684000 -- (-1576.889) (-1566.243) (-1577.997) [-1570.048] * [-1569.381] (-1577.514) (-1575.088) (-1582.530) -- 0:01:06
684500 -- (-1574.859) [-1565.517] (-1572.504) (-1569.374) * (-1576.079) (-1578.369) [-1572.534] (-1566.849) -- 0:01:05
685000 -- (-1575.814) (-1570.444) [-1571.538] (-1571.366) * (-1582.596) (-1574.654) (-1573.995) [-1567.757] -- 0:01:06
Average standard deviation of split frequencies: 0.007903
685500 -- (-1565.069) (-1568.576) [-1574.558] (-1572.631) * [-1573.430] (-1575.199) (-1576.923) (-1577.202) -- 0:01:06
686000 -- (-1573.322) (-1566.900) (-1571.213) [-1570.001] * (-1570.516) (-1572.164) (-1579.189) [-1572.963] -- 0:01:05
686500 -- (-1576.462) (-1567.277) (-1576.246) [-1571.047] * (-1566.324) (-1567.384) [-1569.444] (-1574.852) -- 0:01:05
687000 -- (-1578.653) (-1566.598) [-1574.004] (-1570.244) * (-1573.063) (-1578.451) [-1566.413] (-1573.612) -- 0:01:05
687500 -- [-1572.969] (-1578.745) (-1575.988) (-1573.202) * (-1575.813) (-1578.798) [-1566.284] (-1569.250) -- 0:01:05
688000 -- (-1569.058) [-1567.805] (-1566.515) (-1572.952) * (-1568.325) (-1574.382) [-1574.346] (-1572.955) -- 0:01:05
688500 -- (-1566.101) [-1568.956] (-1571.716) (-1565.528) * (-1573.064) [-1568.351] (-1572.376) (-1570.438) -- 0:01:05
689000 -- (-1569.905) [-1570.185] (-1574.616) (-1570.212) * (-1576.688) [-1573.287] (-1578.387) (-1574.651) -- 0:01:04
689500 -- (-1581.045) (-1577.055) (-1580.117) [-1569.011] * (-1581.838) (-1571.334) (-1575.298) [-1574.365] -- 0:01:04
690000 -- [-1573.278] (-1569.411) (-1579.963) (-1576.241) * [-1578.542] (-1570.144) (-1573.572) (-1571.840) -- 0:01:05
Average standard deviation of split frequencies: 0.008532
690500 -- (-1585.686) (-1573.306) [-1574.546] (-1572.528) * (-1577.031) [-1569.434] (-1576.619) (-1575.113) -- 0:01:04
691000 -- (-1576.427) [-1569.484] (-1571.595) (-1573.805) * (-1573.489) [-1565.551] (-1574.716) (-1574.015) -- 0:01:04
691500 -- (-1571.374) [-1566.239] (-1571.357) (-1569.873) * (-1571.498) (-1573.474) (-1587.042) [-1573.324] -- 0:01:04
692000 -- (-1567.859) [-1566.258] (-1567.944) (-1572.042) * (-1571.504) [-1569.460] (-1569.192) (-1569.919) -- 0:01:04
692500 -- (-1577.660) [-1568.982] (-1567.472) (-1569.356) * (-1573.813) (-1567.027) (-1573.025) [-1575.233] -- 0:01:04
693000 -- (-1567.615) (-1574.511) [-1570.720] (-1570.038) * (-1577.062) [-1566.739] (-1569.659) (-1569.911) -- 0:01:04
693500 -- (-1573.592) (-1569.369) (-1571.775) [-1570.422] * (-1577.220) (-1565.545) (-1571.698) [-1573.401] -- 0:01:04
694000 -- (-1573.554) (-1573.482) (-1569.769) [-1565.291] * [-1566.873] (-1564.473) (-1573.647) (-1571.462) -- 0:01:03
694500 -- (-1572.293) (-1580.418) (-1572.142) [-1570.710] * (-1571.773) [-1570.851] (-1589.150) (-1570.768) -- 0:01:03
695000 -- (-1572.107) (-1573.043) (-1575.239) [-1567.482] * [-1566.871] (-1578.233) (-1582.460) (-1573.920) -- 0:01:04
Average standard deviation of split frequencies: 0.007676
695500 -- [-1571.122] (-1575.068) (-1573.380) (-1568.761) * (-1581.334) (-1574.557) [-1575.551] (-1570.851) -- 0:01:03
696000 -- (-1569.447) (-1577.661) [-1565.059] (-1568.201) * (-1571.741) (-1576.142) [-1568.955] (-1565.646) -- 0:01:03
696500 -- (-1567.827) (-1575.634) (-1577.172) [-1570.971] * (-1577.323) (-1566.737) (-1565.807) [-1566.994] -- 0:01:03
697000 -- [-1569.573] (-1581.741) (-1572.735) (-1573.390) * (-1573.965) (-1564.636) [-1570.635] (-1567.477) -- 0:01:03
697500 -- (-1573.849) (-1577.921) [-1568.585] (-1576.651) * [-1579.457] (-1580.428) (-1573.767) (-1568.976) -- 0:01:03
698000 -- (-1583.683) (-1567.071) (-1572.985) [-1570.908] * (-1579.515) (-1569.111) (-1568.083) [-1569.247] -- 0:01:03
698500 -- (-1568.906) (-1569.134) [-1566.484] (-1572.424) * (-1571.146) [-1567.714] (-1567.294) (-1575.896) -- 0:01:03
699000 -- [-1577.097] (-1571.051) (-1571.857) (-1570.886) * (-1571.624) [-1576.777] (-1578.113) (-1570.089) -- 0:01:02
699500 -- (-1572.428) (-1569.974) [-1567.606] (-1567.730) * (-1569.309) [-1580.358] (-1573.669) (-1572.099) -- 0:01:02
700000 -- (-1577.063) (-1572.213) [-1572.604] (-1573.645) * (-1571.656) [-1572.931] (-1568.709) (-1569.247) -- 0:01:03
Average standard deviation of split frequencies: 0.007064
700500 -- (-1577.069) (-1571.761) (-1568.863) [-1565.839] * (-1571.534) [-1566.693] (-1572.134) (-1572.173) -- 0:01:02
701000 -- (-1577.654) (-1571.170) [-1573.969] (-1575.370) * (-1572.787) [-1575.612] (-1570.941) (-1575.100) -- 0:01:02
701500 -- (-1572.484) (-1572.573) [-1576.222] (-1573.305) * (-1576.024) (-1571.122) [-1570.310] (-1568.439) -- 0:01:02
702000 -- (-1574.430) (-1572.008) (-1568.934) [-1572.396] * (-1573.355) (-1573.073) (-1575.320) [-1571.453] -- 0:01:02
702500 -- (-1569.493) (-1578.145) [-1569.852] (-1570.307) * (-1581.081) (-1566.097) (-1573.401) [-1572.062] -- 0:01:02
703000 -- (-1575.983) (-1572.193) (-1573.467) [-1568.257] * [-1572.118] (-1577.558) (-1570.229) (-1570.211) -- 0:01:02
703500 -- (-1573.766) [-1569.507] (-1569.428) (-1570.664) * (-1567.468) [-1566.739] (-1573.717) (-1574.791) -- 0:01:01
704000 -- [-1577.457] (-1573.665) (-1569.011) (-1575.080) * (-1571.944) [-1571.688] (-1568.701) (-1568.039) -- 0:01:01
704500 -- (-1571.420) (-1568.899) (-1568.964) [-1566.246] * (-1568.860) [-1571.123] (-1568.768) (-1573.200) -- 0:01:01
705000 -- [-1573.070] (-1568.379) (-1571.675) (-1570.067) * (-1573.544) (-1575.829) [-1565.163] (-1573.033) -- 0:01:01
Average standard deviation of split frequencies: 0.007456
705500 -- [-1576.354] (-1568.429) (-1569.745) (-1568.495) * (-1575.683) (-1581.192) [-1570.044] (-1569.268) -- 0:01:01
706000 -- (-1573.834) (-1570.906) [-1575.929] (-1571.117) * (-1568.981) [-1568.582] (-1573.244) (-1568.404) -- 0:01:01
706500 -- (-1567.964) (-1574.185) (-1573.543) [-1572.304] * (-1569.509) (-1567.382) [-1576.440] (-1568.068) -- 0:01:01
707000 -- [-1566.024] (-1567.904) (-1574.486) (-1569.203) * (-1574.016) (-1568.724) [-1570.308] (-1569.725) -- 0:01:01
707500 -- (-1569.294) (-1567.763) [-1572.327] (-1570.423) * [-1573.842] (-1572.775) (-1571.118) (-1573.292) -- 0:01:01
708000 -- (-1568.203) [-1566.152] (-1574.391) (-1567.057) * (-1568.879) (-1569.430) [-1573.003] (-1567.143) -- 0:01:01
708500 -- [-1567.034] (-1569.719) (-1574.721) (-1575.150) * [-1569.808] (-1571.656) (-1578.854) (-1576.300) -- 0:01:00
709000 -- (-1577.272) [-1567.748] (-1569.338) (-1571.268) * (-1568.793) (-1576.689) [-1570.467] (-1578.003) -- 0:01:00
709500 -- [-1568.227] (-1569.590) (-1567.058) (-1576.101) * (-1572.958) (-1576.143) [-1569.704] (-1570.918) -- 0:01:01
710000 -- (-1572.339) (-1569.506) [-1566.316] (-1571.802) * [-1566.828] (-1575.227) (-1573.993) (-1571.275) -- 0:01:00
Average standard deviation of split frequencies: 0.006080
710500 -- (-1579.089) [-1570.695] (-1575.635) (-1572.058) * [-1565.522] (-1565.796) (-1582.009) (-1568.405) -- 0:01:00
711000 -- (-1568.353) [-1568.023] (-1572.345) (-1570.600) * [-1571.384] (-1570.773) (-1570.879) (-1576.209) -- 0:01:00
711500 -- [-1569.671] (-1571.074) (-1576.624) (-1572.865) * (-1566.933) [-1570.002] (-1573.485) (-1573.910) -- 0:01:00
712000 -- (-1578.656) [-1569.962] (-1576.784) (-1578.536) * (-1568.550) (-1569.933) (-1572.799) [-1569.235] -- 0:01:00
712500 -- (-1570.680) [-1572.220] (-1572.545) (-1570.215) * (-1567.355) [-1572.289] (-1574.538) (-1570.413) -- 0:01:00
713000 -- [-1567.873] (-1570.939) (-1568.417) (-1569.497) * [-1568.527] (-1576.592) (-1566.609) (-1576.619) -- 0:00:59
713500 -- (-1567.905) (-1582.232) (-1579.902) [-1570.340] * [-1568.995] (-1575.407) (-1569.763) (-1576.496) -- 0:00:59
714000 -- (-1574.529) (-1576.459) (-1572.793) [-1569.625] * (-1568.173) (-1579.342) (-1578.648) [-1575.936] -- 0:00:59
714500 -- (-1571.004) (-1578.197) (-1577.650) [-1573.409] * [-1565.596] (-1577.125) (-1568.678) (-1579.019) -- 0:00:59
715000 -- [-1575.834] (-1570.859) (-1564.826) (-1571.612) * [-1570.477] (-1570.515) (-1567.269) (-1587.258) -- 0:00:59
Average standard deviation of split frequencies: 0.005487
715500 -- (-1572.009) (-1571.522) [-1568.917] (-1571.271) * [-1570.102] (-1571.485) (-1568.222) (-1580.988) -- 0:00:59
716000 -- (-1577.487) [-1576.229] (-1572.543) (-1573.612) * (-1572.606) (-1567.303) (-1569.808) [-1579.976] -- 0:00:59
716500 -- (-1576.545) (-1569.458) [-1573.879] (-1574.660) * (-1574.517) [-1568.010] (-1573.148) (-1573.580) -- 0:00:59
717000 -- [-1564.668] (-1570.801) (-1568.755) (-1576.784) * [-1566.789] (-1567.309) (-1569.136) (-1574.803) -- 0:00:59
717500 -- [-1568.931] (-1568.445) (-1568.622) (-1572.082) * (-1576.329) (-1572.395) [-1567.238] (-1578.313) -- 0:00:59
718000 -- (-1572.626) (-1574.022) (-1572.853) [-1567.564] * (-1567.929) [-1573.708] (-1569.616) (-1571.744) -- 0:00:58
718500 -- [-1573.938] (-1575.779) (-1576.938) (-1568.312) * (-1570.988) (-1578.747) (-1573.821) [-1571.642] -- 0:00:58
719000 -- (-1572.647) [-1570.707] (-1565.993) (-1573.284) * (-1571.964) [-1570.517] (-1565.175) (-1582.395) -- 0:00:58
719500 -- (-1568.757) (-1573.572) (-1570.787) [-1572.412] * (-1573.773) [-1568.089] (-1575.391) (-1577.253) -- 0:00:58
720000 -- (-1570.672) (-1573.655) [-1564.233] (-1573.011) * (-1580.838) (-1573.967) [-1578.013] (-1575.272) -- 0:00:58
Average standard deviation of split frequencies: 0.005560
720500 -- (-1568.568) (-1576.161) [-1566.609] (-1572.648) * (-1571.451) [-1570.184] (-1572.129) (-1569.023) -- 0:00:58
721000 -- (-1570.536) (-1575.429) [-1570.712] (-1574.363) * (-1570.471) [-1569.944] (-1574.176) (-1570.806) -- 0:00:58
721500 -- (-1566.675) [-1564.144] (-1579.436) (-1580.544) * (-1574.804) [-1577.263] (-1571.559) (-1578.385) -- 0:00:58
722000 -- (-1569.825) [-1565.773] (-1573.586) (-1573.949) * [-1568.858] (-1570.367) (-1569.744) (-1575.706) -- 0:00:58
722500 -- [-1569.206] (-1573.521) (-1575.492) (-1571.248) * (-1576.823) [-1568.067] (-1568.957) (-1573.327) -- 0:00:57
723000 -- [-1577.908] (-1572.441) (-1573.766) (-1577.843) * (-1578.951) [-1566.515] (-1574.078) (-1570.901) -- 0:00:57
723500 -- (-1569.292) [-1574.390] (-1571.037) (-1568.639) * [-1571.351] (-1567.979) (-1576.396) (-1568.189) -- 0:00:57
724000 -- [-1569.970] (-1573.458) (-1568.451) (-1571.782) * (-1573.553) [-1570.448] (-1583.714) (-1565.409) -- 0:00:57
724500 -- (-1565.554) [-1571.593] (-1568.987) (-1568.865) * (-1568.852) (-1575.650) (-1573.013) [-1571.420] -- 0:00:57
725000 -- (-1570.196) [-1568.165] (-1571.376) (-1570.696) * (-1574.121) (-1575.142) (-1574.317) [-1569.702] -- 0:00:57
Average standard deviation of split frequencies: 0.006601
725500 -- (-1574.117) [-1565.652] (-1567.095) (-1572.152) * (-1572.675) [-1570.026] (-1576.136) (-1568.713) -- 0:00:57
726000 -- (-1570.677) (-1570.637) [-1565.367] (-1578.776) * (-1570.128) (-1568.933) (-1572.844) [-1574.282] -- 0:00:57
726500 -- (-1573.741) (-1573.511) [-1568.985] (-1573.222) * (-1574.509) (-1572.577) (-1574.492) [-1573.726] -- 0:00:57
727000 -- (-1575.515) (-1569.435) (-1570.276) [-1567.554] * (-1572.270) (-1576.958) (-1569.533) [-1569.478] -- 0:00:57
727500 -- (-1581.341) (-1579.131) [-1569.683] (-1570.503) * (-1585.888) (-1574.814) [-1565.860] (-1583.667) -- 0:00:56
728000 -- [-1575.284] (-1580.500) (-1573.416) (-1571.029) * (-1572.628) (-1569.396) (-1572.996) [-1568.398] -- 0:00:56
728500 -- [-1568.871] (-1577.729) (-1573.990) (-1575.609) * (-1571.172) [-1567.906] (-1574.857) (-1568.837) -- 0:00:56
729000 -- (-1566.813) [-1568.642] (-1572.003) (-1572.978) * (-1577.780) (-1566.311) [-1566.793] (-1578.019) -- 0:00:56
729500 -- (-1568.138) (-1568.634) [-1575.273] (-1569.275) * (-1570.517) [-1566.093] (-1570.106) (-1575.988) -- 0:00:56
730000 -- (-1566.013) (-1571.660) [-1570.294] (-1570.213) * (-1573.126) [-1565.250] (-1578.082) (-1580.329) -- 0:00:56
Average standard deviation of split frequencies: 0.006989
730500 -- (-1573.116) (-1569.810) [-1569.895] (-1569.738) * (-1569.466) [-1568.361] (-1576.221) (-1582.091) -- 0:00:56
731000 -- (-1565.870) (-1570.423) (-1566.184) [-1568.078] * (-1570.275) (-1566.178) [-1566.592] (-1575.390) -- 0:00:56
731500 -- (-1576.117) [-1570.272] (-1568.031) (-1568.126) * (-1574.077) [-1573.055] (-1568.598) (-1575.380) -- 0:00:56
732000 -- (-1570.419) (-1581.191) [-1568.388] (-1575.997) * (-1572.050) [-1575.293] (-1570.890) (-1568.751) -- 0:00:56
732500 -- (-1572.567) (-1572.548) (-1573.175) [-1564.046] * [-1575.182] (-1574.636) (-1576.859) (-1570.803) -- 0:00:55
733000 -- (-1569.573) [-1573.053] (-1569.104) (-1583.683) * (-1569.523) (-1574.681) [-1563.063] (-1568.477) -- 0:00:55
733500 -- (-1574.599) (-1568.359) [-1571.413] (-1575.159) * [-1564.118] (-1568.186) (-1571.902) (-1573.701) -- 0:00:55
734000 -- (-1565.849) [-1568.589] (-1569.118) (-1574.222) * (-1574.726) [-1568.148] (-1569.249) (-1568.939) -- 0:00:55
734500 -- [-1563.903] (-1565.621) (-1572.775) (-1569.287) * (-1564.937) (-1567.259) [-1568.152] (-1573.314) -- 0:00:55
735000 -- [-1568.092] (-1569.906) (-1569.729) (-1571.210) * (-1568.819) (-1570.148) [-1565.799] (-1569.602) -- 0:00:55
Average standard deviation of split frequencies: 0.007152
735500 -- (-1572.574) (-1570.298) (-1573.484) [-1575.293] * [-1566.490] (-1572.571) (-1572.636) (-1579.214) -- 0:00:55
736000 -- (-1581.023) (-1568.611) (-1582.314) [-1567.082] * (-1569.234) (-1570.691) [-1566.143] (-1575.991) -- 0:00:55
736500 -- (-1578.385) (-1563.998) (-1580.871) [-1571.979] * [-1567.847] (-1574.251) (-1573.379) (-1568.662) -- 0:00:55
737000 -- (-1568.031) (-1566.899) (-1575.347) [-1566.430] * (-1571.005) (-1577.081) (-1577.455) [-1566.635] -- 0:00:54
737500 -- (-1574.203) (-1571.724) (-1576.728) [-1567.725] * [-1571.718] (-1586.198) (-1576.217) (-1570.656) -- 0:00:54
738000 -- (-1579.110) [-1576.302] (-1576.785) (-1570.789) * (-1580.038) (-1575.119) [-1566.549] (-1571.036) -- 0:00:54
738500 -- [-1570.009] (-1573.789) (-1581.696) (-1565.460) * (-1574.231) (-1578.482) (-1576.362) [-1565.644] -- 0:00:54
739000 -- [-1569.045] (-1576.677) (-1579.255) (-1568.541) * [-1566.598] (-1570.044) (-1574.597) (-1570.077) -- 0:00:54
739500 -- (-1572.079) (-1576.776) [-1576.829] (-1571.955) * (-1567.822) (-1571.599) [-1571.903] (-1570.224) -- 0:00:54
740000 -- (-1567.770) (-1570.711) [-1569.035] (-1568.072) * [-1572.996] (-1564.792) (-1570.688) (-1578.158) -- 0:00:54
Average standard deviation of split frequencies: 0.008274
740500 -- (-1568.432) [-1568.453] (-1571.979) (-1572.864) * [-1574.563] (-1578.018) (-1570.683) (-1568.197) -- 0:00:54
741000 -- (-1576.039) [-1569.046] (-1575.444) (-1578.437) * (-1580.255) [-1568.091] (-1588.568) (-1576.062) -- 0:00:54
741500 -- (-1569.389) (-1575.476) (-1572.703) [-1564.968] * (-1572.368) (-1564.868) (-1583.835) [-1569.436] -- 0:00:54
742000 -- (-1570.341) [-1565.322] (-1575.186) (-1574.572) * (-1571.130) [-1566.881] (-1577.458) (-1572.782) -- 0:00:53
742500 -- (-1583.558) (-1567.840) (-1580.961) [-1575.654] * (-1570.112) (-1566.805) (-1576.249) [-1573.015] -- 0:00:53
743000 -- (-1574.414) [-1572.004] (-1572.207) (-1576.125) * (-1566.717) (-1570.834) (-1573.925) [-1572.538] -- 0:00:53
743500 -- (-1571.255) (-1569.694) [-1576.218] (-1575.230) * (-1566.843) (-1574.996) (-1570.380) [-1569.468] -- 0:00:53
744000 -- (-1576.674) [-1569.861] (-1571.746) (-1575.558) * (-1572.957) (-1570.513) (-1568.659) [-1568.725] -- 0:00:53
744500 -- (-1567.478) [-1573.219] (-1572.598) (-1579.399) * (-1577.193) (-1568.946) (-1564.533) [-1579.583] -- 0:00:53
745000 -- (-1570.141) [-1577.068] (-1571.105) (-1572.599) * [-1564.005] (-1570.134) (-1567.498) (-1574.827) -- 0:00:53
Average standard deviation of split frequencies: 0.007372
745500 -- (-1576.288) (-1575.503) [-1571.391] (-1572.170) * (-1569.849) [-1566.615] (-1573.052) (-1579.985) -- 0:00:53
746000 -- (-1574.845) [-1570.392] (-1580.900) (-1581.461) * (-1568.904) (-1568.253) [-1573.087] (-1571.052) -- 0:00:53
746500 -- [-1572.780] (-1576.136) (-1570.760) (-1582.165) * (-1575.868) [-1570.497] (-1572.205) (-1581.143) -- 0:00:52
747000 -- [-1569.749] (-1573.594) (-1569.251) (-1575.376) * (-1571.836) (-1572.449) [-1566.062] (-1575.545) -- 0:00:52
747500 -- (-1575.820) (-1575.114) (-1570.559) [-1574.323] * (-1572.062) [-1574.174] (-1569.102) (-1573.456) -- 0:00:52
748000 -- (-1577.564) (-1588.664) (-1568.147) [-1573.871] * (-1573.107) (-1569.091) [-1565.914] (-1579.869) -- 0:00:52
748500 -- [-1574.101] (-1569.413) (-1566.840) (-1572.732) * [-1568.817] (-1572.322) (-1573.607) (-1580.625) -- 0:00:52
749000 -- (-1575.883) [-1565.455] (-1569.206) (-1573.564) * (-1568.880) [-1575.642] (-1575.201) (-1574.281) -- 0:00:52
749500 -- (-1573.691) (-1574.252) [-1568.646] (-1576.467) * (-1568.189) (-1572.496) (-1571.534) [-1574.070] -- 0:00:52
750000 -- (-1584.456) (-1573.746) (-1572.762) [-1571.350] * (-1573.233) (-1570.416) (-1573.189) [-1569.578] -- 0:00:52
Average standard deviation of split frequencies: 0.007117
750500 -- (-1572.673) [-1570.024] (-1568.731) (-1574.591) * (-1577.948) [-1564.578] (-1570.828) (-1571.617) -- 0:00:52
751000 -- (-1569.792) (-1574.463) [-1572.561] (-1568.217) * (-1574.936) (-1574.015) (-1575.470) [-1571.690] -- 0:00:52
751500 -- (-1565.721) (-1571.192) (-1566.311) [-1571.457] * (-1573.305) (-1579.622) (-1571.825) [-1575.005] -- 0:00:51
752000 -- (-1571.841) [-1569.205] (-1572.835) (-1573.706) * (-1570.123) (-1572.685) (-1572.606) [-1575.641] -- 0:00:51
752500 -- (-1567.518) (-1581.098) [-1568.847] (-1570.606) * (-1580.300) (-1571.177) (-1576.830) [-1578.463] -- 0:00:51
753000 -- [-1572.458] (-1578.524) (-1570.486) (-1571.271) * (-1570.910) (-1567.885) [-1567.562] (-1573.362) -- 0:00:51
753500 -- (-1571.088) [-1574.050] (-1580.072) (-1564.215) * (-1574.005) (-1569.914) (-1574.810) [-1571.359] -- 0:00:51
754000 -- (-1571.916) [-1569.576] (-1567.095) (-1573.119) * (-1570.885) (-1571.488) (-1569.097) [-1571.888] -- 0:00:51
754500 -- (-1574.939) (-1574.621) [-1568.961] (-1576.865) * (-1573.942) (-1571.598) (-1567.837) [-1569.848] -- 0:00:51
755000 -- [-1570.752] (-1578.582) (-1577.214) (-1570.890) * (-1572.412) [-1572.486] (-1572.543) (-1567.644) -- 0:00:51
Average standard deviation of split frequencies: 0.006028
755500 -- (-1572.815) [-1570.505] (-1569.082) (-1576.388) * (-1575.610) [-1567.953] (-1566.139) (-1569.383) -- 0:00:51
756000 -- (-1575.201) (-1570.936) [-1569.596] (-1577.033) * (-1571.818) [-1573.982] (-1569.490) (-1568.891) -- 0:00:50
756500 -- [-1566.330] (-1572.361) (-1576.046) (-1573.644) * (-1576.622) (-1574.271) [-1572.221] (-1569.795) -- 0:00:50
757000 -- (-1573.584) (-1575.273) (-1572.137) [-1574.370] * (-1568.517) (-1570.993) (-1575.409) [-1568.426] -- 0:00:50
757500 -- (-1574.305) (-1574.524) (-1570.083) [-1568.276] * (-1575.397) (-1575.959) (-1568.995) [-1566.709] -- 0:00:50
758000 -- [-1571.648] (-1572.108) (-1574.519) (-1570.757) * (-1576.250) (-1564.517) [-1570.598] (-1568.547) -- 0:00:50
758500 -- (-1578.465) (-1567.334) (-1578.018) [-1569.488] * (-1579.848) (-1576.810) (-1571.021) [-1569.755] -- 0:00:50
759000 -- [-1570.746] (-1575.346) (-1577.310) (-1572.238) * (-1565.611) (-1569.263) (-1568.569) [-1576.690] -- 0:00:50
759500 -- (-1566.196) (-1570.537) [-1572.643] (-1573.356) * [-1569.170] (-1571.780) (-1568.079) (-1570.186) -- 0:00:50
760000 -- (-1574.441) [-1568.875] (-1567.165) (-1577.273) * (-1573.806) (-1573.879) [-1570.897] (-1571.972) -- 0:00:50
Average standard deviation of split frequencies: 0.005991
760500 -- [-1564.541] (-1570.915) (-1578.451) (-1569.903) * (-1579.339) (-1570.681) [-1573.112] (-1577.916) -- 0:00:50
761000 -- (-1570.983) (-1580.656) [-1576.064] (-1572.762) * (-1573.892) (-1571.854) (-1570.519) [-1570.368] -- 0:00:49
761500 -- (-1581.083) (-1576.229) [-1572.574] (-1574.112) * (-1578.944) (-1574.938) (-1572.991) [-1567.351] -- 0:00:49
762000 -- [-1575.919] (-1578.286) (-1571.430) (-1574.141) * (-1575.814) [-1568.961] (-1573.514) (-1578.296) -- 0:00:49
762500 -- (-1568.900) [-1571.991] (-1569.378) (-1569.531) * (-1572.567) (-1571.884) [-1570.965] (-1568.769) -- 0:00:49
763000 -- (-1570.968) [-1575.073] (-1568.368) (-1572.860) * (-1577.298) (-1579.059) (-1570.687) [-1562.857] -- 0:00:49
763500 -- (-1566.823) [-1574.039] (-1568.433) (-1568.734) * (-1574.658) (-1580.416) [-1565.524] (-1571.199) -- 0:00:49
764000 -- (-1573.377) (-1568.682) [-1565.919] (-1568.602) * (-1572.537) [-1573.772] (-1575.678) (-1576.339) -- 0:00:49
764500 -- [-1577.349] (-1573.839) (-1569.824) (-1575.915) * (-1570.590) [-1568.293] (-1576.477) (-1568.908) -- 0:00:49
765000 -- (-1574.306) (-1569.842) [-1571.013] (-1572.068) * (-1575.117) (-1564.974) [-1576.332] (-1567.438) -- 0:00:49
Average standard deviation of split frequencies: 0.005436
765500 -- (-1565.100) (-1575.325) (-1572.525) [-1572.715] * (-1574.871) [-1574.635] (-1570.181) (-1576.067) -- 0:00:49
766000 -- [-1571.455] (-1571.830) (-1570.173) (-1579.607) * (-1570.199) (-1582.541) [-1581.274] (-1571.314) -- 0:00:48
766500 -- (-1567.441) (-1576.547) (-1569.538) [-1566.706] * (-1575.964) (-1573.784) (-1575.565) [-1571.043] -- 0:00:48
767000 -- (-1570.734) [-1574.355] (-1572.362) (-1575.047) * (-1567.088) (-1579.848) (-1570.075) [-1567.147] -- 0:00:48
767500 -- (-1572.179) [-1568.908] (-1567.622) (-1567.778) * [-1570.788] (-1567.881) (-1570.338) (-1574.651) -- 0:00:48
768000 -- (-1572.774) (-1566.167) (-1566.702) [-1564.449] * (-1573.660) (-1565.840) [-1570.598] (-1569.794) -- 0:00:48
768500 -- [-1568.227] (-1567.100) (-1575.228) (-1570.322) * [-1570.638] (-1574.199) (-1569.326) (-1573.541) -- 0:00:48
769000 -- (-1573.956) (-1570.160) (-1574.534) [-1575.593] * [-1570.587] (-1570.197) (-1577.492) (-1572.242) -- 0:00:48
769500 -- (-1569.043) (-1571.515) (-1564.327) [-1578.258] * (-1572.931) (-1575.411) (-1574.423) [-1573.552] -- 0:00:48
770000 -- [-1567.396] (-1566.893) (-1571.181) (-1572.911) * [-1569.232] (-1574.740) (-1574.483) (-1568.586) -- 0:00:48
Average standard deviation of split frequencies: 0.005607
770500 -- [-1576.124] (-1573.376) (-1570.719) (-1568.344) * (-1572.735) [-1569.647] (-1572.162) (-1571.443) -- 0:00:47
771000 -- (-1573.073) (-1572.092) [-1565.637] (-1570.865) * (-1566.241) [-1569.379] (-1572.429) (-1573.374) -- 0:00:47
771500 -- (-1579.606) (-1580.996) [-1566.872] (-1571.503) * (-1568.907) (-1573.685) (-1578.656) [-1569.047] -- 0:00:47
772000 -- (-1572.811) (-1579.364) [-1567.589] (-1577.536) * [-1566.681] (-1575.319) (-1566.500) (-1570.877) -- 0:00:47
772500 -- (-1573.951) [-1575.731] (-1568.856) (-1581.001) * [-1570.962] (-1577.390) (-1570.391) (-1573.569) -- 0:00:47
773000 -- (-1572.665) [-1576.908] (-1568.038) (-1572.604) * (-1570.230) [-1575.389] (-1576.448) (-1571.169) -- 0:00:47
773500 -- (-1573.752) [-1575.823] (-1582.517) (-1568.616) * (-1575.366) (-1566.837) (-1575.123) [-1568.486] -- 0:00:47
774000 -- (-1572.105) (-1577.211) (-1571.633) [-1572.081] * (-1578.803) (-1568.914) (-1568.802) [-1574.377] -- 0:00:47
774500 -- [-1573.173] (-1580.304) (-1575.922) (-1569.968) * [-1573.283] (-1572.227) (-1570.252) (-1575.601) -- 0:00:47
775000 -- [-1574.726] (-1564.088) (-1570.014) (-1571.765) * [-1578.054] (-1568.192) (-1569.948) (-1576.373) -- 0:00:47
Average standard deviation of split frequencies: 0.005670
775500 -- (-1572.836) (-1571.768) (-1568.558) [-1572.923] * (-1581.427) (-1575.458) (-1568.441) [-1570.906] -- 0:00:46
776000 -- (-1574.534) (-1571.958) (-1577.762) [-1569.332] * (-1577.483) [-1572.277] (-1572.448) (-1572.947) -- 0:00:46
776500 -- (-1576.226) [-1570.312] (-1575.229) (-1570.207) * [-1567.443] (-1577.849) (-1577.787) (-1575.688) -- 0:00:46
777000 -- (-1574.119) (-1567.074) [-1572.522] (-1579.580) * (-1579.412) (-1570.783) (-1572.555) [-1574.052] -- 0:00:46
777500 -- (-1570.197) (-1576.778) [-1562.741] (-1568.686) * (-1569.426) (-1569.025) (-1567.640) [-1567.842] -- 0:00:46
778000 -- (-1573.310) (-1571.958) [-1565.586] (-1567.259) * (-1571.460) [-1576.441] (-1573.519) (-1576.471) -- 0:00:46
778500 -- (-1569.198) (-1575.663) [-1569.910] (-1569.788) * (-1573.765) (-1576.117) [-1570.213] (-1573.423) -- 0:00:46
779000 -- (-1566.326) (-1575.608) [-1569.142] (-1567.948) * (-1575.220) (-1576.480) (-1571.343) [-1571.418] -- 0:00:46
779500 -- [-1564.743] (-1569.581) (-1573.082) (-1570.561) * (-1570.343) [-1572.467] (-1576.724) (-1568.966) -- 0:00:46
780000 -- (-1566.401) (-1569.330) [-1569.063] (-1568.758) * (-1579.063) (-1572.378) [-1566.286] (-1569.154) -- 0:00:45
Average standard deviation of split frequencies: 0.004630
780500 -- (-1569.485) (-1578.613) [-1574.975] (-1563.331) * (-1569.772) [-1574.991] (-1576.278) (-1567.175) -- 0:00:45
781000 -- (-1573.876) [-1573.625] (-1566.007) (-1572.501) * (-1571.990) [-1571.027] (-1571.870) (-1570.790) -- 0:00:45
781500 -- (-1567.971) [-1570.097] (-1566.004) (-1578.583) * (-1581.216) (-1581.240) [-1566.079] (-1577.068) -- 0:00:45
782000 -- (-1572.810) [-1571.891] (-1568.712) (-1577.336) * (-1579.243) (-1571.838) [-1566.011] (-1572.845) -- 0:00:45
782500 -- (-1571.376) [-1572.029] (-1578.626) (-1577.212) * [-1570.300] (-1575.053) (-1569.345) (-1572.884) -- 0:00:45
783000 -- (-1565.681) [-1575.822] (-1579.311) (-1567.065) * [-1569.868] (-1577.094) (-1568.640) (-1580.137) -- 0:00:45
783500 -- (-1573.895) (-1571.232) (-1575.109) [-1570.717] * (-1571.164) [-1570.749] (-1569.046) (-1574.409) -- 0:00:45
784000 -- (-1568.765) (-1577.271) (-1574.750) [-1569.884] * (-1569.273) (-1570.902) [-1564.915] (-1576.977) -- 0:00:45
784500 -- (-1574.120) [-1565.471] (-1584.842) (-1567.918) * (-1577.582) [-1569.181] (-1572.294) (-1569.353) -- 0:00:45
785000 -- (-1576.670) (-1570.270) (-1566.356) [-1569.184] * (-1571.640) (-1570.904) (-1572.286) [-1569.896] -- 0:00:44
Average standard deviation of split frequencies: 0.004598
785500 -- (-1568.700) (-1568.226) (-1571.212) [-1568.301] * [-1568.674] (-1570.417) (-1572.857) (-1579.007) -- 0:00:44
786000 -- (-1570.622) (-1568.837) (-1570.434) [-1571.680] * (-1573.297) (-1570.210) (-1570.366) [-1575.132] -- 0:00:44
786500 -- (-1569.387) (-1575.874) (-1572.340) [-1572.195] * (-1576.606) [-1572.079] (-1569.292) (-1572.729) -- 0:00:44
787000 -- (-1573.793) (-1578.844) [-1574.520] (-1567.662) * [-1573.006] (-1574.730) (-1576.348) (-1580.002) -- 0:00:44
787500 -- (-1569.532) [-1570.885] (-1570.090) (-1571.681) * (-1576.108) [-1567.192] (-1574.866) (-1570.202) -- 0:00:44
788000 -- (-1568.158) (-1568.655) [-1570.100] (-1583.128) * (-1573.283) (-1566.104) (-1567.543) [-1566.010] -- 0:00:44
788500 -- (-1573.386) (-1566.945) [-1567.301] (-1568.547) * (-1575.603) (-1580.189) [-1572.398] (-1574.559) -- 0:00:44
789000 -- (-1570.682) [-1571.618] (-1575.502) (-1565.615) * (-1584.456) (-1568.684) (-1572.502) [-1570.748] -- 0:00:44
789500 -- (-1572.175) (-1579.980) (-1570.824) [-1572.858] * (-1575.142) (-1574.243) [-1575.121] (-1567.498) -- 0:00:43
790000 -- (-1571.821) (-1589.605) (-1574.680) [-1572.084] * (-1571.394) (-1576.459) (-1572.644) [-1576.539] -- 0:00:43
Average standard deviation of split frequencies: 0.004770
790500 -- [-1570.385] (-1585.062) (-1569.934) (-1576.891) * [-1574.549] (-1576.641) (-1573.266) (-1575.493) -- 0:00:43
791000 -- (-1578.296) [-1575.626] (-1567.065) (-1572.912) * (-1576.198) [-1577.395] (-1571.722) (-1576.549) -- 0:00:43
791500 -- (-1566.919) [-1574.341] (-1574.488) (-1572.304) * (-1573.185) (-1570.322) [-1571.743] (-1569.277) -- 0:00:43
792000 -- (-1568.195) [-1569.751] (-1578.425) (-1572.305) * [-1573.208] (-1574.203) (-1571.180) (-1569.483) -- 0:00:43
792500 -- (-1575.274) (-1574.844) [-1576.962] (-1576.754) * [-1571.118] (-1574.034) (-1572.824) (-1569.653) -- 0:00:43
793000 -- (-1571.960) (-1566.359) [-1570.603] (-1577.494) * (-1578.040) (-1575.778) [-1567.013] (-1565.331) -- 0:00:43
793500 -- [-1565.731] (-1565.159) (-1567.193) (-1581.698) * (-1572.670) (-1577.726) [-1570.448] (-1570.235) -- 0:00:43
794000 -- (-1574.220) [-1573.411] (-1568.997) (-1576.693) * (-1587.209) (-1578.427) (-1565.559) [-1572.055] -- 0:00:43
794500 -- (-1570.175) [-1564.967] (-1563.910) (-1577.636) * (-1570.820) [-1574.317] (-1566.196) (-1567.179) -- 0:00:42
795000 -- (-1571.395) (-1566.788) (-1571.549) [-1579.435] * (-1575.273) (-1575.454) (-1567.825) [-1574.598] -- 0:00:42
Average standard deviation of split frequencies: 0.004639
795500 -- [-1572.419] (-1575.207) (-1587.944) (-1583.315) * (-1570.133) (-1569.859) (-1583.480) [-1569.739] -- 0:00:42
796000 -- [-1571.196] (-1573.943) (-1570.308) (-1573.624) * [-1569.734] (-1573.765) (-1571.854) (-1571.766) -- 0:00:42
796500 -- (-1573.923) (-1573.578) [-1567.858] (-1573.666) * (-1575.697) [-1564.873] (-1580.950) (-1573.058) -- 0:00:42
797000 -- [-1571.525] (-1573.958) (-1571.616) (-1570.560) * (-1563.847) (-1572.696) [-1568.154] (-1580.493) -- 0:00:42
797500 -- (-1576.774) (-1567.022) (-1571.266) [-1562.959] * (-1574.229) [-1575.586] (-1569.678) (-1577.821) -- 0:00:42
798000 -- (-1566.216) (-1569.956) (-1578.074) [-1569.263] * [-1571.388] (-1576.834) (-1566.415) (-1569.158) -- 0:00:42
798500 -- [-1571.326] (-1569.420) (-1572.035) (-1562.824) * (-1570.510) (-1568.592) (-1575.676) [-1572.550] -- 0:00:42
799000 -- (-1572.118) (-1565.338) [-1568.543] (-1569.305) * [-1575.275] (-1569.633) (-1570.899) (-1576.839) -- 0:00:42
799500 -- (-1572.245) (-1568.083) (-1570.816) [-1564.026] * (-1572.671) (-1577.717) [-1566.064] (-1570.619) -- 0:00:41
800000 -- (-1585.991) (-1570.915) (-1568.624) [-1569.782] * (-1570.173) (-1572.924) (-1579.468) [-1564.521] -- 0:00:41
Average standard deviation of split frequencies: 0.004416
800500 -- (-1573.519) (-1575.237) [-1571.639] (-1573.669) * (-1569.336) [-1570.235] (-1569.745) (-1573.570) -- 0:00:41
801000 -- (-1577.745) [-1570.688] (-1580.387) (-1574.926) * (-1583.292) (-1573.489) [-1576.459] (-1570.589) -- 0:00:41
801500 -- (-1579.858) (-1569.865) (-1576.351) [-1571.842] * (-1575.380) (-1572.118) (-1570.943) [-1579.087] -- 0:00:41
802000 -- (-1569.988) [-1571.376] (-1570.611) (-1572.061) * (-1567.861) (-1574.895) (-1583.839) [-1570.221] -- 0:00:41
802500 -- (-1575.196) (-1567.201) [-1573.923] (-1582.974) * [-1573.131] (-1569.718) (-1569.213) (-1570.955) -- 0:00:41
803000 -- [-1567.660] (-1568.776) (-1573.933) (-1577.584) * [-1578.625] (-1576.645) (-1568.977) (-1569.601) -- 0:00:41
803500 -- (-1564.820) [-1569.478] (-1570.228) (-1584.127) * (-1570.595) [-1572.414] (-1574.627) (-1575.203) -- 0:00:41
804000 -- (-1567.485) [-1573.604] (-1569.369) (-1570.861) * [-1568.148] (-1573.140) (-1580.731) (-1565.163) -- 0:00:40
804500 -- (-1569.005) (-1570.060) (-1570.164) [-1573.149] * (-1572.399) [-1571.127] (-1572.061) (-1570.786) -- 0:00:40
805000 -- [-1569.320] (-1574.327) (-1568.665) (-1567.175) * (-1573.569) [-1568.119] (-1569.166) (-1570.176) -- 0:00:40
Average standard deviation of split frequencies: 0.004484
805500 -- (-1572.172) (-1568.913) (-1572.924) [-1568.801] * [-1567.649] (-1572.752) (-1577.238) (-1569.227) -- 0:00:40
806000 -- [-1573.676] (-1569.967) (-1576.109) (-1576.307) * (-1571.070) (-1575.867) (-1565.845) [-1567.686] -- 0:00:40
806500 -- [-1574.503] (-1572.377) (-1566.570) (-1570.440) * (-1574.217) (-1576.853) [-1569.989] (-1572.225) -- 0:00:40
807000 -- (-1573.247) [-1572.143] (-1572.854) (-1569.093) * (-1570.985) (-1571.082) [-1566.988] (-1575.052) -- 0:00:40
807500 -- (-1574.921) [-1572.118] (-1573.055) (-1573.538) * (-1567.732) (-1572.997) [-1566.166] (-1573.479) -- 0:00:40
808000 -- [-1568.359] (-1576.377) (-1574.592) (-1570.587) * (-1571.677) [-1564.883] (-1569.757) (-1577.099) -- 0:00:40
808500 -- (-1568.331) (-1574.548) [-1566.242] (-1568.633) * (-1566.720) (-1575.329) [-1569.115] (-1574.427) -- 0:00:40
809000 -- [-1569.492] (-1575.140) (-1572.459) (-1567.108) * (-1572.372) [-1577.476] (-1572.847) (-1575.182) -- 0:00:39
809500 -- (-1571.748) (-1574.946) [-1571.743] (-1568.474) * (-1575.648) (-1573.354) (-1577.532) [-1568.210] -- 0:00:39
810000 -- [-1568.408] (-1568.716) (-1570.417) (-1573.297) * (-1574.015) (-1567.465) (-1571.989) [-1570.651] -- 0:00:39
Average standard deviation of split frequencies: 0.004361
810500 -- (-1567.920) (-1573.006) (-1570.356) [-1569.930] * (-1576.804) [-1569.501] (-1571.874) (-1571.775) -- 0:00:39
811000 -- (-1570.267) [-1571.833] (-1582.528) (-1572.402) * (-1570.302) [-1569.844] (-1572.168) (-1576.728) -- 0:00:39
811500 -- (-1573.229) (-1570.565) (-1570.368) [-1567.631] * (-1569.974) [-1575.937] (-1567.705) (-1569.118) -- 0:00:39
812000 -- (-1575.981) (-1568.330) [-1567.465] (-1568.404) * (-1569.781) [-1568.917] (-1574.451) (-1571.231) -- 0:00:39
812500 -- [-1572.718] (-1572.897) (-1574.483) (-1570.861) * (-1574.644) [-1574.733] (-1566.939) (-1575.860) -- 0:00:39
813000 -- (-1575.161) (-1573.800) [-1572.049] (-1567.934) * (-1570.043) [-1568.003] (-1573.571) (-1569.358) -- 0:00:39
813500 -- (-1577.714) (-1570.834) [-1571.955] (-1571.334) * (-1570.643) (-1578.965) (-1570.672) [-1577.367] -- 0:00:38
814000 -- (-1579.721) [-1572.063] (-1566.983) (-1565.285) * (-1574.433) (-1579.512) (-1576.923) [-1569.960] -- 0:00:38
814500 -- (-1572.963) [-1569.044] (-1571.388) (-1573.353) * [-1569.942] (-1571.000) (-1564.646) (-1572.464) -- 0:00:38
815000 -- (-1564.991) (-1577.988) [-1572.967] (-1571.647) * (-1568.050) (-1579.344) [-1574.368] (-1572.892) -- 0:00:38
Average standard deviation of split frequencies: 0.004333
815500 -- (-1576.444) (-1568.956) (-1573.545) [-1568.754] * (-1571.373) (-1585.132) (-1577.796) [-1566.306] -- 0:00:38
816000 -- (-1572.399) [-1570.593] (-1581.386) (-1578.385) * [-1573.499] (-1577.963) (-1579.793) (-1574.043) -- 0:00:38
816500 -- (-1568.818) (-1564.026) [-1569.341] (-1572.599) * (-1563.991) (-1578.075) (-1566.182) [-1571.740] -- 0:00:38
817000 -- (-1572.538) (-1569.977) [-1567.021] (-1570.133) * (-1568.799) (-1565.898) [-1573.505] (-1573.695) -- 0:00:38
817500 -- [-1568.536] (-1567.429) (-1567.804) (-1569.572) * [-1569.536] (-1571.601) (-1574.627) (-1571.101) -- 0:00:38
818000 -- [-1572.740] (-1581.448) (-1574.557) (-1565.190) * (-1568.405) [-1571.224] (-1571.145) (-1566.492) -- 0:00:38
818500 -- (-1571.900) [-1567.187] (-1573.885) (-1571.514) * (-1571.777) (-1568.713) (-1573.717) [-1572.378] -- 0:00:37
819000 -- (-1570.916) (-1570.904) [-1573.480] (-1574.138) * (-1568.417) (-1568.404) (-1574.913) [-1565.627] -- 0:00:37
819500 -- (-1570.214) (-1567.201) [-1570.371] (-1577.925) * (-1568.590) [-1564.606] (-1564.891) (-1568.128) -- 0:00:37
820000 -- (-1571.765) [-1573.996] (-1573.045) (-1581.291) * [-1568.585] (-1582.431) (-1573.085) (-1575.958) -- 0:00:37
Average standard deviation of split frequencies: 0.004691
820500 -- (-1577.194) (-1571.362) (-1569.439) [-1564.567] * (-1574.366) [-1570.199] (-1574.053) (-1572.210) -- 0:00:37
821000 -- (-1568.798) (-1578.305) (-1571.930) [-1566.964] * (-1575.193) (-1586.242) (-1581.980) [-1570.566] -- 0:00:37
821500 -- (-1586.021) [-1570.517] (-1573.111) (-1571.042) * (-1568.647) (-1578.288) [-1571.992] (-1570.403) -- 0:00:37
822000 -- (-1572.655) (-1577.368) (-1572.353) [-1576.871] * (-1568.400) [-1570.246] (-1570.568) (-1573.513) -- 0:00:37
822500 -- (-1575.768) (-1579.307) (-1568.236) [-1571.121] * (-1572.136) [-1571.975] (-1576.636) (-1570.956) -- 0:00:37
823000 -- (-1581.227) [-1571.694] (-1573.958) (-1577.628) * (-1576.966) (-1566.643) [-1572.177] (-1573.942) -- 0:00:36
823500 -- (-1574.767) (-1571.281) (-1570.442) [-1567.600] * (-1573.447) [-1569.429] (-1573.428) (-1567.946) -- 0:00:36
824000 -- (-1576.982) (-1578.336) [-1568.434] (-1572.923) * (-1575.083) (-1568.702) (-1565.943) [-1569.454] -- 0:00:36
824500 -- (-1571.399) (-1577.338) [-1570.435] (-1564.963) * [-1568.105] (-1572.426) (-1570.240) (-1570.414) -- 0:00:36
825000 -- (-1570.633) (-1576.328) [-1570.734] (-1575.002) * (-1572.858) (-1569.557) (-1571.833) [-1568.408] -- 0:00:36
Average standard deviation of split frequencies: 0.004471
825500 -- (-1574.133) (-1584.092) [-1572.913] (-1569.689) * (-1567.368) [-1570.888] (-1572.999) (-1579.489) -- 0:00:36
826000 -- (-1572.411) (-1574.890) [-1566.678] (-1572.165) * [-1566.836] (-1576.515) (-1571.582) (-1565.951) -- 0:00:36
826500 -- (-1570.540) [-1568.414] (-1573.825) (-1575.767) * [-1571.835] (-1573.729) (-1566.709) (-1572.680) -- 0:00:36
827000 -- (-1566.250) (-1576.418) (-1573.995) [-1567.759] * (-1577.909) (-1570.449) (-1572.318) [-1573.861] -- 0:00:36
827500 -- (-1569.426) (-1571.476) (-1577.357) [-1568.310] * [-1567.936] (-1572.170) (-1576.318) (-1568.138) -- 0:00:36
828000 -- [-1566.561] (-1571.361) (-1570.031) (-1575.387) * (-1573.435) (-1572.884) (-1569.013) [-1570.393] -- 0:00:35
828500 -- [-1566.932] (-1570.209) (-1572.816) (-1574.300) * (-1571.805) (-1580.768) [-1567.254] (-1575.688) -- 0:00:35
829000 -- (-1576.899) (-1573.706) [-1574.089] (-1573.536) * (-1580.869) (-1572.203) (-1570.057) [-1570.877] -- 0:00:35
829500 -- [-1576.427] (-1575.282) (-1569.528) (-1573.524) * (-1566.816) [-1569.783] (-1573.457) (-1568.829) -- 0:00:35
830000 -- (-1578.629) [-1569.964] (-1571.803) (-1571.331) * (-1568.475) (-1576.163) [-1569.260] (-1561.884) -- 0:00:35
Average standard deviation of split frequencies: 0.005202
830500 -- (-1575.240) [-1568.033] (-1581.059) (-1569.731) * [-1571.267] (-1573.291) (-1571.767) (-1579.595) -- 0:00:35
831000 -- (-1570.473) (-1579.227) [-1568.688] (-1570.273) * (-1577.886) (-1575.938) (-1577.126) [-1569.966] -- 0:00:35
831500 -- (-1572.358) (-1574.188) [-1569.829] (-1576.882) * (-1577.239) [-1572.242] (-1576.108) (-1572.959) -- 0:00:35
832000 -- (-1567.094) (-1567.581) (-1570.066) [-1571.394] * (-1568.338) (-1572.925) (-1579.757) [-1572.691] -- 0:00:35
832500 -- (-1575.830) (-1576.031) [-1567.509] (-1571.792) * (-1568.235) [-1571.423] (-1572.755) (-1574.525) -- 0:00:35
833000 -- [-1574.373] (-1579.468) (-1573.070) (-1577.554) * (-1565.328) (-1572.968) (-1580.162) [-1569.106] -- 0:00:34
833500 -- (-1565.893) (-1568.015) (-1568.538) [-1566.173] * (-1570.844) (-1574.579) [-1571.842] (-1571.263) -- 0:00:34
834000 -- (-1565.857) (-1578.934) (-1570.169) [-1574.178] * (-1568.465) (-1570.219) [-1573.212] (-1572.296) -- 0:00:34
834500 -- [-1568.255] (-1571.807) (-1567.859) (-1577.117) * (-1575.359) [-1569.396] (-1570.866) (-1573.807) -- 0:00:34
835000 -- [-1577.876] (-1574.502) (-1569.394) (-1579.293) * [-1569.584] (-1572.754) (-1576.063) (-1572.099) -- 0:00:34
Average standard deviation of split frequencies: 0.005545
835500 -- (-1574.736) (-1570.022) (-1569.830) [-1574.304] * (-1579.112) [-1571.359] (-1571.960) (-1574.981) -- 0:00:34
836000 -- (-1568.483) (-1576.616) (-1574.083) [-1567.926] * (-1571.211) (-1573.092) (-1572.602) [-1571.939] -- 0:00:34
836500 -- [-1571.753] (-1577.530) (-1567.866) (-1575.394) * [-1574.352] (-1574.494) (-1573.246) (-1571.444) -- 0:00:34
837000 -- (-1571.904) (-1576.607) (-1569.708) [-1570.926] * (-1573.364) (-1581.270) [-1575.988] (-1573.280) -- 0:00:34
837500 -- [-1571.762] (-1579.211) (-1566.653) (-1574.333) * (-1572.918) [-1572.284] (-1574.154) (-1570.968) -- 0:00:33
838000 -- [-1567.619] (-1568.164) (-1568.745) (-1577.097) * [-1567.929] (-1572.262) (-1572.405) (-1572.976) -- 0:00:33
838500 -- (-1569.191) [-1574.413] (-1576.118) (-1575.531) * (-1581.599) [-1564.385] (-1570.964) (-1572.516) -- 0:00:33
839000 -- [-1566.793] (-1570.781) (-1567.848) (-1570.207) * (-1571.903) [-1571.368] (-1576.268) (-1579.108) -- 0:00:33
839500 -- [-1569.476] (-1571.987) (-1566.187) (-1571.442) * (-1575.965) (-1574.909) [-1574.916] (-1567.422) -- 0:00:33
840000 -- (-1571.588) [-1578.446] (-1566.233) (-1572.326) * (-1575.519) (-1573.873) (-1574.132) [-1566.662] -- 0:00:33
Average standard deviation of split frequencies: 0.005888
840500 -- (-1580.046) (-1574.918) (-1572.198) [-1568.760] * (-1574.536) (-1569.053) (-1575.061) [-1572.053] -- 0:00:33
841000 -- (-1574.113) (-1568.252) (-1570.721) [-1566.026] * (-1571.124) [-1568.022] (-1570.393) (-1569.873) -- 0:00:33
841500 -- (-1575.116) (-1573.087) (-1572.276) [-1568.328] * (-1568.976) (-1573.800) (-1575.051) [-1576.238] -- 0:00:33
842000 -- (-1566.555) (-1570.124) [-1567.163] (-1565.181) * (-1570.377) [-1573.457] (-1576.352) (-1579.136) -- 0:00:33
842500 -- [-1574.342] (-1567.945) (-1568.079) (-1570.454) * (-1571.702) (-1572.816) [-1569.925] (-1571.189) -- 0:00:32
843000 -- (-1573.860) [-1565.526] (-1569.719) (-1570.291) * [-1571.879] (-1574.290) (-1574.978) (-1571.123) -- 0:00:32
843500 -- (-1576.175) (-1570.379) [-1577.733] (-1574.973) * (-1574.237) (-1571.673) [-1562.711] (-1570.105) -- 0:00:32
844000 -- (-1580.110) (-1571.959) [-1572.570] (-1578.408) * (-1570.628) (-1571.980) [-1565.370] (-1572.465) -- 0:00:32
844500 -- (-1568.351) (-1577.092) (-1576.907) [-1571.462] * (-1572.389) (-1580.122) (-1569.718) [-1568.593] -- 0:00:32
845000 -- (-1575.496) [-1570.485] (-1576.408) (-1573.469) * (-1568.503) (-1571.839) (-1577.354) [-1574.938] -- 0:00:32
Average standard deviation of split frequencies: 0.005572
845500 -- [-1564.522] (-1575.102) (-1571.186) (-1568.133) * [-1572.877] (-1568.963) (-1571.872) (-1578.376) -- 0:00:32
846000 -- (-1569.764) [-1566.407] (-1577.681) (-1585.001) * (-1571.022) (-1567.772) (-1575.394) [-1567.157] -- 0:00:32
846500 -- (-1567.072) (-1567.950) (-1569.168) [-1569.894] * [-1563.913] (-1572.738) (-1566.272) (-1572.309) -- 0:00:32
847000 -- [-1568.278] (-1571.768) (-1575.605) (-1568.806) * (-1575.287) (-1570.944) [-1568.043] (-1573.512) -- 0:00:31
847500 -- (-1564.483) [-1568.240] (-1569.633) (-1568.524) * (-1581.363) (-1574.329) [-1568.839] (-1572.687) -- 0:00:31
848000 -- [-1577.404] (-1568.639) (-1566.932) (-1571.509) * (-1581.909) (-1575.050) [-1565.610] (-1576.212) -- 0:00:31
848500 -- (-1569.925) (-1573.824) (-1569.361) [-1565.222] * (-1573.216) [-1572.209] (-1568.112) (-1569.126) -- 0:00:31
849000 -- [-1570.901] (-1582.479) (-1569.365) (-1566.965) * (-1583.940) (-1576.519) (-1570.882) [-1570.401] -- 0:00:31
849500 -- [-1570.857] (-1582.290) (-1577.595) (-1564.888) * (-1574.208) [-1576.257] (-1566.824) (-1571.047) -- 0:00:31
850000 -- [-1574.330] (-1571.546) (-1573.897) (-1574.726) * (-1571.262) [-1571.174] (-1567.035) (-1572.468) -- 0:00:31
Average standard deviation of split frequencies: 0.005449
850500 -- (-1579.244) (-1570.484) [-1570.583] (-1570.043) * (-1575.366) [-1570.039] (-1568.717) (-1577.766) -- 0:00:31
851000 -- (-1575.465) (-1569.897) [-1572.341] (-1567.098) * [-1569.176] (-1569.974) (-1568.810) (-1565.678) -- 0:00:30
851500 -- (-1578.220) [-1571.655] (-1573.708) (-1570.346) * (-1570.608) [-1571.655] (-1570.489) (-1580.633) -- 0:00:31
852000 -- (-1568.318) (-1567.316) (-1579.589) [-1574.887] * (-1576.529) (-1578.441) [-1569.443] (-1580.515) -- 0:00:30
852500 -- (-1573.629) (-1572.155) (-1571.117) [-1572.177] * (-1570.797) (-1574.595) [-1565.516] (-1581.050) -- 0:00:30
853000 -- (-1570.094) (-1568.160) [-1566.756] (-1578.213) * [-1571.301] (-1574.053) (-1567.855) (-1576.325) -- 0:00:30
853500 -- (-1573.091) (-1569.031) (-1571.266) [-1570.017] * [-1574.007] (-1576.532) (-1572.097) (-1578.156) -- 0:00:30
854000 -- (-1570.623) [-1571.414] (-1571.822) (-1572.143) * (-1573.978) (-1583.643) [-1567.769] (-1576.794) -- 0:00:30
854500 -- (-1580.569) (-1571.892) [-1568.356] (-1566.215) * (-1578.158) [-1575.230] (-1567.177) (-1573.550) -- 0:00:30
855000 -- (-1572.522) (-1573.762) [-1571.009] (-1571.823) * [-1566.766] (-1574.093) (-1571.410) (-1570.845) -- 0:00:30
Average standard deviation of split frequencies: 0.006241
855500 -- (-1570.459) [-1574.155] (-1569.466) (-1571.283) * (-1569.583) (-1565.127) [-1573.760] (-1573.255) -- 0:00:30
856000 -- (-1570.120) (-1571.980) [-1577.076] (-1566.262) * [-1569.297] (-1572.888) (-1570.815) (-1572.523) -- 0:00:29
856500 -- (-1570.274) (-1575.327) [-1575.237] (-1567.941) * (-1571.667) [-1567.687] (-1571.176) (-1573.677) -- 0:00:29
857000 -- (-1584.818) (-1578.476) [-1568.287] (-1566.463) * (-1572.465) (-1569.134) [-1581.317] (-1568.037) -- 0:00:29
857500 -- (-1575.664) (-1573.593) (-1568.600) [-1569.571] * (-1572.871) (-1569.981) (-1578.525) [-1568.551] -- 0:00:29
858000 -- [-1565.524] (-1570.148) (-1571.507) (-1569.999) * (-1574.052) [-1567.211] (-1579.506) (-1571.583) -- 0:00:29
858500 -- (-1571.031) (-1578.132) [-1568.202] (-1569.890) * (-1572.572) (-1570.808) [-1569.120] (-1571.446) -- 0:00:29
859000 -- (-1570.261) [-1573.452] (-1569.051) (-1573.074) * [-1567.578] (-1569.964) (-1573.230) (-1570.940) -- 0:00:29
859500 -- (-1565.566) (-1579.787) [-1571.124] (-1583.059) * (-1573.383) (-1567.702) [-1568.335] (-1567.122) -- 0:00:29
860000 -- (-1572.924) (-1578.171) (-1582.858) [-1567.813] * (-1579.547) [-1565.768] (-1577.283) (-1571.127) -- 0:00:29
Average standard deviation of split frequencies: 0.005934
860500 -- (-1573.156) [-1569.437] (-1576.802) (-1578.897) * (-1575.638) (-1568.522) [-1572.131] (-1569.990) -- 0:00:29
861000 -- (-1578.008) (-1572.264) [-1579.671] (-1571.393) * (-1573.128) [-1569.264] (-1575.328) (-1568.546) -- 0:00:29
861500 -- [-1573.979] (-1574.835) (-1575.991) (-1577.324) * (-1572.843) (-1573.610) (-1568.833) [-1576.948] -- 0:00:28
862000 -- [-1569.793] (-1573.942) (-1574.714) (-1579.475) * (-1575.073) (-1576.325) (-1573.699) [-1570.864] -- 0:00:28
862500 -- (-1580.212) (-1568.450) (-1577.354) [-1567.236] * [-1567.878] (-1576.376) (-1578.586) (-1572.161) -- 0:00:28
863000 -- [-1575.373] (-1569.760) (-1573.511) (-1576.937) * (-1566.217) (-1575.081) (-1580.546) [-1571.948] -- 0:00:28
863500 -- (-1570.840) (-1570.812) (-1577.302) [-1576.813] * [-1568.117] (-1573.650) (-1579.118) (-1572.551) -- 0:00:28
864000 -- (-1571.555) (-1576.406) [-1571.069] (-1569.939) * [-1568.763] (-1584.297) (-1581.810) (-1571.408) -- 0:00:28
864500 -- (-1567.216) [-1573.961] (-1569.258) (-1568.885) * (-1572.151) (-1570.527) [-1573.971] (-1573.535) -- 0:00:28
865000 -- (-1573.028) (-1571.393) [-1574.551] (-1570.428) * [-1571.468] (-1574.607) (-1570.740) (-1579.229) -- 0:00:28
Average standard deviation of split frequencies: 0.005625
865500 -- (-1577.094) (-1570.348) (-1575.838) [-1573.489] * (-1574.246) (-1576.355) [-1572.143] (-1574.248) -- 0:00:27
866000 -- (-1569.793) [-1571.987] (-1566.500) (-1571.723) * (-1576.682) (-1569.766) [-1569.618] (-1571.941) -- 0:00:28
866500 -- [-1572.197] (-1570.340) (-1576.776) (-1569.028) * (-1571.925) [-1576.575] (-1571.048) (-1570.576) -- 0:00:27
867000 -- (-1568.916) (-1572.904) [-1570.471] (-1573.825) * [-1566.324] (-1572.673) (-1570.403) (-1568.374) -- 0:00:27
867500 -- (-1566.218) (-1568.562) [-1571.872] (-1572.996) * (-1575.510) (-1572.683) (-1574.121) [-1569.897] -- 0:00:27
868000 -- (-1566.799) (-1568.547) (-1569.643) [-1575.349] * (-1571.386) [-1570.109] (-1572.893) (-1570.744) -- 0:00:27
868500 -- (-1569.769) (-1577.308) (-1567.672) [-1569.505] * (-1567.664) (-1570.266) (-1572.701) [-1569.182] -- 0:00:27
869000 -- [-1573.694] (-1573.182) (-1578.436) (-1568.754) * [-1573.577] (-1571.730) (-1572.281) (-1569.757) -- 0:00:27
869500 -- (-1574.525) (-1579.181) (-1572.769) [-1575.625] * (-1577.345) [-1575.564] (-1571.032) (-1566.996) -- 0:00:27
870000 -- (-1572.489) (-1572.077) [-1566.502] (-1568.740) * (-1569.180) (-1583.426) [-1570.049] (-1572.401) -- 0:00:27
Average standard deviation of split frequencies: 0.005956
870500 -- [-1566.843] (-1569.689) (-1566.349) (-1571.744) * (-1566.039) (-1572.591) [-1574.153] (-1568.363) -- 0:00:26
871000 -- (-1573.193) (-1572.997) [-1569.154] (-1574.328) * (-1576.413) (-1567.285) (-1570.837) [-1577.692] -- 0:00:26
871500 -- [-1568.998] (-1568.605) (-1572.225) (-1572.296) * (-1569.091) [-1569.301] (-1569.447) (-1575.711) -- 0:00:26
872000 -- (-1574.991) [-1574.184] (-1573.645) (-1574.620) * [-1571.576] (-1570.623) (-1567.429) (-1570.895) -- 0:00:26
872500 -- [-1570.063] (-1569.794) (-1567.571) (-1580.704) * (-1570.406) (-1575.903) [-1565.727] (-1570.345) -- 0:00:26
873000 -- (-1569.122) (-1571.775) [-1568.263] (-1569.980) * [-1566.883] (-1571.754) (-1570.510) (-1572.291) -- 0:00:26
873500 -- (-1579.602) (-1575.375) (-1574.413) [-1569.649] * (-1576.775) (-1577.663) [-1573.680] (-1571.868) -- 0:00:26
874000 -- [-1568.428] (-1565.778) (-1569.854) (-1564.729) * (-1567.525) (-1576.345) (-1578.322) [-1567.904] -- 0:00:26
874500 -- (-1568.223) (-1576.586) (-1563.808) [-1570.141] * [-1572.667] (-1571.452) (-1568.455) (-1569.323) -- 0:00:26
875000 -- (-1572.775) (-1576.989) [-1566.192] (-1569.242) * (-1569.237) [-1575.271] (-1574.215) (-1571.395) -- 0:00:26
Average standard deviation of split frequencies: 0.006278
875500 -- (-1576.551) (-1581.242) (-1573.440) [-1569.317] * (-1573.348) (-1571.584) [-1575.865] (-1570.995) -- 0:00:25
876000 -- [-1575.879] (-1570.310) (-1570.913) (-1568.355) * (-1571.624) (-1570.218) (-1572.250) [-1574.490] -- 0:00:25
876500 -- (-1573.118) [-1572.224] (-1574.459) (-1572.390) * (-1568.289) [-1575.573] (-1569.809) (-1571.063) -- 0:00:25
877000 -- (-1570.513) (-1573.297) [-1569.459] (-1569.760) * (-1573.135) (-1572.564) (-1566.709) [-1568.931] -- 0:00:25
877500 -- (-1579.900) (-1570.553) (-1569.829) [-1567.752] * (-1573.535) (-1567.610) (-1569.183) [-1569.207] -- 0:00:25
878000 -- [-1567.927] (-1576.472) (-1569.609) (-1570.502) * (-1574.195) [-1567.727] (-1571.150) (-1574.530) -- 0:00:25
878500 -- (-1573.507) (-1575.384) [-1567.805] (-1568.846) * [-1569.480] (-1568.879) (-1569.494) (-1579.207) -- 0:00:25
879000 -- (-1574.818) [-1568.745] (-1569.796) (-1579.774) * (-1571.037) (-1570.643) (-1567.026) [-1570.165] -- 0:00:25
879500 -- (-1574.887) [-1571.015] (-1572.566) (-1572.568) * [-1569.933] (-1569.138) (-1573.429) (-1570.912) -- 0:00:25
880000 -- (-1573.197) (-1572.649) [-1565.429] (-1565.685) * [-1566.191] (-1568.846) (-1572.594) (-1574.029) -- 0:00:24
Average standard deviation of split frequencies: 0.006423
880500 -- [-1572.145] (-1569.170) (-1572.887) (-1568.004) * [-1567.010] (-1574.027) (-1580.052) (-1567.634) -- 0:00:24
881000 -- [-1568.105] (-1572.696) (-1577.735) (-1570.187) * [-1568.012] (-1568.182) (-1572.263) (-1568.623) -- 0:00:24
881500 -- (-1570.250) [-1576.431] (-1576.804) (-1572.515) * (-1568.013) (-1571.964) (-1571.360) [-1572.830] -- 0:00:24
882000 -- (-1572.685) (-1572.905) [-1581.685] (-1570.105) * (-1570.612) (-1568.172) [-1570.181] (-1577.084) -- 0:00:24
882500 -- (-1569.376) (-1579.661) (-1578.607) [-1568.120] * [-1569.961] (-1567.314) (-1570.492) (-1575.798) -- 0:00:24
883000 -- [-1568.594] (-1572.641) (-1578.009) (-1567.860) * (-1567.424) (-1572.810) [-1570.846] (-1576.374) -- 0:00:24
883500 -- (-1568.426) (-1568.890) [-1573.452] (-1573.015) * (-1572.583) (-1566.516) [-1572.089] (-1567.497) -- 0:00:24
884000 -- (-1573.456) [-1572.380] (-1576.078) (-1566.099) * (-1572.867) (-1565.893) (-1564.852) [-1567.537] -- 0:00:24
884500 -- (-1572.080) (-1579.574) (-1571.458) [-1567.303] * [-1576.805] (-1578.634) (-1578.224) (-1570.859) -- 0:00:24
885000 -- (-1569.444) [-1571.530] (-1577.904) (-1570.880) * (-1570.656) [-1571.644] (-1570.842) (-1565.435) -- 0:00:23
Average standard deviation of split frequencies: 0.006385
885500 -- [-1570.528] (-1577.956) (-1566.524) (-1573.308) * (-1570.665) (-1570.438) [-1571.790] (-1570.764) -- 0:00:23
886000 -- (-1566.534) (-1572.396) [-1566.947] (-1575.187) * [-1567.162] (-1568.941) (-1567.163) (-1575.924) -- 0:00:23
886500 -- (-1574.750) [-1570.407] (-1570.242) (-1574.527) * (-1572.154) (-1575.148) (-1569.692) [-1573.429] -- 0:00:23
887000 -- (-1568.709) (-1569.170) [-1571.146] (-1570.197) * (-1574.076) (-1571.898) (-1570.593) [-1567.750] -- 0:00:23
887500 -- (-1566.265) (-1567.895) (-1568.029) [-1574.575] * [-1573.698] (-1568.596) (-1570.619) (-1571.962) -- 0:00:23
888000 -- (-1575.913) (-1570.219) (-1573.184) [-1570.381] * (-1578.098) (-1567.128) [-1564.958] (-1571.007) -- 0:00:23
888500 -- (-1565.194) (-1570.432) [-1573.246] (-1570.392) * [-1567.318] (-1569.541) (-1569.195) (-1567.042) -- 0:00:23
889000 -- (-1572.087) [-1571.629] (-1575.352) (-1571.801) * (-1566.972) (-1566.857) [-1574.380] (-1573.907) -- 0:00:23
889500 -- (-1575.328) (-1578.825) (-1569.454) [-1566.069] * [-1565.630] (-1573.402) (-1584.921) (-1570.044) -- 0:00:22
890000 -- [-1578.308] (-1576.741) (-1580.978) (-1576.140) * (-1570.172) (-1574.381) (-1573.208) [-1566.314] -- 0:00:22
Average standard deviation of split frequencies: 0.006528
890500 -- (-1587.596) [-1570.509] (-1568.232) (-1578.849) * (-1575.467) [-1569.262] (-1568.434) (-1571.592) -- 0:00:22
891000 -- (-1576.148) [-1569.993] (-1568.868) (-1575.220) * [-1570.027] (-1578.198) (-1572.613) (-1580.021) -- 0:00:22
891500 -- (-1574.633) (-1566.933) (-1571.029) [-1575.768] * [-1578.799] (-1573.858) (-1569.885) (-1576.027) -- 0:00:22
892000 -- (-1578.006) [-1572.185] (-1570.296) (-1576.252) * (-1572.559) [-1567.626] (-1575.277) (-1572.848) -- 0:00:22
892500 -- (-1572.618) [-1565.209] (-1577.244) (-1573.857) * (-1576.894) [-1573.209] (-1581.551) (-1567.201) -- 0:00:22
893000 -- (-1574.007) (-1570.290) (-1568.713) [-1574.138] * (-1567.997) [-1564.972] (-1572.051) (-1571.193) -- 0:00:22
893500 -- [-1570.460] (-1570.560) (-1572.513) (-1582.729) * [-1569.661] (-1571.880) (-1575.195) (-1573.526) -- 0:00:22
894000 -- [-1570.328] (-1568.245) (-1574.011) (-1568.715) * (-1572.071) (-1569.515) (-1574.889) [-1569.699] -- 0:00:22
894500 -- (-1570.364) [-1570.932] (-1581.188) (-1584.110) * (-1567.492) [-1568.080] (-1576.203) (-1570.092) -- 0:00:21
895000 -- [-1571.157] (-1569.891) (-1577.313) (-1575.720) * (-1575.299) (-1567.209) [-1563.888] (-1583.974) -- 0:00:21
Average standard deviation of split frequencies: 0.006226
895500 -- (-1572.178) [-1569.058] (-1573.589) (-1571.562) * (-1572.567) [-1569.835] (-1573.697) (-1566.342) -- 0:00:21
896000 -- (-1571.065) (-1574.011) [-1573.895] (-1573.111) * (-1576.690) (-1571.490) [-1566.989] (-1571.904) -- 0:00:21
896500 -- [-1569.328] (-1575.677) (-1575.501) (-1572.815) * [-1571.899] (-1567.701) (-1570.386) (-1570.693) -- 0:00:21
897000 -- (-1570.900) (-1578.595) [-1578.052] (-1573.354) * [-1569.419] (-1570.668) (-1576.084) (-1567.789) -- 0:00:21
897500 -- (-1573.652) (-1584.476) [-1573.004] (-1569.334) * (-1570.658) [-1569.748] (-1568.200) (-1577.100) -- 0:00:21
898000 -- [-1572.511] (-1583.029) (-1577.954) (-1574.566) * [-1574.931] (-1578.498) (-1568.480) (-1589.059) -- 0:00:21
898500 -- (-1569.609) (-1577.963) (-1569.123) [-1570.205] * (-1583.939) [-1564.107] (-1573.285) (-1577.686) -- 0:00:21
899000 -- (-1583.983) (-1579.675) [-1575.191] (-1576.529) * (-1576.693) (-1567.797) [-1574.511] (-1567.705) -- 0:00:21
899500 -- (-1570.050) [-1574.131] (-1571.144) (-1571.846) * [-1575.580] (-1570.672) (-1572.022) (-1568.542) -- 0:00:20
900000 -- [-1570.993] (-1572.892) (-1569.640) (-1569.435) * (-1573.472) [-1574.182] (-1578.404) (-1570.420) -- 0:00:20
Average standard deviation of split frequencies: 0.006455
900500 -- (-1568.439) (-1565.984) (-1568.715) [-1568.967] * (-1566.287) [-1568.732] (-1581.048) (-1569.556) -- 0:00:20
901000 -- (-1569.669) [-1574.971] (-1570.715) (-1567.994) * (-1570.106) (-1572.079) (-1573.452) [-1572.417] -- 0:00:20
901500 -- (-1582.870) (-1578.630) [-1573.548] (-1574.015) * [-1564.908] (-1572.436) (-1583.074) (-1567.982) -- 0:00:20
902000 -- (-1573.393) [-1575.386] (-1571.524) (-1568.841) * [-1566.121] (-1566.909) (-1573.721) (-1574.201) -- 0:00:20
902500 -- (-1578.172) [-1571.505] (-1564.908) (-1568.182) * (-1575.693) (-1572.371) (-1576.304) [-1569.668] -- 0:00:20
903000 -- (-1572.679) [-1569.435] (-1567.242) (-1568.211) * (-1571.084) [-1571.557] (-1574.676) (-1574.579) -- 0:00:20
903500 -- (-1576.864) [-1574.459] (-1571.408) (-1569.171) * (-1579.617) (-1574.389) [-1569.366] (-1579.394) -- 0:00:20
904000 -- (-1585.092) (-1569.693) [-1568.892] (-1564.777) * (-1572.357) (-1576.971) [-1571.409] (-1572.879) -- 0:00:19
904500 -- (-1586.097) [-1572.466] (-1576.972) (-1570.701) * (-1576.473) (-1571.992) (-1568.557) [-1568.445] -- 0:00:19
905000 -- [-1570.035] (-1569.122) (-1576.461) (-1572.255) * (-1576.353) (-1570.792) [-1570.978] (-1567.580) -- 0:00:19
Average standard deviation of split frequencies: 0.006591
905500 -- [-1570.548] (-1573.322) (-1579.022) (-1568.761) * (-1578.152) (-1572.617) [-1572.031] (-1569.985) -- 0:00:19
906000 -- (-1571.862) [-1571.884] (-1569.197) (-1570.839) * (-1566.110) (-1575.943) (-1569.778) [-1572.362] -- 0:00:19
906500 -- [-1570.686] (-1574.275) (-1569.308) (-1577.487) * (-1575.247) (-1576.851) (-1568.716) [-1577.729] -- 0:00:19
907000 -- (-1574.218) (-1567.336) [-1566.842] (-1575.699) * (-1575.589) (-1571.353) [-1571.020] (-1570.592) -- 0:00:19
907500 -- (-1571.921) [-1566.253] (-1571.955) (-1573.326) * [-1569.857] (-1567.005) (-1568.192) (-1567.347) -- 0:00:19
908000 -- [-1579.728] (-1564.538) (-1571.562) (-1583.921) * (-1571.408) [-1570.150] (-1574.745) (-1569.275) -- 0:00:19
908500 -- (-1578.928) (-1584.349) [-1569.869] (-1585.912) * [-1571.943] (-1572.696) (-1571.996) (-1570.251) -- 0:00:19
909000 -- (-1577.486) [-1570.929] (-1586.695) (-1567.277) * (-1570.536) (-1572.521) [-1571.339] (-1570.278) -- 0:00:18
909500 -- (-1573.852) (-1569.919) (-1581.754) [-1568.316] * (-1577.211) [-1572.340] (-1568.701) (-1576.973) -- 0:00:18
910000 -- [-1567.482] (-1572.078) (-1574.235) (-1571.847) * (-1571.489) [-1565.955] (-1574.828) (-1578.995) -- 0:00:18
Average standard deviation of split frequencies: 0.006643
910500 -- (-1566.304) (-1578.376) [-1562.284] (-1566.685) * (-1564.728) [-1572.469] (-1568.047) (-1575.943) -- 0:00:18
911000 -- (-1575.952) [-1570.701] (-1575.221) (-1574.478) * (-1581.494) (-1573.659) [-1571.375] (-1576.967) -- 0:00:18
911500 -- (-1571.278) (-1568.206) (-1571.505) [-1570.012] * [-1568.627] (-1567.661) (-1577.295) (-1572.753) -- 0:00:18
912000 -- [-1568.788] (-1571.402) (-1571.172) (-1573.442) * (-1567.723) [-1577.666] (-1566.135) (-1579.448) -- 0:00:18
912500 -- (-1575.807) (-1575.233) [-1568.500] (-1572.570) * [-1569.975] (-1569.097) (-1567.430) (-1579.139) -- 0:00:18
913000 -- (-1574.367) (-1574.054) (-1570.342) [-1571.688] * (-1573.824) (-1568.784) [-1572.389] (-1572.554) -- 0:00:18
913500 -- (-1575.881) [-1571.959] (-1582.954) (-1568.668) * (-1565.688) [-1569.404] (-1572.006) (-1569.027) -- 0:00:17
914000 -- (-1576.090) (-1579.615) [-1568.762] (-1579.351) * [-1572.272] (-1579.328) (-1570.888) (-1570.791) -- 0:00:17
914500 -- [-1570.226] (-1567.945) (-1567.390) (-1575.684) * (-1569.345) [-1568.194] (-1567.281) (-1568.047) -- 0:00:17
915000 -- (-1569.850) (-1571.732) [-1572.622] (-1575.770) * (-1568.139) [-1568.308] (-1574.480) (-1576.059) -- 0:00:17
Average standard deviation of split frequencies: 0.006519
915500 -- (-1574.491) (-1567.783) [-1572.561] (-1583.376) * (-1567.480) [-1571.137] (-1573.914) (-1568.228) -- 0:00:17
916000 -- (-1566.030) (-1573.657) [-1574.351] (-1578.320) * (-1572.299) [-1572.959] (-1570.016) (-1569.651) -- 0:00:17
916500 -- (-1566.093) [-1566.655] (-1577.950) (-1579.549) * (-1575.816) (-1572.794) [-1566.362] (-1568.549) -- 0:00:17
917000 -- (-1567.110) (-1567.328) (-1581.625) [-1578.530] * (-1574.462) (-1573.293) [-1566.872] (-1575.458) -- 0:00:17
917500 -- (-1566.720) (-1569.618) (-1578.138) [-1573.367] * (-1567.922) (-1568.967) [-1571.415] (-1574.553) -- 0:00:17
918000 -- (-1569.588) (-1576.533) (-1579.672) [-1569.755] * [-1570.302] (-1571.129) (-1584.218) (-1573.336) -- 0:00:17
918500 -- [-1566.555] (-1575.575) (-1570.336) (-1575.718) * [-1564.770] (-1570.069) (-1569.867) (-1572.116) -- 0:00:16
919000 -- (-1570.062) [-1569.732] (-1576.301) (-1571.566) * (-1575.893) [-1566.863] (-1570.633) (-1568.052) -- 0:00:16
919500 -- (-1568.126) (-1572.486) (-1568.110) [-1565.951] * (-1568.477) (-1570.641) (-1577.810) [-1565.508] -- 0:00:16
920000 -- (-1572.374) [-1567.346] (-1570.353) (-1570.073) * (-1576.885) [-1569.085] (-1575.830) (-1578.272) -- 0:00:16
Average standard deviation of split frequencies: 0.006571
920500 -- [-1568.976] (-1570.939) (-1569.313) (-1576.453) * (-1572.180) (-1572.436) (-1574.264) [-1567.746] -- 0:00:16
921000 -- (-1572.627) (-1571.321) (-1572.239) [-1564.956] * (-1572.668) (-1574.027) [-1566.471] (-1570.136) -- 0:00:16
921500 -- (-1567.838) (-1569.077) [-1567.167] (-1568.308) * [-1575.525] (-1576.491) (-1562.907) (-1574.653) -- 0:00:16
922000 -- [-1576.045] (-1570.144) (-1573.350) (-1574.214) * (-1571.832) (-1573.485) (-1572.292) [-1565.925] -- 0:00:16
922500 -- [-1568.487] (-1578.426) (-1579.454) (-1579.227) * (-1572.317) (-1568.347) (-1576.614) [-1573.466] -- 0:00:16
923000 -- [-1573.673] (-1580.980) (-1580.237) (-1572.023) * (-1576.620) (-1569.990) (-1575.506) [-1569.503] -- 0:00:16
923500 -- (-1574.441) [-1575.328] (-1575.657) (-1567.484) * (-1571.716) [-1574.485] (-1571.422) (-1566.764) -- 0:00:15
924000 -- (-1575.992) (-1572.285) (-1582.296) [-1569.349] * [-1570.428] (-1570.358) (-1568.151) (-1572.815) -- 0:00:15
924500 -- [-1572.955] (-1574.481) (-1569.045) (-1578.920) * (-1571.231) [-1565.901] (-1567.393) (-1572.835) -- 0:00:15
925000 -- (-1572.273) (-1569.659) (-1565.444) [-1566.225] * [-1572.047] (-1572.893) (-1568.800) (-1570.893) -- 0:00:15
Average standard deviation of split frequencies: 0.007382
925500 -- [-1573.585] (-1570.250) (-1571.142) (-1574.543) * (-1582.476) (-1575.867) (-1574.019) [-1571.072] -- 0:00:15
926000 -- [-1570.939] (-1565.829) (-1571.701) (-1570.433) * (-1566.132) [-1574.594] (-1569.557) (-1572.624) -- 0:00:15
926500 -- (-1574.889) (-1574.005) (-1572.770) [-1570.613] * (-1569.258) (-1569.516) (-1574.616) [-1565.851] -- 0:00:15
927000 -- [-1567.719] (-1567.714) (-1575.571) (-1567.528) * (-1574.889) (-1572.325) [-1567.028] (-1574.981) -- 0:00:15
927500 -- (-1566.402) [-1567.384] (-1574.365) (-1569.808) * [-1570.551] (-1567.875) (-1567.777) (-1577.664) -- 0:00:15
928000 -- [-1571.970] (-1581.205) (-1576.111) (-1566.535) * (-1571.739) (-1570.976) [-1573.188] (-1569.677) -- 0:00:14
928500 -- [-1570.973] (-1572.520) (-1574.417) (-1575.513) * (-1573.178) [-1575.594] (-1565.866) (-1578.588) -- 0:00:14
929000 -- [-1577.845] (-1574.900) (-1566.043) (-1570.257) * (-1574.832) (-1568.964) (-1573.081) [-1572.112] -- 0:00:14
929500 -- (-1577.093) [-1568.987] (-1569.650) (-1567.163) * (-1572.918) (-1569.969) [-1567.601] (-1565.971) -- 0:00:14
930000 -- (-1571.207) (-1571.075) (-1577.769) [-1571.629] * (-1577.398) (-1569.107) [-1569.156] (-1571.388) -- 0:00:14
Average standard deviation of split frequencies: 0.007429
930500 -- (-1574.174) [-1570.543] (-1567.764) (-1572.022) * (-1569.880) [-1570.259] (-1574.987) (-1566.145) -- 0:00:14
931000 -- (-1572.312) [-1569.285] (-1570.212) (-1573.175) * (-1571.653) [-1568.096] (-1572.706) (-1572.492) -- 0:00:14
931500 -- (-1571.349) (-1570.708) [-1569.036] (-1573.187) * (-1570.003) (-1574.036) (-1579.181) [-1568.863] -- 0:00:14
932000 -- (-1576.509) (-1579.160) [-1569.052] (-1579.783) * [-1571.597] (-1573.390) (-1570.178) (-1571.983) -- 0:00:14
932500 -- (-1570.575) [-1571.229] (-1567.495) (-1577.033) * [-1578.841] (-1567.127) (-1574.217) (-1571.655) -- 0:00:14
933000 -- [-1568.133] (-1566.628) (-1574.874) (-1581.217) * (-1574.988) (-1568.378) (-1575.188) [-1564.766] -- 0:00:13
933500 -- (-1570.144) [-1567.806] (-1569.923) (-1564.021) * (-1576.824) [-1573.228] (-1566.613) (-1569.242) -- 0:00:13
934000 -- (-1580.997) [-1566.495] (-1572.617) (-1567.628) * (-1572.290) (-1573.247) [-1567.687] (-1564.598) -- 0:00:13
934500 -- (-1571.641) (-1570.978) [-1570.909] (-1575.006) * (-1571.829) (-1578.758) [-1567.942] (-1576.339) -- 0:00:13
935000 -- (-1571.184) (-1574.486) [-1572.305] (-1565.452) * (-1573.083) (-1577.191) [-1567.138] (-1574.433) -- 0:00:13
Average standard deviation of split frequencies: 0.007471
935500 -- (-1568.903) (-1567.688) [-1571.004] (-1578.446) * [-1572.020] (-1581.607) (-1574.534) (-1570.562) -- 0:00:13
936000 -- [-1568.592] (-1577.581) (-1573.771) (-1581.427) * (-1565.824) [-1566.922] (-1568.334) (-1567.312) -- 0:00:13
936500 -- (-1565.791) (-1571.021) [-1567.597] (-1572.445) * (-1573.924) [-1567.669] (-1568.220) (-1566.654) -- 0:00:13
937000 -- (-1581.261) (-1574.522) [-1571.656] (-1567.726) * (-1571.070) (-1570.417) [-1567.795] (-1573.239) -- 0:00:13
937500 -- (-1573.040) (-1576.058) (-1579.029) [-1572.024] * (-1568.910) [-1569.375] (-1576.895) (-1572.693) -- 0:00:13
938000 -- (-1573.453) [-1572.336] (-1578.765) (-1574.005) * (-1574.335) (-1570.808) (-1580.081) [-1577.342] -- 0:00:12
938500 -- (-1571.767) (-1584.129) (-1568.292) [-1572.103] * [-1570.769] (-1574.745) (-1578.048) (-1583.469) -- 0:00:12
939000 -- (-1579.859) [-1576.919] (-1564.986) (-1579.411) * (-1565.390) (-1578.287) [-1572.893] (-1575.957) -- 0:00:12
939500 -- (-1574.302) (-1567.932) (-1571.755) [-1577.365] * (-1574.851) (-1575.078) (-1572.795) [-1569.202] -- 0:00:12
940000 -- [-1568.284] (-1574.863) (-1577.144) (-1568.832) * (-1571.327) (-1582.095) [-1568.566] (-1581.697) -- 0:00:12
Average standard deviation of split frequencies: 0.007434
940500 -- [-1565.277] (-1571.388) (-1570.195) (-1571.217) * [-1577.955] (-1572.632) (-1564.551) (-1575.450) -- 0:00:12
941000 -- [-1566.845] (-1570.375) (-1574.276) (-1570.612) * (-1567.047) (-1567.356) [-1568.223] (-1573.390) -- 0:00:12
941500 -- [-1567.921] (-1565.229) (-1566.296) (-1568.639) * [-1569.438] (-1571.129) (-1572.192) (-1565.363) -- 0:00:12
942000 -- (-1576.281) [-1568.323] (-1567.610) (-1571.954) * (-1572.723) (-1567.746) (-1567.799) [-1568.768] -- 0:00:12
942500 -- (-1571.100) (-1567.622) (-1570.075) [-1574.098] * (-1572.570) (-1572.976) [-1569.682] (-1577.748) -- 0:00:11
943000 -- (-1570.523) (-1577.720) (-1568.509) [-1573.860] * (-1574.127) (-1577.786) (-1578.478) [-1573.750] -- 0:00:11
943500 -- (-1575.568) [-1568.225] (-1571.447) (-1577.942) * (-1577.515) (-1579.949) (-1570.395) [-1568.073] -- 0:00:11
944000 -- (-1572.285) (-1570.890) [-1579.062] (-1575.564) * [-1566.926] (-1580.516) (-1577.241) (-1570.060) -- 0:00:11
944500 -- [-1563.895] (-1575.002) (-1568.580) (-1574.327) * (-1570.625) (-1572.105) (-1575.835) [-1566.682] -- 0:00:11
945000 -- (-1567.215) (-1563.016) (-1577.101) [-1567.460] * (-1570.545) (-1572.303) (-1575.553) [-1570.864] -- 0:00:11
Average standard deviation of split frequencies: 0.007142
945500 -- (-1576.781) (-1582.597) (-1573.578) [-1564.436] * (-1570.770) (-1565.526) [-1569.562] (-1568.823) -- 0:00:11
946000 -- [-1572.946] (-1576.189) (-1582.121) (-1571.587) * (-1572.902) [-1566.721] (-1567.748) (-1572.205) -- 0:00:11
946500 -- (-1567.962) [-1576.376] (-1574.439) (-1570.912) * (-1575.877) (-1577.828) (-1573.779) [-1568.409] -- 0:00:11
947000 -- [-1569.908] (-1581.649) (-1577.011) (-1570.073) * (-1575.213) (-1578.534) [-1570.925] (-1570.616) -- 0:00:11
947500 -- (-1572.806) (-1582.331) [-1568.599] (-1570.505) * (-1572.134) (-1573.975) [-1570.404] (-1575.657) -- 0:00:10
948000 -- (-1566.800) [-1568.877] (-1578.178) (-1567.895) * (-1588.878) (-1574.124) [-1577.723] (-1567.045) -- 0:00:10
948500 -- [-1571.495] (-1566.491) (-1569.371) (-1566.442) * (-1573.864) (-1572.184) [-1570.239] (-1572.720) -- 0:00:10
949000 -- (-1570.724) (-1574.025) [-1576.786] (-1567.876) * (-1569.155) (-1567.072) [-1567.818] (-1575.081) -- 0:00:10
949500 -- (-1583.386) (-1578.808) [-1570.665] (-1567.809) * (-1580.684) (-1567.235) (-1573.161) [-1565.509] -- 0:00:10
950000 -- (-1570.686) (-1572.623) [-1567.357] (-1566.793) * (-1571.086) [-1579.845] (-1573.662) (-1568.895) -- 0:00:10
Average standard deviation of split frequencies: 0.007190
950500 -- [-1575.096] (-1570.605) (-1569.291) (-1586.390) * (-1570.999) [-1569.617] (-1567.494) (-1577.153) -- 0:00:10
951000 -- [-1568.000] (-1576.397) (-1569.682) (-1565.785) * (-1576.684) [-1571.377] (-1574.653) (-1568.606) -- 0:00:10
951500 -- (-1580.599) (-1568.291) (-1571.114) [-1566.873] * (-1569.283) (-1570.119) [-1569.138] (-1565.334) -- 0:00:10
952000 -- [-1574.843] (-1570.212) (-1571.003) (-1572.575) * (-1572.655) (-1574.528) [-1571.569] (-1569.399) -- 0:00:09
952500 -- (-1583.966) [-1566.681] (-1568.641) (-1571.390) * (-1567.760) (-1568.843) (-1568.362) [-1568.917] -- 0:00:09
953000 -- [-1568.658] (-1575.131) (-1581.606) (-1577.119) * (-1569.563) [-1571.034] (-1568.625) (-1570.563) -- 0:00:09
953500 -- (-1566.128) (-1565.516) [-1569.702] (-1579.637) * (-1571.120) [-1564.688] (-1568.596) (-1571.959) -- 0:00:09
954000 -- [-1566.624] (-1570.881) (-1571.233) (-1573.562) * (-1570.728) (-1573.458) [-1566.776] (-1569.397) -- 0:00:09
954500 -- (-1572.896) (-1575.733) [-1576.536] (-1576.975) * (-1566.876) [-1568.554] (-1572.770) (-1575.921) -- 0:00:09
955000 -- (-1572.735) [-1567.856] (-1570.582) (-1579.277) * (-1564.898) (-1570.291) (-1573.790) [-1570.397] -- 0:00:09
Average standard deviation of split frequencies: 0.006903
955500 -- (-1566.826) (-1568.732) [-1567.033] (-1579.322) * [-1568.296] (-1575.190) (-1573.639) (-1570.598) -- 0:00:09
956000 -- (-1570.789) [-1570.650] (-1581.310) (-1583.709) * (-1578.803) [-1566.536] (-1574.553) (-1568.950) -- 0:00:09
956500 -- [-1567.844] (-1568.737) (-1577.182) (-1573.157) * (-1571.602) [-1568.039] (-1569.800) (-1574.329) -- 0:00:09
957000 -- (-1571.344) [-1572.719] (-1568.211) (-1573.961) * (-1576.153) [-1575.602] (-1568.852) (-1577.851) -- 0:00:08
957500 -- (-1569.905) [-1573.367] (-1572.508) (-1572.377) * (-1566.653) (-1570.739) [-1567.266] (-1576.135) -- 0:00:08
958000 -- (-1570.822) (-1567.974) (-1569.672) [-1568.940] * (-1574.557) [-1575.170] (-1566.788) (-1565.748) -- 0:00:08
958500 -- (-1573.187) (-1570.987) [-1572.313] (-1569.089) * (-1572.910) (-1569.841) (-1573.648) [-1571.927] -- 0:00:08
959000 -- (-1573.398) (-1568.203) [-1572.469] (-1575.465) * (-1576.248) [-1572.469] (-1566.366) (-1585.344) -- 0:00:08
959500 -- [-1569.419] (-1571.810) (-1571.366) (-1577.238) * (-1569.258) [-1575.373] (-1574.143) (-1569.166) -- 0:00:08
960000 -- (-1579.216) [-1578.706] (-1580.843) (-1578.791) * (-1582.463) (-1573.419) [-1569.061] (-1574.420) -- 0:00:08
Average standard deviation of split frequencies: 0.006052
960500 -- [-1573.119] (-1569.467) (-1570.560) (-1578.804) * (-1571.302) (-1570.146) [-1573.355] (-1572.877) -- 0:00:08
961000 -- [-1566.231] (-1575.084) (-1579.692) (-1572.744) * (-1571.382) (-1571.035) (-1569.997) [-1572.004] -- 0:00:08
961500 -- (-1575.936) [-1571.072] (-1577.734) (-1572.079) * (-1579.409) (-1567.548) [-1566.576] (-1572.410) -- 0:00:08
962000 -- (-1572.666) [-1565.741] (-1566.111) (-1572.534) * (-1568.348) (-1573.942) [-1569.317] (-1569.374) -- 0:00:07
962500 -- [-1569.851] (-1571.982) (-1575.329) (-1568.705) * (-1568.378) (-1569.975) (-1574.752) [-1570.074] -- 0:00:07
963000 -- [-1569.340] (-1576.884) (-1568.878) (-1570.857) * (-1565.589) (-1570.214) (-1573.922) [-1574.027] -- 0:00:07
963500 -- [-1573.581] (-1570.049) (-1572.892) (-1570.975) * [-1567.790] (-1575.739) (-1573.389) (-1581.192) -- 0:00:07
964000 -- [-1565.203] (-1570.562) (-1577.017) (-1574.732) * (-1568.618) (-1575.461) (-1576.713) [-1576.081] -- 0:00:07
964500 -- (-1572.502) (-1576.804) [-1566.882] (-1569.927) * [-1569.925] (-1571.350) (-1577.503) (-1568.649) -- 0:00:07
965000 -- (-1572.637) (-1568.242) [-1572.659] (-1569.303) * (-1572.472) (-1574.552) [-1567.833] (-1573.831) -- 0:00:07
Average standard deviation of split frequencies: 0.006669
965500 -- (-1575.301) [-1568.397] (-1567.209) (-1569.599) * [-1570.101] (-1571.493) (-1566.851) (-1573.047) -- 0:00:07
966000 -- (-1568.623) (-1574.574) [-1567.271] (-1574.779) * (-1573.033) [-1571.512] (-1568.491) (-1576.728) -- 0:00:07
966500 -- [-1570.998] (-1581.088) (-1570.714) (-1570.891) * (-1575.688) [-1568.028] (-1570.940) (-1586.491) -- 0:00:06
967000 -- (-1572.298) (-1585.085) [-1570.053] (-1571.415) * (-1577.857) (-1566.848) [-1571.456] (-1572.684) -- 0:00:06
967500 -- (-1576.446) (-1575.930) [-1566.710] (-1571.416) * (-1574.708) (-1569.163) [-1573.463] (-1573.516) -- 0:00:06
968000 -- (-1568.908) (-1575.329) [-1568.291] (-1570.292) * (-1572.223) [-1569.305] (-1569.669) (-1579.386) -- 0:00:06
968500 -- [-1572.216] (-1576.717) (-1573.480) (-1572.376) * (-1569.004) [-1574.188] (-1576.390) (-1572.254) -- 0:00:06
969000 -- [-1572.093] (-1573.235) (-1576.360) (-1573.516) * [-1572.832] (-1579.733) (-1568.154) (-1574.995) -- 0:00:06
969500 -- [-1566.019] (-1570.332) (-1574.719) (-1569.555) * [-1576.965] (-1573.465) (-1568.913) (-1569.663) -- 0:00:06
970000 -- [-1564.185] (-1571.085) (-1573.954) (-1569.927) * (-1571.495) (-1580.928) (-1576.338) [-1566.794] -- 0:00:06
Average standard deviation of split frequencies: 0.006880
970500 -- (-1566.469) (-1571.623) (-1566.601) [-1566.181] * (-1576.178) (-1577.078) (-1573.550) [-1566.379] -- 0:00:06
971000 -- (-1574.793) (-1576.304) (-1585.001) [-1568.589] * (-1570.249) (-1574.508) (-1570.561) [-1574.439] -- 0:00:06
971500 -- [-1575.435] (-1574.330) (-1569.070) (-1562.872) * (-1569.217) [-1575.911] (-1568.868) (-1572.857) -- 0:00:05
972000 -- (-1571.008) (-1571.652) (-1573.791) [-1570.503] * (-1572.122) [-1575.414] (-1569.972) (-1565.071) -- 0:00:05
972500 -- (-1571.936) (-1573.886) [-1569.686] (-1570.838) * (-1567.973) (-1574.162) (-1570.941) [-1568.086] -- 0:00:05
973000 -- (-1582.221) (-1572.256) (-1573.995) [-1562.795] * (-1575.963) (-1570.232) (-1572.371) [-1577.207] -- 0:00:05
973500 -- (-1567.248) (-1577.438) [-1562.390] (-1570.664) * (-1583.786) (-1565.449) (-1566.947) [-1574.109] -- 0:00:05
974000 -- (-1564.165) [-1569.533] (-1577.819) (-1577.502) * (-1578.616) (-1575.872) (-1566.410) [-1568.703] -- 0:00:05
974500 -- (-1572.876) (-1569.997) [-1579.918] (-1570.170) * (-1573.107) (-1572.292) (-1567.014) [-1572.745] -- 0:00:05
975000 -- (-1578.978) (-1598.995) (-1570.964) [-1565.197] * (-1566.250) (-1574.555) (-1565.938) [-1567.392] -- 0:00:05
Average standard deviation of split frequencies: 0.006762
975500 -- [-1565.103] (-1574.226) (-1574.371) (-1572.989) * (-1565.936) (-1571.549) [-1572.683] (-1571.895) -- 0:00:05
976000 -- [-1569.772] (-1587.917) (-1571.374) (-1569.424) * (-1565.117) (-1575.695) [-1573.622] (-1569.619) -- 0:00:04
976500 -- [-1573.666] (-1572.629) (-1573.669) (-1569.350) * [-1568.265] (-1576.688) (-1567.424) (-1578.680) -- 0:00:04
977000 -- (-1577.794) (-1569.846) [-1574.919] (-1563.312) * (-1570.194) (-1574.830) [-1574.582] (-1571.097) -- 0:00:04
977500 -- (-1571.247) (-1570.662) (-1577.979) [-1569.203] * (-1574.864) (-1577.254) [-1565.680] (-1566.354) -- 0:00:04
978000 -- (-1579.369) (-1564.096) (-1579.825) [-1571.321] * [-1576.063] (-1572.509) (-1566.476) (-1575.214) -- 0:00:04
978500 -- (-1573.064) (-1583.747) (-1567.001) [-1572.049] * (-1583.613) (-1568.873) (-1565.784) [-1568.345] -- 0:00:04
979000 -- (-1585.134) (-1572.169) [-1568.381] (-1568.344) * [-1570.090] (-1567.661) (-1571.522) (-1570.651) -- 0:00:04
979500 -- (-1571.064) (-1572.986) (-1567.076) [-1569.855] * [-1577.864] (-1573.294) (-1572.278) (-1574.264) -- 0:00:04
980000 -- (-1568.170) (-1568.508) (-1571.157) [-1570.042] * (-1573.350) [-1569.878] (-1577.877) (-1571.496) -- 0:00:04
Average standard deviation of split frequencies: 0.006329
980500 -- [-1573.129] (-1572.612) (-1572.321) (-1571.229) * (-1579.767) [-1569.280] (-1575.204) (-1571.575) -- 0:00:04
981000 -- (-1579.274) (-1568.995) (-1578.042) [-1575.469] * (-1566.719) [-1566.300] (-1576.180) (-1567.472) -- 0:00:03
981500 -- (-1570.560) (-1582.286) (-1570.812) [-1579.292] * (-1576.003) [-1562.559] (-1574.173) (-1567.886) -- 0:00:03
982000 -- (-1564.691) [-1576.174] (-1578.226) (-1573.885) * (-1569.693) (-1568.018) (-1578.295) [-1567.326] -- 0:00:03
982500 -- (-1579.274) (-1568.952) [-1566.871] (-1571.584) * (-1575.394) [-1573.032] (-1580.770) (-1578.130) -- 0:00:03
983000 -- [-1574.641] (-1573.718) (-1569.611) (-1576.128) * [-1570.276] (-1573.767) (-1570.786) (-1579.128) -- 0:00:03
983500 -- (-1572.629) (-1578.800) [-1568.752] (-1580.654) * (-1574.838) (-1564.614) (-1574.495) [-1571.201] -- 0:00:03
984000 -- [-1569.289] (-1565.833) (-1564.743) (-1566.115) * (-1567.942) [-1567.871] (-1577.795) (-1569.616) -- 0:00:03
984500 -- [-1573.315] (-1568.901) (-1566.732) (-1572.772) * (-1568.429) (-1567.433) (-1579.415) [-1570.298] -- 0:00:03
985000 -- (-1565.021) (-1570.436) [-1568.890] (-1575.291) * (-1569.382) [-1569.919] (-1580.246) (-1580.987) -- 0:00:03
Average standard deviation of split frequencies: 0.006534
985500 -- (-1575.226) [-1573.609] (-1566.087) (-1571.947) * [-1568.864] (-1572.283) (-1572.166) (-1574.075) -- 0:00:03
986000 -- (-1577.919) (-1575.550) (-1569.879) [-1568.520] * (-1577.396) (-1578.859) [-1567.620] (-1580.915) -- 0:00:02
986500 -- (-1570.578) [-1568.612] (-1567.854) (-1573.260) * [-1569.663] (-1569.339) (-1569.414) (-1573.312) -- 0:00:02
987000 -- (-1579.056) (-1567.217) (-1568.840) [-1572.263] * (-1579.975) (-1568.527) [-1570.753] (-1572.756) -- 0:00:02
987500 -- (-1570.417) [-1571.222] (-1570.063) (-1575.110) * (-1578.601) [-1570.645] (-1569.771) (-1572.617) -- 0:00:02
988000 -- (-1578.350) (-1572.360) (-1569.313) [-1574.462] * [-1573.676] (-1573.022) (-1568.478) (-1585.352) -- 0:00:02
988500 -- (-1574.652) [-1565.210] (-1570.539) (-1570.555) * (-1568.965) (-1572.766) (-1569.255) [-1573.924] -- 0:00:02
989000 -- [-1571.216] (-1574.814) (-1574.361) (-1569.016) * (-1566.754) (-1570.811) (-1574.973) [-1567.153] -- 0:00:02
989500 -- [-1574.652] (-1580.898) (-1567.508) (-1569.506) * (-1568.874) (-1574.588) (-1575.491) [-1575.831] -- 0:00:02
990000 -- (-1566.369) [-1569.091] (-1574.360) (-1574.198) * (-1568.686) (-1566.540) (-1574.440) [-1569.807] -- 0:00:02
Average standard deviation of split frequencies: 0.006424
990500 -- (-1567.783) (-1575.351) (-1574.678) [-1569.755] * (-1571.179) (-1570.480) [-1569.471] (-1569.961) -- 0:00:01
991000 -- (-1576.318) (-1567.394) (-1566.439) [-1567.521] * (-1569.289) (-1575.882) [-1569.370] (-1570.568) -- 0:00:01
991500 -- (-1570.434) (-1572.418) [-1570.225] (-1572.309) * (-1570.929) (-1574.210) [-1569.313] (-1570.715) -- 0:00:01
992000 -- (-1574.104) (-1567.980) [-1566.754] (-1571.336) * (-1572.589) (-1571.077) (-1570.100) [-1567.150] -- 0:00:01
992500 -- (-1569.755) (-1570.767) [-1565.755] (-1568.897) * (-1575.082) [-1569.617] (-1570.925) (-1564.583) -- 0:00:01
993000 -- (-1576.861) [-1572.772] (-1567.173) (-1574.932) * (-1573.860) [-1567.970] (-1572.390) (-1577.921) -- 0:00:01
993500 -- (-1570.637) (-1568.810) [-1571.976] (-1574.001) * (-1572.983) (-1573.300) (-1572.649) [-1573.487] -- 0:00:01
994000 -- [-1570.578] (-1568.867) (-1567.789) (-1574.851) * (-1572.615) [-1566.557] (-1576.353) (-1570.651) -- 0:00:01
994500 -- (-1572.538) (-1574.846) (-1568.209) [-1567.377] * (-1580.261) (-1574.418) [-1570.424] (-1579.033) -- 0:00:01
995000 -- (-1574.409) (-1574.637) (-1567.427) [-1571.750] * (-1568.402) (-1580.580) (-1569.383) [-1569.403] -- 0:00:01
Average standard deviation of split frequencies: 0.006390
995500 -- (-1571.076) (-1571.669) (-1570.083) [-1580.334] * (-1568.891) [-1571.185] (-1573.314) (-1576.405) -- 0:00:00
996000 -- (-1565.265) [-1569.414] (-1580.095) (-1573.707) * (-1572.363) (-1571.188) (-1574.377) [-1574.061] -- 0:00:00
996500 -- [-1570.034] (-1575.816) (-1573.935) (-1569.966) * (-1574.299) (-1574.960) (-1568.498) [-1573.050] -- 0:00:00
997000 -- (-1567.730) (-1574.302) [-1570.059] (-1574.356) * (-1566.381) (-1568.948) [-1577.634] (-1566.208) -- 0:00:00
997500 -- (-1566.858) (-1568.438) [-1567.469] (-1572.346) * (-1569.218) [-1571.628] (-1573.400) (-1574.682) -- 0:00:00
998000 -- [-1571.289] (-1569.587) (-1574.443) (-1570.715) * (-1569.553) (-1575.941) [-1576.854] (-1572.400) -- 0:00:00
998500 -- (-1572.245) [-1573.138] (-1575.310) (-1569.587) * (-1567.282) [-1566.961] (-1576.984) (-1567.103) -- 0:00:00
999000 -- (-1579.515) (-1569.196) [-1569.609] (-1574.657) * [-1565.573] (-1569.642) (-1578.241) (-1566.590) -- 0:00:00
999500 -- (-1575.422) (-1574.502) [-1571.072] (-1576.931) * (-1568.441) (-1574.738) [-1574.556] (-1573.039) -- 0:00:00
1000000 -- [-1570.749] (-1571.666) (-1567.331) (-1571.576) * (-1569.631) (-1574.214) (-1577.458) [-1573.507] -- 0:00:00
Average standard deviation of split frequencies: 0.006438
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1570.748843 -- 15.753252
Chain 1 -- -1570.748848 -- 15.753252
Chain 2 -- -1571.665933 -- 16.406328
Chain 2 -- -1571.665940 -- 16.406328
Chain 3 -- -1567.331268 -- 12.697659
Chain 3 -- -1567.331270 -- 12.697659
Chain 4 -- -1571.575552 -- 13.739744
Chain 4 -- -1571.575551 -- 13.739744
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1569.630664 -- 13.625764
Chain 1 -- -1569.630663 -- 13.625764
Chain 2 -- -1574.213739 -- 13.977783
Chain 2 -- -1574.213738 -- 13.977783
Chain 3 -- -1577.457817 -- 13.086504
Chain 3 -- -1577.457815 -- 13.086504
Chain 4 -- -1573.506651 -- 13.178957
Chain 4 -- -1573.506649 -- 13.178957
Analysis completed in 3 mins 28 seconds
Analysis used 207.54 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1561.09
Likelihood of best state for "cold" chain of run 2 was -1561.09
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
56.2 % ( 49 %) Dirichlet(Revmat{all})
71.4 % ( 63 %) Slider(Revmat{all})
27.1 % ( 24 %) Dirichlet(Pi{all})
29.3 % ( 30 %) Slider(Pi{all})
40.7 % ( 27 %) Multiplier(Alpha{1,2})
47.4 % ( 25 %) Multiplier(Alpha{3})
52.1 % ( 27 %) Slider(Pinvar{all})
18.1 % ( 15 %) ExtSPR(Tau{all},V{all})
7.7 % ( 10 %) ExtTBR(Tau{all},V{all})
19.1 % ( 15 %) NNI(Tau{all},V{all})
18.2 % ( 20 %) ParsSPR(Tau{all},V{all})
26.5 % ( 22 %) Multiplier(V{all})
39.2 % ( 40 %) Nodeslider(V{all})
25.6 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
55.6 % ( 54 %) Dirichlet(Revmat{all})
70.8 % ( 56 %) Slider(Revmat{all})
26.9 % ( 24 %) Dirichlet(Pi{all})
28.6 % ( 18 %) Slider(Pi{all})
40.2 % ( 21 %) Multiplier(Alpha{1,2})
47.6 % ( 27 %) Multiplier(Alpha{3})
52.5 % ( 26 %) Slider(Pinvar{all})
18.2 % ( 21 %) ExtSPR(Tau{all},V{all})
7.8 % ( 13 %) ExtTBR(Tau{all},V{all})
19.2 % ( 18 %) NNI(Tau{all},V{all})
18.4 % ( 27 %) ParsSPR(Tau{all},V{all})
26.5 % ( 19 %) Multiplier(V{all})
39.3 % ( 41 %) Nodeslider(V{all})
25.7 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166598 0.82 0.66
3 | 167212 166861 0.83
4 | 166924 165882 166523
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166663 0.82 0.66
3 | 166507 166716 0.83
4 | 167300 166496 166318
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1568.50
| 2 |
| |
| 1 |
| 1 2 |
| 2 2 2 2 1 |
| 11 2 1 12 2 2 |
| 1 1 2 2 1 1 1 * 2 |
| 2 * 1 2 1 2 2 2 21 |
|21 221 2 1 *1 1 * *1 1 *11 2 1 1 2 1|
| 22 21 1 21 2 2 11 1 2 1 21 2 2 1 |
| 2 2 2 22 2 2 2 1 |
| 11 22 212 1 1 * 1 12|
|1 1 21 2 11 |
| 1 2 1 2 |
| 12 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1572.01
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1566.80 -1577.28
2 -1567.01 -1576.49
--------------------------------------
TOTAL -1566.90 -1576.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.706752 0.016810 0.478873 0.971231 0.692624 986.17 1036.44 1.000
r(A<->C){all} 0.069834 0.000890 0.020878 0.134702 0.066466 756.73 771.81 1.001
r(A<->G){all} 0.186193 0.002422 0.098272 0.282881 0.181994 654.59 691.76 1.000
r(A<->T){all} 0.070334 0.002049 0.000042 0.154521 0.063758 470.83 556.89 1.000
r(C<->G){all} 0.059906 0.000552 0.016792 0.105600 0.057813 615.13 730.67 1.001
r(C<->T){all} 0.496880 0.004946 0.364222 0.630053 0.497758 654.17 734.86 1.000
r(G<->T){all} 0.116852 0.001566 0.046636 0.197452 0.113309 864.31 889.80 1.000
pi(A){all} 0.231597 0.000260 0.200752 0.263432 0.231553 1222.24 1285.31 1.000
pi(C){all} 0.295902 0.000306 0.262798 0.330867 0.295252 981.73 992.38 1.000
pi(G){all} 0.316560 0.000321 0.281715 0.351506 0.315815 754.23 981.55 1.000
pi(T){all} 0.155941 0.000188 0.131238 0.184362 0.155600 834.51 925.97 1.000
alpha{1,2} 0.109005 0.001536 0.013855 0.178348 0.110496 893.76 899.40 1.000
alpha{3} 1.879653 0.549239 0.636073 3.330932 1.770550 1170.37 1184.78 1.000
pinvar{all} 0.468581 0.005955 0.316441 0.602830 0.476896 879.89 887.81 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
Key to taxon bipartitions (saved to file "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-------------
1 -- .******
2 -- .*.....
3 -- ..*....
4 -- ...*...
5 -- ....*..
6 -- .....*.
7 -- ......*
8 -- .....**
9 -- ...****
10 -- .**....
11 -- ....***
12 -- ...**..
13 -- ...*.**
-------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
8 3002 1.000000 0.000000 1.000000 1.000000 2
9 2981 0.993005 0.001413 0.992005 0.994004 2
10 2783 0.927049 0.005182 0.923384 0.930713 2
11 1183 0.394071 0.012719 0.385077 0.403065 2
12 1124 0.374417 0.016017 0.363091 0.385743 2
13 695 0.231512 0.003298 0.229181 0.233844 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.028869 0.000117 0.011278 0.050483 0.027632 1.000 2
length{all}[2] 0.011036 0.000034 0.001714 0.022606 0.009965 1.000 2
length{all}[3] 0.008918 0.000027 0.000916 0.019148 0.007916 1.000 2
length{all}[4] 0.037893 0.000184 0.013780 0.065456 0.036093 1.000 2
length{all}[5] 0.039614 0.000229 0.012506 0.070008 0.038157 1.000 2
length{all}[6] 0.123605 0.002224 0.037105 0.217781 0.117924 1.000 2
length{all}[7] 0.179759 0.002976 0.084472 0.286137 0.173056 1.000 2
length{all}[8] 0.217592 0.004538 0.095755 0.347927 0.208918 1.000 2
length{all}[9] 0.037997 0.000252 0.008493 0.069671 0.036326 1.000 2
length{all}[10] 0.009999 0.000041 0.000360 0.022660 0.008779 1.000 2
length{all}[11] 0.011672 0.000095 0.000019 0.029998 0.009083 1.003 2
length{all}[12] 0.014379 0.000157 0.000014 0.038136 0.011274 1.000 2
length{all}[13] 0.009125 0.000078 0.000011 0.025275 0.006635 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006438
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------------------ C4 (4)
| |
| |------------------------------------------------ C5 (5)
|-----------99----------+
+ | /------------------------ C6 (6)
| \----------100----------+
| \------------------------ C7 (7)
|
| /------------------------ C2 (2)
\-----------------------93----------------------+
\------------------------ C3 (3)
Phylogram (based on average branch lengths):
/----- C1 (1)
|
| /------ C4 (4)
| |
| |------- C5 (5)
|-----+
+ | /--------------------- C6 (6)
| \-----------------------------------+
| \------------------------------ C7 (7)
|
| /- C2 (2)
\-+
\- C3 (3)
|-------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (12 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 3 trees
95 % credible set contains 5 trees
99 % credible set contains 9 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 7 ls = 603
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Sites with gaps or missing data are removed.
3 ambiguity characters in seq. 4
3 ambiguity characters in seq. 5
1 sites are removed. 201
Sequences read..
Counting site patterns.. 0:00
124 patterns at 200 / 200 sites (100.0%), 0:00
Counting codons..
168 bytes for distance
121024 bytes for conP
16864 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, 5, (6, 7)), (2, 3)); MP score: 143
242048 bytes for conP, adjusted
0.040235 0.040038 0.080326 0.078804 0.180618 0.163291 0.197704 0.016821 0.019285 0.011136 0.300000 1.300000
ntime & nrate & np: 10 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 12
lnL0 = -1726.950021
Iterating by ming2
Initial: fx= 1726.950021
x= 0.04023 0.04004 0.08033 0.07880 0.18062 0.16329 0.19770 0.01682 0.01929 0.01114 0.30000 1.30000
1 h-m-p 0.0000 0.0008 213.8492 +++YYCYCCC 1708.465373 6 0.0007 29 | 0/12
2 h-m-p 0.0000 0.0001 3631.8330 +YCC 1692.788016 2 0.0001 48 | 0/12
3 h-m-p 0.0001 0.0006 737.9818 +YYYYC 1677.791205 4 0.0005 68 | 0/12
4 h-m-p 0.0000 0.0002 431.0115 +CYYCC 1669.849836 4 0.0002 90 | 0/12
5 h-m-p 0.0000 0.0001 4053.7398 +YYCCCCC 1652.545009 6 0.0000 116 | 0/12
6 h-m-p 0.0000 0.0002 1362.9209 +YYYCYCCCC 1627.230447 8 0.0002 144 | 0/12
7 h-m-p 0.0006 0.0030 250.7164 +YYYCYCYCCC 1523.418288 9 0.0028 174 | 0/12
8 h-m-p 0.0001 0.0007 106.7270 YCCC 1523.101057 3 0.0001 194 | 0/12
9 h-m-p 0.0005 0.0186 19.7985 YCCC 1522.883607 3 0.0011 214 | 0/12
10 h-m-p 0.0042 0.0692 4.9480 CCC 1522.598461 2 0.0067 233 | 0/12
11 h-m-p 0.0058 0.0402 5.6619 YCCCC 1520.816890 4 0.0130 255 | 0/12
12 h-m-p 0.0043 0.0217 15.9989 YCYCCC 1513.914202 5 0.0109 278 | 0/12
13 h-m-p 0.0016 0.0080 30.1972 YCC 1513.350763 2 0.0012 296 | 0/12
14 h-m-p 0.0605 0.3024 0.5736 YCCCCC 1509.067914 5 0.1332 320 | 0/12
15 h-m-p 0.3560 1.7799 0.1132 YCCCC 1502.458653 4 0.8134 354 | 0/12
16 h-m-p 0.1521 0.7606 0.1340 +YYCCCC 1497.662811 5 0.5269 390 | 0/12
17 h-m-p 0.2200 1.0998 0.0649 +YCYCCC 1495.946517 5 0.6547 426 | 0/12
18 h-m-p 0.1715 0.8574 0.1820 CCCCC 1494.695831 4 0.2471 461 | 0/12
19 h-m-p 0.7876 8.0000 0.0571 +YCCC 1492.569591 3 5.0451 494 | 0/12
20 h-m-p 1.2455 6.2274 0.1178 CCCC 1491.486150 3 1.6436 527 | 0/12
21 h-m-p 1.6000 8.0000 0.0545 CYC 1491.175155 2 1.8297 557 | 0/12
22 h-m-p 1.6000 8.0000 0.0297 CCC 1490.976659 2 2.2471 588 | 0/12
23 h-m-p 1.6000 8.0000 0.0093 CCC 1490.833894 2 2.5804 619 | 0/12
24 h-m-p 0.5177 8.0000 0.0464 +CCC 1490.771019 2 1.9429 651 | 0/12
25 h-m-p 1.6000 8.0000 0.0119 CC 1490.749242 1 2.2803 680 | 0/12
26 h-m-p 1.6000 8.0000 0.0031 CC 1490.746592 1 1.4764 709 | 0/12
27 h-m-p 1.6000 8.0000 0.0020 CC 1490.746133 1 2.3216 738 | 0/12
28 h-m-p 1.6000 8.0000 0.0014 CC 1490.745929 1 2.2199 767 | 0/12
29 h-m-p 1.6000 8.0000 0.0004 C 1490.745906 0 1.6346 794 | 0/12
30 h-m-p 1.6000 8.0000 0.0002 C 1490.745899 0 2.3555 821 | 0/12
31 h-m-p 1.6000 8.0000 0.0001 Y 1490.745895 0 2.9470 848 | 0/12
32 h-m-p 1.6000 8.0000 0.0000 C 1490.745894 0 1.6054 875 | 0/12
33 h-m-p 1.6000 8.0000 0.0000 Y 1490.745894 0 1.0915 902 | 0/12
34 h-m-p 1.6000 8.0000 0.0000 C 1490.745894 0 1.6000 929 | 0/12
35 h-m-p 1.6000 8.0000 0.0000 ------------Y 1490.745894 0 0.0000 968
Out..
lnL = -1490.745894
969 lfun, 969 eigenQcodon, 9690 P(t)
Time used: 0:03
Model 1: NearlyNeutral
TREE # 1
(1, (4, 5, (6, 7)), (2, 3)); MP score: 143
0.040235 0.040038 0.080326 0.078804 0.180618 0.163291 0.197704 0.016821 0.019285 0.011136 2.280943 0.877411 0.315445
ntime & nrate & np: 10 2 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 7.423790
np = 13
lnL0 = -1550.188989
Iterating by ming2
Initial: fx= 1550.188989
x= 0.04023 0.04004 0.08033 0.07880 0.18062 0.16329 0.19770 0.01682 0.01929 0.01114 2.28094 0.87741 0.31544
1 h-m-p 0.0000 0.0013 222.6680 ++++ 1504.645006 m 0.0013 20 | 0/13
2 h-m-p 0.0000 0.0000 9598.9837 YCYCCC 1500.632899 5 0.0000 44 | 0/13
3 h-m-p 0.0000 0.0001 472.0206 YCCCC 1498.555864 4 0.0000 67 | 0/13
4 h-m-p 0.0000 0.0002 160.2295 CCCCC 1498.013051 4 0.0001 91 | 0/13
5 h-m-p 0.0001 0.0089 78.4351 +YCCC 1497.397750 3 0.0003 113 | 0/13
6 h-m-p 0.0003 0.0015 76.1550 YCYCCC 1496.007285 5 0.0008 137 | 0/13
7 h-m-p 0.0023 0.0114 11.4712 YCC 1495.926519 2 0.0011 156 | 0/13
8 h-m-p 0.0025 0.0235 5.1586 YCC 1495.894532 2 0.0015 175 | 0/13
9 h-m-p 0.0010 0.0375 7.5716 +CCC 1495.697224 2 0.0051 196 | 0/13
10 h-m-p 0.0023 0.0567 17.1225 +CCCC 1494.450397 3 0.0121 219 | 0/13
11 h-m-p 0.0014 0.0082 147.9941 CCC 1493.014698 2 0.0017 239 | 0/13
12 h-m-p 0.0014 0.0069 181.7571 +YYYCCC 1486.498751 5 0.0049 263 | 0/13
13 h-m-p 0.0406 0.2031 2.6544 CC 1486.372878 1 0.0132 281 | 0/13
14 h-m-p 0.0041 0.1465 8.4378 ++YYYC 1484.199854 3 0.0614 302 | 0/13
15 h-m-p 0.2425 1.4510 2.1367 CYCCCC 1481.816067 5 0.3830 327 | 0/13
16 h-m-p 1.4248 7.1241 0.0573 YCCC 1481.113251 3 0.6513 348 | 0/13
17 h-m-p 0.1722 2.3394 0.2168 +YYCCCC 1480.772948 5 0.7410 386 | 0/13
18 h-m-p 1.5929 7.9647 0.0366 YCCC 1480.520570 3 1.0540 420 | 0/13
19 h-m-p 0.1410 7.3975 0.2738 +YC 1480.404892 1 0.4445 451 | 0/13
20 h-m-p 1.6000 8.0000 0.0342 CCC 1480.361672 2 1.8943 484 | 0/13
21 h-m-p 1.6000 8.0000 0.0112 YC 1480.333364 1 2.8224 514 | 0/13
22 h-m-p 1.6000 8.0000 0.0068 CC 1480.318921 1 1.4088 545 | 0/13
23 h-m-p 0.9588 8.0000 0.0101 CC 1480.314429 1 1.4603 576 | 0/13
24 h-m-p 1.6000 8.0000 0.0049 C 1480.313305 0 1.5441 605 | 0/13
25 h-m-p 1.6000 8.0000 0.0013 YC 1480.313213 1 1.0435 635 | 0/13
26 h-m-p 1.6000 8.0000 0.0002 Y 1480.313209 0 1.0067 664 | 0/13
27 h-m-p 1.6000 8.0000 0.0001 Y 1480.313209 0 1.0637 693 | 0/13
28 h-m-p 1.6000 8.0000 0.0000 Y 1480.313209 0 1.6000 722 | 0/13
29 h-m-p 1.6000 8.0000 0.0000 C 1480.313209 0 0.5300 751 | 0/13
30 h-m-p 1.5421 8.0000 0.0000 C 1480.313209 0 1.5421 780 | 0/13
31 h-m-p 1.6000 8.0000 0.0000 ----------C 1480.313209 0 0.0000 819
Out..
lnL = -1480.313209
820 lfun, 2460 eigenQcodon, 16400 P(t)
Time used: 0:07
Model 2: PositiveSelection
TREE # 1
(1, (4, 5, (6, 7)), (2, 3)); MP score: 143
initial w for M2:NSpselection reset.
0.040235 0.040038 0.080326 0.078804 0.180618 0.163291 0.197704 0.016821 0.019285 0.011136 2.406010 1.591876 0.136540 0.318247 2.382499
ntime & nrate & np: 10 3 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.641276
np = 15
lnL0 = -1578.029430
Iterating by ming2
Initial: fx= 1578.029430
x= 0.04023 0.04004 0.08033 0.07880 0.18062 0.16329 0.19770 0.01682 0.01929 0.01114 2.40601 1.59188 0.13654 0.31825 2.38250
1 h-m-p 0.0000 0.0026 209.1250 ++++YYYCYCCC 1533.962039 7 0.0024 35 | 0/15
2 h-m-p 0.0000 0.0002 176.4376 YCCCC 1532.932641 4 0.0001 60 | 0/15
3 h-m-p 0.0001 0.0009 163.7940 ++ 1524.817614 m 0.0009 78 | 0/15
4 h-m-p 0.0004 0.0022 218.0529 YCCC 1519.060070 3 0.0010 101 | 0/15
5 h-m-p 0.0005 0.0026 95.5349 YYCCC 1517.825224 4 0.0007 125 | 0/15
6 h-m-p 0.0023 0.0144 28.9212 YCCCCC 1515.981049 5 0.0049 152 | 0/15
7 h-m-p 0.0037 0.0186 37.8724 CCCCC 1513.823597 4 0.0063 178 | 0/15
8 h-m-p 0.0021 0.0105 25.6386 CCCC 1513.171681 3 0.0038 202 | 0/15
9 h-m-p 0.0036 0.0458 26.9292 CYC 1512.589093 2 0.0043 223 | 0/15
10 h-m-p 0.0067 0.0337 11.8979 YCC 1512.363176 2 0.0045 244 | 0/15
11 h-m-p 0.0071 0.0725 7.5368 YCCC 1511.946376 3 0.0138 267 | 0/15
12 h-m-p 0.0098 0.5201 10.6072 ++YCYCCC 1495.154707 5 0.3488 296 | 0/15
13 h-m-p 0.1272 0.6360 2.0007 CCCCC 1493.245718 4 0.1667 322 | 0/15
14 h-m-p 0.0141 0.0703 17.5250 YCYCCC 1488.616381 5 0.0366 348 | 0/15
15 h-m-p 0.0539 0.2694 3.2003 YCYCCC 1486.042754 5 0.1170 374 | 0/15
16 h-m-p 0.2649 1.3243 0.4211 YCCCC 1484.354057 4 0.5410 399 | 0/15
17 h-m-p 0.2302 5.9416 0.9896 YCCC 1483.276505 3 0.5581 437 | 0/15
18 h-m-p 0.2110 1.0551 1.9295 CCCCC 1482.760520 4 0.2548 478 | 0/15
19 h-m-p 0.4141 2.5128 1.1871 YCC 1482.166023 2 0.6856 499 | 0/15
20 h-m-p 0.5034 3.1391 1.6170 CCC 1481.504846 2 0.6400 521 | 0/15
21 h-m-p 0.7568 3.7841 1.2463 YCCC 1481.199951 3 0.4904 544 | 0/15
22 h-m-p 0.4616 4.0885 1.3239 CCC 1480.897676 2 0.4987 566 | 0/15
23 h-m-p 0.6714 3.6509 0.9834 YC 1480.789658 1 0.3285 585 | 0/15
24 h-m-p 0.2352 2.6304 1.3732 CCC 1480.700169 2 0.3203 622 | 0/15
25 h-m-p 0.3337 4.7949 1.3179 YC 1480.599884 1 0.5653 641 | 0/15
26 h-m-p 0.5451 8.0000 1.3668 CCC 1480.492019 2 0.7731 663 | 0/15
27 h-m-p 0.9509 8.0000 1.1112 CC 1480.423029 1 0.9859 683 | 0/15
28 h-m-p 0.9784 8.0000 1.1198 CC 1480.384461 1 0.8206 703 | 0/15
29 h-m-p 0.8276 8.0000 1.1103 CYC 1480.357015 2 0.8746 724 | 0/15
30 h-m-p 0.9886 8.0000 0.9822 CCC 1480.337879 2 1.4544 746 | 0/15
31 h-m-p 0.8829 8.0000 1.6181 YC 1480.329863 1 0.4980 780 | 0/15
32 h-m-p 0.7184 8.0000 1.1217 YC 1480.322358 1 1.1453 799 | 0/15
33 h-m-p 1.4903 8.0000 0.8620 CC 1480.318250 1 1.5069 819 | 0/15
34 h-m-p 0.8771 8.0000 1.4809 CC 1480.316266 1 0.7515 854 | 0/15
35 h-m-p 1.0745 8.0000 1.0358 CC 1480.314704 1 1.5371 874 | 0/15
36 h-m-p 1.6000 8.0000 0.8274 CC 1480.313863 1 2.1652 894 | 0/15
37 h-m-p 1.6000 8.0000 0.9055 CC 1480.313469 1 2.2786 929 | 0/15
38 h-m-p 1.6000 8.0000 0.8419 C 1480.313322 0 2.2891 962 | 0/15
39 h-m-p 1.6000 8.0000 0.8035 C 1480.313264 0 1.8609 995 | 0/15
40 h-m-p 1.6000 8.0000 0.8638 C 1480.313236 0 1.8248 1028 | 0/15
41 h-m-p 1.6000 8.0000 0.8888 C 1480.313221 0 1.9714 1061 | 0/15
42 h-m-p 1.6000 8.0000 0.8255 C 1480.313214 0 2.1455 1094 | 0/15
43 h-m-p 1.6000 8.0000 0.8164 C 1480.313211 0 2.3457 1127 | 0/15
44 h-m-p 1.6000 8.0000 0.8190 C 1480.313210 0 2.4011 1160 | 0/15
45 h-m-p 1.6000 8.0000 0.8472 C 1480.313209 0 2.5248 1193 | 0/15
46 h-m-p 1.6000 8.0000 0.9254 C 1480.313209 0 2.5589 1226 | 0/15
47 h-m-p 1.6000 8.0000 1.1466 Y 1480.313209 0 2.7644 1259 | 0/15
48 h-m-p 1.0016 8.0000 3.1645 ----Y 1480.313209 0 0.0010 1281 | 0/15
49 h-m-p 0.0160 8.0000 0.3215 --Y 1480.313209 0 0.0003 1301 | 0/15
50 h-m-p 1.0994 8.0000 0.0001 Y 1480.313209 0 0.7171 1334 | 0/15
51 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/15
52 h-m-p 0.0160 8.0000 0.0006 -------Y 1480.313209 0 0.0000 1421
Out..
lnL = -1480.313209
1422 lfun, 5688 eigenQcodon, 42660 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1493.461529 S = -1426.741763 -57.723304
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 124 patterns 0:19
did 20 / 124 patterns 0:19
did 30 / 124 patterns 0:19
did 40 / 124 patterns 0:19
did 50 / 124 patterns 0:19
did 60 / 124 patterns 0:19
did 70 / 124 patterns 0:20
did 80 / 124 patterns 0:20
did 90 / 124 patterns 0:20
did 100 / 124 patterns 0:20
did 110 / 124 patterns 0:20
did 120 / 124 patterns 0:20
did 124 / 124 patterns 0:20
Time used: 0:20
Model 3: discrete
TREE # 1
(1, (4, 5, (6, 7)), (2, 3)); MP score: 143
0.040235 0.040038 0.080326 0.078804 0.180618 0.163291 0.197704 0.016821 0.019285 0.011136 2.406009 0.465673 0.549129 0.027732 0.061724 0.115310
ntime & nrate & np: 10 4 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 17.305322
np = 16
lnL0 = -1489.867956
Iterating by ming2
Initial: fx= 1489.867956
x= 0.04023 0.04004 0.08033 0.07880 0.18062 0.16329 0.19770 0.01682 0.01929 0.01114 2.40601 0.46567 0.54913 0.02773 0.06172 0.11531
1 h-m-p 0.0000 0.0003 165.0680 +++ 1484.389377 m 0.0003 22 | 1/16
2 h-m-p 0.0001 0.0005 146.0782 +YYCCCC 1481.933881 5 0.0003 50 | 1/16
3 h-m-p 0.0000 0.0002 300.4673 ++ 1478.689742 m 0.0002 69 | 1/16
4 h-m-p 0.0000 0.0000 133.2682
h-m-p: 2.08317119e-20 1.04158559e-19 1.33268216e+02 1478.689742
.. | 1/16
5 h-m-p 0.0000 0.0026 167.3555 +YYCCC 1478.012357 4 0.0001 111 | 1/16
6 h-m-p 0.0002 0.0014 56.0130 YCCC 1477.450958 3 0.0004 135 | 1/16
7 h-m-p 0.0001 0.0005 113.3167 YC 1476.954379 1 0.0002 155 | 1/16
8 h-m-p 0.0000 0.0001 54.9543 ++ 1476.804165 m 0.0001 174 | 2/16
9 h-m-p 0.0002 0.0087 43.3477 +CCC 1476.574949 2 0.0006 198 | 2/16
10 h-m-p 0.0011 0.0055 21.2574 YCC 1476.511591 2 0.0005 220 | 2/16
11 h-m-p 0.0053 0.0555 1.8909 -YC 1476.510476 1 0.0006 241 | 2/16
12 h-m-p 0.0022 0.3195 0.5092 +YC 1476.509240 1 0.0054 262 | 2/16
13 h-m-p 0.0019 0.2912 1.4828 CC 1476.507773 1 0.0026 297 | 2/16
14 h-m-p 0.0008 0.2531 4.7367 ++YC 1476.491319 1 0.0093 319 | 2/16
15 h-m-p 0.0050 0.0923 8.7384 YC 1476.478088 1 0.0040 339 | 2/16
16 h-m-p 0.0455 0.4084 0.7776 -C 1476.477424 0 0.0026 359 | 2/16
17 h-m-p 0.0061 2.3608 0.3258 +CC 1476.473256 1 0.0374 395 | 2/16
18 h-m-p 0.0029 0.4427 4.2032 +YC 1476.441029 1 0.0219 430 | 2/16
19 h-m-p 0.3891 3.4214 0.2361 YC 1476.420290 1 0.2546 450 | 1/16
20 h-m-p 0.0130 0.1848 4.6113 --YC 1476.419981 1 0.0001 486 | 1/16
21 h-m-p 0.0471 8.0000 0.0127 ++YC 1476.417413 1 1.4580 508 | 1/16
22 h-m-p 1.2322 8.0000 0.0151 +YC 1476.415147 1 4.0287 544 | 1/16
23 h-m-p 1.6000 8.0000 0.0300 CC 1476.413510 1 1.8148 580 | 1/16
24 h-m-p 1.6000 8.0000 0.0011 Y 1476.413465 0 1.0279 614 | 1/16
25 h-m-p 1.6000 8.0000 0.0003 Y 1476.413464 0 1.1741 648 | 1/16
26 h-m-p 1.4590 8.0000 0.0002 Y 1476.413464 0 2.9985 682 | 1/16
27 h-m-p 1.6000 8.0000 0.0004 ++ 1476.413464 m 8.0000 716 | 1/16
28 h-m-p 0.5591 8.0000 0.0050 +Y 1476.413462 0 4.3117 751 | 1/16
29 h-m-p 0.8690 8.0000 0.0249 Y 1476.413460 0 0.8690 785 | 1/16
30 h-m-p 0.8904 8.0000 0.0243 C 1476.413456 0 0.8904 819 | 0/16
31 h-m-p 0.0118 5.8983 16.7410 --C 1476.413455 0 0.0002 855 | 0/16
32 h-m-p 0.1151 0.5754 0.0087 ++ 1476.413452 m 0.5754 874 | 1/16
33 h-m-p 0.2125 8.0000 0.0234 +Y 1476.413447 0 1.5076 910 | 1/16
34 h-m-p 1.0620 8.0000 0.0333 Y 1476.413445 0 0.5065 944 | 1/16
35 h-m-p 0.1746 8.0000 0.0964 Y 1476.413439 0 0.3551 978 | 0/16
36 h-m-p 0.0135 6.7708 20.2571 --C 1476.413438 0 0.0002 1014 | 0/16
37 h-m-p 0.1284 0.6419 0.0181 ++ 1476.413433 m 0.6419 1033 | 1/16
38 h-m-p 0.2264 8.0000 0.0513 +Y 1476.413427 0 0.9058 1069 | 1/16
39 h-m-p 0.0916 8.0000 0.5066 Y 1476.413420 0 0.0479 1103 | 1/16
40 h-m-p 0.2732 8.0000 0.0888 Y 1476.413418 0 0.1542 1137 | 1/16
41 h-m-p 1.1915 8.0000 0.0115 C 1476.413412 0 1.2990 1171 | 0/16
42 h-m-p 0.0074 3.7126 9.3299 --C 1476.413412 0 0.0002 1207 | 0/16
43 h-m-p 0.1156 0.5781 0.0047 ++ 1476.413410 m 0.5781 1226 | 1/16
44 h-m-p 0.8358 8.0000 0.0033 C 1476.413408 0 0.9677 1261 | 1/16
45 h-m-p 0.1451 8.0000 0.0218 +C 1476.413405 0 0.9185 1296 | 1/16
46 h-m-p 0.6746 8.0000 0.0297 C 1476.413402 0 0.6746 1330 | 0/16
47 h-m-p 0.0054 2.6877 47.7311 -Y 1476.413402 0 0.0002 1365 | 0/16
48 h-m-p 0.2740 1.3699 0.0121 ++ 1476.413395 m 1.3699 1384 | 1/16
49 h-m-p 0.7910 8.0000 0.0210 C 1476.413391 0 0.2368 1419 | 1/16
50 h-m-p 0.1420 8.0000 0.0350 +C 1476.413384 0 0.7780 1454 | 1/16
51 h-m-p 0.4125 8.0000 0.0661 Y 1476.413381 0 0.4125 1488 | 0/16
52 h-m-p 0.0030 1.4849 82.3683 -C 1476.413379 0 0.0002 1523 | 0/16
53 h-m-p 0.9472 4.7361 0.0033 Y 1476.413374 0 1.8724 1542 | 0/16
54 h-m-p 0.1302 8.0000 0.0468 --------C 1476.413374 0 0.0000 1585 | 0/16
55 h-m-p 0.0002 0.1033 0.2988 Y 1476.413374 0 0.0004 1620 | 0/16
56 h-m-p 0.0003 0.0498 0.3686 -----Y 1476.413374 0 0.0000 1660 | 0/16
57 h-m-p 0.0000 0.0058 3.2888 +C 1476.413374 0 0.0000 1696 | 0/16
58 h-m-p 0.2173 8.0000 0.0007 +Y 1476.413374 0 1.5915 1716 | 0/16
59 h-m-p 0.0519 8.0000 0.0218 ---Y 1476.413374 0 0.0002 1754 | 0/16
60 h-m-p 0.0160 8.0000 0.0006 -Y 1476.413374 0 0.0010 1790 | 0/16
61 h-m-p 0.0160 8.0000 0.0003 ------C 1476.413374 0 0.0000 1831
Out..
lnL = -1476.413374
1832 lfun, 7328 eigenQcodon, 54960 P(t)
Time used: 0:34
Model 7: beta
TREE # 1
(1, (4, 5, (6, 7)), (2, 3)); MP score: 143
0.040235 0.040038 0.080326 0.078804 0.180618 0.163291 0.197704 0.016821 0.019285 0.011136 2.349591 0.702842 1.818396
ntime & nrate & np: 10 1 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 9.275973
np = 13
lnL0 = -1521.116832
Iterating by ming2
Initial: fx= 1521.116832
x= 0.04023 0.04004 0.08033 0.07880 0.18062 0.16329 0.19770 0.01682 0.01929 0.01114 2.34959 0.70284 1.81840
1 h-m-p 0.0000 0.0108 152.2456 +++YCCCC 1517.789863 4 0.0004 28 | 0/13
2 h-m-p 0.0001 0.0007 149.2417 +YYCYCC 1513.629210 5 0.0005 52 | 0/13
3 h-m-p 0.0001 0.0005 296.8771 +CYCCC 1507.231381 4 0.0004 76 | 0/13
4 h-m-p 0.0000 0.0002 3358.2003 +YCYCCC 1489.138279 5 0.0001 101 | 0/13
5 h-m-p 0.0001 0.0004 543.6266 CYCCC 1486.618497 4 0.0001 124 | 0/13
6 h-m-p 0.0007 0.0033 28.1595 CCCC 1486.305068 3 0.0008 146 | 0/13
7 h-m-p 0.0008 0.0055 30.7542 YCC 1486.155904 2 0.0006 165 | 0/13
8 h-m-p 0.0006 0.0107 28.3843 +YYCC 1485.712779 3 0.0022 186 | 0/13
9 h-m-p 0.0020 0.0154 32.3738 CCC 1485.162097 2 0.0030 206 | 0/13
10 h-m-p 0.0031 0.0155 28.6753 CCCCC 1484.616072 4 0.0037 230 | 0/13
11 h-m-p 0.0008 0.0100 124.8322 +CCCCC 1481.664855 4 0.0042 255 | 0/13
12 h-m-p 0.0091 0.0453 8.6827 CCC 1481.567961 2 0.0035 275 | 0/13
13 h-m-p 0.0988 2.6991 0.3105 ++YCCCC 1477.939546 4 1.0487 300 | 0/13
14 h-m-p 0.3822 2.9026 0.8519 CCC 1477.588926 2 0.3079 333 | 0/13
15 h-m-p 0.5892 6.2005 0.4452 YYC 1477.382591 2 0.4950 364 | 0/13
16 h-m-p 1.1755 8.0000 0.1874 YCCC 1477.012837 3 2.2149 398 | 0/13
17 h-m-p 1.3337 7.5999 0.3113 CCYC 1476.742689 3 1.3143 432 | 0/13
18 h-m-p 1.6000 8.0000 0.1501 YC 1476.662048 1 0.9943 462 | 0/13
19 h-m-p 0.8227 7.4898 0.1814 CYC 1476.601868 2 0.7136 494 | 0/13
20 h-m-p 1.6000 8.0000 0.0197 CCC 1476.571500 2 1.3916 527 | 0/13
21 h-m-p 1.6000 8.0000 0.0072 YC 1476.550259 1 2.9769 557 | 0/13
22 h-m-p 0.3236 8.0000 0.0662 +YC 1476.537828 1 1.1090 588 | 0/13
23 h-m-p 1.6000 8.0000 0.0254 YC 1476.535921 1 0.8458 618 | 0/13
24 h-m-p 1.6000 8.0000 0.0077 YC 1476.535766 1 0.7097 648 | 0/13
25 h-m-p 1.6000 8.0000 0.0006 Y 1476.535763 0 0.9138 677 | 0/13
26 h-m-p 1.6000 8.0000 0.0001 Y 1476.535763 0 0.7332 706 | 0/13
27 h-m-p 1.6000 8.0000 0.0000 Y 1476.535763 0 1.0621 735 | 0/13
28 h-m-p 1.6000 8.0000 0.0000 Y 1476.535763 0 0.4000 764 | 0/13
29 h-m-p 0.7619 8.0000 0.0000 --------C 1476.535763 0 0.0000 801
Out..
lnL = -1476.535763
802 lfun, 8822 eigenQcodon, 80200 P(t)
Time used: 0:55
Model 8: beta&w>1
TREE # 1
(1, (4, 5, (6, 7)), (2, 3)); MP score: 143
initial w for M8:NSbetaw>1 reset.
0.040235 0.040038 0.080326 0.078804 0.180618 0.163291 0.197704 0.016821 0.019285 0.011136 2.349212 0.900000 1.017304 1.339697 2.499728
ntime & nrate & np: 10 2 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.178774
np = 15
lnL0 = -1568.188800
Iterating by ming2
Initial: fx= 1568.188800
x= 0.04023 0.04004 0.08033 0.07880 0.18062 0.16329 0.19770 0.01682 0.01929 0.01114 2.34921 0.90000 1.01730 1.33970 2.49973
1 h-m-p 0.0000 0.0005 256.7633 +++ 1551.611207 m 0.0005 21 | 1/15
2 h-m-p 0.0002 0.0008 112.4867 +YYCCC 1548.551473 4 0.0005 46 | 1/15
3 h-m-p 0.0001 0.0003 289.5941 +YYCCCC 1545.965292 5 0.0002 73 | 1/15
4 h-m-p 0.0002 0.0012 270.8703 ++ 1534.561603 m 0.0012 91 | 1/15
5 h-m-p 0.0000 0.0000 5807.4166 +YCYCCC 1529.510613 5 0.0000 118 | 1/15
6 h-m-p 0.0001 0.0003 2324.6021 +YYCYCCC 1506.769566 6 0.0002 146 | 1/15
7 h-m-p 0.0002 0.0011 208.7063 YYC 1505.833455 2 0.0002 166 | 0/15
8 h-m-p 0.0001 0.0007 411.5860 YYCCC 1501.110557 4 0.0001 190 | 0/15
9 h-m-p 0.0015 0.0095 37.4492 CCC 1499.704167 2 0.0023 212 | 0/15
10 h-m-p 0.0065 0.0367 13.2495 CYC 1499.144845 2 0.0062 233 | 0/15
11 h-m-p 0.0011 0.0054 78.3972 CCCC 1498.348386 3 0.0015 257 | 0/15
12 h-m-p 0.0099 0.1267 12.2095 +YCCC 1496.682612 3 0.0262 281 | 0/15
13 h-m-p 0.1371 0.6857 1.3113 CCCCC 1491.521834 4 0.2478 307 | 0/15
14 h-m-p 0.0091 0.0453 17.9860 CCCCC 1489.328274 4 0.0102 333 | 0/15
15 h-m-p 0.0798 0.8756 2.2923 +CYCCC 1485.527034 4 0.5066 359 | 0/15
16 h-m-p 0.0706 0.3531 2.1353 +CYC 1483.092042 2 0.2951 381 | 0/15
17 h-m-p 0.0160 0.0799 1.6406 ++ 1481.953257 m 0.0799 399 | 1/15
18 h-m-p 0.0393 0.1967 0.5055 ++ 1479.134920 m 0.1967 417 | 1/15
19 h-m-p 0.1246 0.9520 0.7982 +YCCCC 1477.705761 4 0.3361 457 | 1/15
20 h-m-p 0.0291 0.1457 0.7226 ++ 1477.410917 m 0.1457 489 | 1/15
21 h-m-p 1.1688 7.1093 0.0901 YCC 1477.073386 2 0.7658 524 | 1/15
22 h-m-p 0.3797 8.0000 0.1817 YCCC 1476.896843 3 0.8073 561 | 1/15
23 h-m-p 1.1790 8.0000 0.1244 YCC 1476.836308 2 0.7128 596 | 1/15
24 h-m-p 1.1983 8.0000 0.0740 CCC 1476.775695 2 1.4336 632 | 1/15
25 h-m-p 1.2736 8.0000 0.0833 CCC 1476.700586 2 1.5764 668 | 1/15
26 h-m-p 0.8049 4.0244 0.0986 YC 1476.618319 1 1.9291 701 | 1/15
27 h-m-p 0.2304 1.1521 0.0805 ++ 1476.569245 m 1.1521 733 | 2/15
28 h-m-p 1.6000 8.0000 0.0416 YC 1476.556060 1 0.9366 766 | 2/15
29 h-m-p 0.5858 8.0000 0.0665 CC 1476.546467 1 0.7201 799 | 2/15
30 h-m-p 1.6000 8.0000 0.0210 CC 1476.541071 1 1.9407 832 | 2/15
31 h-m-p 1.6000 8.0000 0.0086 C 1476.537401 0 1.6000 863 | 2/15
32 h-m-p 1.6000 8.0000 0.0083 YC 1476.536582 1 1.2021 895 | 2/15
33 h-m-p 1.6000 8.0000 0.0022 C 1476.536467 0 2.2520 926 | 2/15
34 h-m-p 1.6000 8.0000 0.0004 +YC 1476.536212 1 4.9514 959 | 2/15
35 h-m-p 0.7501 8.0000 0.0028 +YC 1476.535901 1 2.4573 992 | 2/15
36 h-m-p 1.6000 8.0000 0.0009 Y 1476.535886 0 1.0836 1023 | 2/15
37 h-m-p 1.6000 8.0000 0.0001 Y 1476.535886 0 1.0209 1054 | 2/15
38 h-m-p 1.6000 8.0000 0.0000 Y 1476.535886 0 1.6000 1085 | 2/15
39 h-m-p 1.6000 8.0000 0.0000 -C 1476.535886 0 0.1000 1117 | 2/15
40 h-m-p 0.0711 8.0000 0.0000 -Y 1476.535886 0 0.0044 1149
Out..
lnL = -1476.535886
1150 lfun, 13800 eigenQcodon, 126500 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1497.732712 S = -1428.968298 -60.301739
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 124 patterns 1:29
did 20 / 124 patterns 1:30
did 30 / 124 patterns 1:30
did 40 / 124 patterns 1:30
did 50 / 124 patterns 1:30
did 60 / 124 patterns 1:30
did 70 / 124 patterns 1:30
did 80 / 124 patterns 1:30
did 90 / 124 patterns 1:31
did 100 / 124 patterns 1:31
did 110 / 124 patterns 1:31
did 120 / 124 patterns 1:31
did 124 / 124 patterns 1:31
Time used: 1:31
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=201
D_melanogaster_CG34424-PA MAATIQNTLKVALRKRMKDALKGIDAEAIARQSQAVTAKVLQSEIFRQAQ
D_sechellia_CG34424-PA MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
D_simulans_CG34424-PA MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ
D_yakuba_CG34424-PA MAATIQNSLKVALRKRIKDALKGIDAEAIARQSQAVTSKVLQSEVFRQAQ
D_erecta_CG34424-PA MAATIQNSLKVALRKRIKDALKSIDPEAIARQSQAVTAKVLQSEIFRHAQ
D_biarmipes_CG34424-PA MAATIQNSLKVALRGRMKDALKGLDAETIARQSRAVTAKVLQSEVFRQAQ
D_elegans_CG34424-PA MAATIQNTLKVALRKRMKDALKNLDTEAIARQSRAVTAKVLQSEFFRQAT
*******:****** *:*****.:*.::*****:***:******.**:*
D_melanogaster_CG34424-PA RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMEEYE
D_sechellia_CG34424-PA RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
D_simulans_CG34424-PA RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
D_yakuba_CG34424-PA RVSIYLSTASELDTTALISEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
D_erecta_CG34424-PA RVSIYLSTTSELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE
D_biarmipes_CG34424-PA RVSIYLSTASELDTTALLLEMFRLEKMVFVPTYEGSKMKMVRLRGMDEYE
D_elegans_CG34424-PA RVSIYLSTASEVDTTALLCEMFRLEKMVFVPTYEGTKMKMVRLRGMDEYE
********:**:*****: ****************::*********:***
D_melanogaster_CG34424-PA SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
D_sechellia_CG34424-PA SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
D_simulans_CG34424-PA SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
D_yakuba_CG34424-PA SLPPTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
D_erecta_CG34424-PA SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG
D_biarmipes_CG34424-PA SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGGRMGHGMG
D_elegans_CG34424-PA SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRTGARMGHGMG
*** ************************************ *.*******
D_melanogaster_CG34424-PA YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
D_sechellia_CG34424-PA YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNKELPMESHDVRLHGVITE
D_simulans_CG34424-PA YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
D_yakuba_CG34424-PA YYDKFLKQHADKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE
D_erecta_CG34424-PA YYDKFLKQHAEKYPHKKISLMALSLNEQIVNNEELPMESHDVRLHSVITE
D_biarmipes_CG34424-PA YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMESHDVRLHSVITE
D_elegans_CG34424-PA YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMETHDVRLHSVITE
**********:************:******.*:*****:******.****
D_melanogaster_CG34424-PA N
D_sechellia_CG34424-PA N
D_simulans_CG34424-PA N
D_yakuba_CG34424-PA o
D_erecta_CG34424-PA o
D_biarmipes_CG34424-PA N
D_elegans_CG34424-PA N
>D_melanogaster_CG34424-PA ATGGCGGCCACGATCCAGAACACCCTGAAGGTGGCGCTGCGAAAGCGCAT GAAGGATGCACTGAAGGGCATCGACGCGGAGGCCATCGCCCGGCAGTCGC AGGCCGTCACGGCTAAGGTGCTGCAAAGCGAGATCTTCCGGCAGGCGCAG CGGGTGAGCATTTACCTGAGCACAGCCTCGGAGCTGGACACCACGGCGCT GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTTGTGCCCACCTACG AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGAGGAGTACGAG AGCCTGCCTCTGACCAAGTGGAACATAAAGCAGCCGGACTTCAAGGAGGC ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATTGTGC CCGGTGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA GATCTCGCTGATGGCACTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG AGTTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA AAC >D_sechellia_CG34424-PA ATGGCGGCCACGATCCAGAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT GAAGGATGCACTGAAGGGCATCGACGCGGATGCCATCGCCCGGCAGTCGC ATGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGTCAGGCGCAG CGGGTGAGCATTTACCTGAGCACCGCCTCGGAGCTGGACACCACGGCGCT GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGACGAGTACGAG AGCCTGCCTCTGACCAAGTGGAACATTAAGCAGCCGGACTTCAAGGAGGC ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATCGTGC CCGGCGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACAAGG AGTTGCCCATGGAGTCGCACGACGTCCGTTTGCACGGTGTAATTACGGAA AAC >D_simulans_CG34424-PA ATGGCGGCCACGATCCAGAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT GAAGGATGCACTGAAGGGCATCGACGCGGATGCCATCGCCCGGCAGTCGC ATGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGGCAGGCGCAG CGGGTGAGCATTTACCTGAGCACCGCCTCGGAGCTGGACACCACAGCGCT GCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG AGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGGACGAGTACGAG AGCCTGCCTCTGACCAAGTGGAACATTAAGCAGCCGGACTTTAAGGAGGC ACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCTCTTCATCGTGC CCGGCGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGCATGGGC TACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA AAC >D_yakuba_CG34424-PA ATGGCAGCCACGATCCAAAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT TAAGGATGCACTGAAGGGCATCGACGCGGAGGCCATCGCTCGGCAGTCGC AGGCCGTCACTTCCAAGGTGCTGCAAAGCGAGGTCTTCCGGCAGGCCCAG CGGGTGAGCATTTACCTGAGCACCGCCTCCGAGTTGGACACCACGGCGCT GATTTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG AGGGCAGCAGGATGAAGATGGTGCGACTGCGCGGCATGGACGAGTACGAG AGCCTGCCCCCGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC GCGCGAAGATGCCATGACCAATGGGCACGGCATCGATCTCTTCATCGTGC CCGGAGTAGCCTTCACCCGCTGCGGAGCTCGGATGGGCCATGGAATGGGC TACTACGACAAGTTCCTCAAGCAGCACGCGGATAAGTATCCGCACAAGAA GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAGCAACGAGG AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA --- >D_erecta_CG34424-PA ATGGCGGCCACGATCCAAAACAGCCTGAAGGTGGCGCTGCGAAAGCGCAT AAAGGATGCACTGAAGAGCATCGACCCGGAGGCTATCGCCCGGCAATCCC AGGCCGTCACGGCCAAGGTGCTGCAAAGCGAGATCTTCCGGCATGCGCAG CGGGTGAGCATTTACCTGAGCACCACCTCCGAGCTGGACACCACGGCGCT GCTTTCGGAGATGTTCCGCCTGGAGAAGATGGTATTCGTGCCCACCTACG AGGGCAGCAGGATGAAGATGGTGCGACTGCGCGGCATGGACGAGTACGAG AGCCTGCCCCTGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC GCGCGAAGATGCCATGACCAATGGGCACGGCATCGATCTCTTCATCGTGC CGGGAGTGGCCTTCACCCGCTGTGGAGCTCGGATGGGCCATGGAATGGGC TACTATGACAAGTTCCTCAAGCAGCACGCGGAGAAGTATCCGCACAAGAA GATCTCGCTGATGGCGCTGTCGCTCAACGAGCAGATAGTCAACAACGAGG AGCTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTGTAATTACGGAA --- >D_biarmipes_CG34424-PA ATGGCGGCTACAATCCAGAATAGTCTCAAAGTGGCGCTGAGGGGGCGCAT GAAGGATGCGCTCAAGGGCCTGGACGCGGAGACCATTGCCCGGCAATCCC GGGCAGTCACGGCCAAGGTGCTCCAGAGCGAGGTTTTCCGCCAGGCCCAG CGGGTGAGCATTTACCTGAGCACCGCCTCTGAACTGGACACCACGGCGCT GCTCCTCGAGATGTTTCGCCTGGAGAAGATGGTCTTCGTGCCCACCTACG AGGGCAGCAAGATGAAGATGGTCCGCCTGCGCGGAATGGACGAGTACGAG AGTCTCCCTCTGACCAAGTGGAACATCAAGCAGCCGGACTTTAAGGAGGC ACGCGAAGATGCCATGACCAACGGCCACGGCATCGACCTCTTCATTGTGC CCGGAGTGGCCTTCACCCGCTGCGGAGGTCGCATGGGCCATGGAATGGGT TACTACGACAAGTTCCTGAAGCAGCACGCCGACAAGTATCCGCACAAGAA GATCTCGCTGATGGCCCTGGCCCTCAACGAGCAGATTGTCAGCAACGAGG AGCTGCCCATGGAGTCGCACGATGTCCGTTTGCACAGTGTAATTACAGAG AAC >D_elegans_CG34424-PA ATGGCGGCTACTATCCAAAACACCCTCAAAGTGGCGCTGAGGAAGCGCAT GAAGGATGCCCTCAAAAACCTGGACACGGAGGCCATTGCCCGGCAATCTC GAGCAGTCACGGCCAAGGTGCTGCAAAGTGAGTTTTTTCGACAGGCAACG CGGGTGAGTATCTACCTGAGCACAGCCTCGGAAGTGGACACCACGGCGCT GCTCTGCGAGATGTTCCGGCTGGAGAAGATGGTCTTCGTGCCCACCTACG AGGGCACCAAGATGAAGATGGTCCGATTGCGGGGCATGGACGAGTACGAG AGCCTTCCGCTGACCAAGTGGAACATCAAGCAGCCGGACTTCAAGGAGGC TCGTGAAGATGCCATGACCAATGGACACGGCATCGATCTCTTCATTGTGC CCGGGGTGGCCTTCACCCGCACTGGAGCTCGCATGGGCCATGGCATGGGC TACTACGACAAGTTCCTGAAGCAGCACGCGGACAAGTATCCGCACAAGAA GATCTCCCTGATGGCACTGGCCCTCAACGAGCAGATCGTCAGCAACGAGG AGCTGCCCATGGAGACGCACGATGTCCGTTTGCACAGTGTAATTACAGAA AAC
>D_melanogaster_CG34424-PA MAATIQNTLKVALRKRMKDALKGIDAEAIARQSQAVTAKVLQSEIFRQAQ RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMEEYE SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE N >D_sechellia_CG34424-PA MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNKELPMESHDVRLHGVITE N >D_simulans_CG34424-PA MAATIQNSLKVALRKRMKDALKGIDADAIARQSHAVTAKVLQSEIFRQAQ RVSIYLSTASELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG YYDKFLKQHAEKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE N >D_yakuba_CG34424-PA MAATIQNSLKVALRKRIKDALKGIDAEAIARQSQAVTSKVLQSEVFRQAQ RVSIYLSTASELDTTALISEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE SLPPTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG YYDKFLKQHADKYPHKKISLMALSLNEQIVSNEELPMESHDVRLHSVITE - >D_erecta_CG34424-PA MAATIQNSLKVALRKRIKDALKSIDPEAIARQSQAVTAKVLQSEIFRHAQ RVSIYLSTTSELDTTALLSEMFRLEKMVFVPTYEGSRMKMVRLRGMDEYE SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGARMGHGMG YYDKFLKQHAEKYPHKKISLMALSLNEQIVNNEELPMESHDVRLHSVITE - >D_biarmipes_CG34424-PA MAATIQNSLKVALRGRMKDALKGLDAETIARQSRAVTAKVLQSEVFRQAQ RVSIYLSTASELDTTALLLEMFRLEKMVFVPTYEGSKMKMVRLRGMDEYE SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRCGGRMGHGMG YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMESHDVRLHSVITE N >D_elegans_CG34424-PA MAATIQNTLKVALRKRMKDALKNLDTEAIARQSRAVTAKVLQSEFFRQAT RVSIYLSTASEVDTTALLCEMFRLEKMVFVPTYEGTKMKMVRLRGMDEYE SLPLTKWNIKQPDFKEAREDAMTNGHGIDLFIVPGVAFTRTGARMGHGMG YYDKFLKQHADKYPHKKISLMALALNEQIVSNEELPMETHDVRLHSVITE N
#NEXUS
[ID: 6123560823]
begin taxa;
dimensions ntax=7;
taxlabels
D_melanogaster_CG34424-PA
D_sechellia_CG34424-PA
D_simulans_CG34424-PA
D_yakuba_CG34424-PA
D_erecta_CG34424-PA
D_biarmipes_CG34424-PA
D_elegans_CG34424-PA
;
end;
begin trees;
translate
1 D_melanogaster_CG34424-PA,
2 D_sechellia_CG34424-PA,
3 D_simulans_CG34424-PA,
4 D_yakuba_CG34424-PA,
5 D_erecta_CG34424-PA,
6 D_biarmipes_CG34424-PA,
7 D_elegans_CG34424-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02763202,(4:0.03609333,5:0.03815675,(6:0.1179244,7:0.1730561)1.000:0.2089177)0.993:0.03632634,(2:0.009964829,3:0.007916349)0.927:0.008779325);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02763202,(4:0.03609333,5:0.03815675,(6:0.1179244,7:0.1730561):0.2089177):0.03632634,(2:0.009964829,3:0.007916349):0.008779325);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1566.80 -1577.28
2 -1567.01 -1576.49
--------------------------------------
TOTAL -1566.90 -1576.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/132/CG34424-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.706752 0.016810 0.478873 0.971231 0.692624 986.17 1036.44 1.000
r(A<->C){all} 0.069834 0.000890 0.020878 0.134702 0.066466 756.73 771.81 1.001
r(A<->G){all} 0.186193 0.002422 0.098272 0.282881 0.181994 654.59 691.76 1.000
r(A<->T){all} 0.070334 0.002049 0.000042 0.154521 0.063758 470.83 556.89 1.000
r(C<->G){all} 0.059906 0.000552 0.016792 0.105600 0.057813 615.13 730.67 1.001
r(C<->T){all} 0.496880 0.004946 0.364222 0.630053 0.497758 654.17 734.86 1.000
r(G<->T){all} 0.116852 0.001566 0.046636 0.197452 0.113309 864.31 889.80 1.000
pi(A){all} 0.231597 0.000260 0.200752 0.263432 0.231553 1222.24 1285.31 1.000
pi(C){all} 0.295902 0.000306 0.262798 0.330867 0.295252 981.73 992.38 1.000
pi(G){all} 0.316560 0.000321 0.281715 0.351506 0.315815 754.23 981.55 1.000
pi(T){all} 0.155941 0.000188 0.131238 0.184362 0.155600 834.51 925.97 1.000
alpha{1,2} 0.109005 0.001536 0.013855 0.178348 0.110496 893.76 899.40 1.000
alpha{3} 1.879653 0.549239 0.636073 3.330932 1.770550 1170.37 1184.78 1.000
pinvar{all} 0.468581 0.005955 0.316441 0.602830 0.476896 879.89 887.81 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/132/CG34424-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 7 ls = 200
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 0 1 0 0 2 | Ser TCT 0 0 0 0 0 1 | Tyr TAT 1 1 1 1 2 1 | Cys TGT 0 0 0 0 1 0
TTC 6 7 6 7 7 5 | TCC 0 0 0 2 2 1 | TAC 5 5 5 5 4 5 | TGC 1 1 1 1 0 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 1 2 1 1 | TCG 6 6 6 5 4 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 1 0 | Pro CCT 1 1 1 0 0 1 | His CAT 1 2 2 1 2 1 | Arg CGT 1 2 1 1 1 1
CTC 3 3 3 3 3 8 | CCC 3 3 3 4 3 3 | CAC 5 5 5 5 5 5 | CGC 5 5 5 5 5 8
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 2 3 1 | CGA 1 1 1 2 2 0
CTG 14 14 15 12 14 12 | CCG 2 2 2 3 4 2 | CAG 8 7 7 7 5 7 | CGG 5 4 5 4 4 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 4 2 5 | Thr ACT 0 0 0 1 0 0 | Asn AAT 0 0 0 1 1 1 | Ser AGT 1 0 1 1 1 3
ATC 6 7 7 7 8 4 | ACC 6 6 6 6 7 7 | AAC 5 5 5 4 5 4 | AGC 6 7 7 7 7 5
ATA 2 1 1 1 2 0 | ACA 1 0 1 0 0 2 | Lys AAA 0 0 0 0 0 1 | Arg AGA 0 0 0 0 0 0
Met ATG 12 12 12 11 11 12 | ACG 4 4 3 3 4 2 | AAG 15 16 15 15 15 14 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 1 | Ala GCT 2 1 1 2 2 1 | Asp GAT 3 4 4 4 3 3 | Gly GGT 1 1 0 0 0 2
GTC 4 4 4 5 3 5 | GCC 7 8 8 7 6 9 | GAC 5 6 6 6 6 7 | GGC 7 8 8 6 5 5
GTA 1 1 1 2 2 1 | GCA 3 2 2 2 1 2 | Glu GAA 1 1 1 2 2 2 | GGA 1 1 1 3 3 4
GTG 7 7 7 6 7 6 | GCG 6 7 7 6 7 5 | GAG 16 13 14 13 14 13 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------
Phe TTT 2 | Ser TCT 1 | Tyr TAT 1 | Cys TGT 0
TTC 6 | TCC 1 | TAC 5 | TGC 1
Leu TTA 0 | TCA 0 | *** TAA 0 | *** TGA 0
TTG 2 | TCG 1 | TAG 0 | Trp TGG 1
------------------------------------------------------
Leu CTT 1 | Pro CCT 0 | His CAT 1 | Arg CGT 2
CTC 5 | CCC 3 | CAC 5 | CGC 3
CTA 0 | CCA 0 | Gln CAA 3 | CGA 3
CTG 11 | CCG 3 | CAG 4 | CGG 4
------------------------------------------------------
Ile ATT 3 | Thr ACT 2 | Asn AAT 1 | Ser AGT 3
ATC 6 | ACC 7 | AAC 5 | AGC 3
ATA 0 | ACA 2 | Lys AAA 2 | Arg AGA 0
Met ATG 12 | ACG 5 | AAG 14 | AGG 1
------------------------------------------------------
Val GTT 0 | Ala GCT 3 | Asp GAT 4 | Gly GGT 0
GTC 5 | GCC 8 | GAC 6 | GGC 6
GTA 1 | GCA 3 | Glu GAA 3 | GGA 2
GTG 7 | GCG 4 | GAG 12 | GGG 1
------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG34424-PA
position 1: T:0.11500 C:0.25000 A:0.31000 G:0.32500
position 2: T:0.30500 C:0.20500 A:0.33000 G:0.16000
position 3: T:0.07500 C:0.37000 A:0.05500 G:0.50000
Average T:0.16500 C:0.27500 A:0.23167 G:0.32833
#2: D_sechellia_CG34424-PA
position 1: T:0.11500 C:0.25000 A:0.31000 G:0.32500
position 2: T:0.30500 C:0.20000 A:0.33000 G:0.16500
position 3: T:0.07500 C:0.40000 A:0.04000 G:0.48500
Average T:0.16500 C:0.28333 A:0.22667 G:0.32500
#3: D_simulans_CG34424-PA
position 1: T:0.11000 C:0.25500 A:0.31000 G:0.32500
position 2: T:0.30500 C:0.20000 A:0.33000 G:0.16500
position 3: T:0.07500 C:0.39500 A:0.04500 G:0.48500
Average T:0.16333 C:0.28333 A:0.22833 G:0.32500
#4: D_yakuba_CG34424-PA
position 1: T:0.12000 C:0.24500 A:0.31000 G:0.32500
position 2: T:0.30000 C:0.20500 A:0.33000 G:0.16500
position 3: T:0.08000 C:0.40000 A:0.07000 G:0.45000
Average T:0.16667 C:0.28333 A:0.23667 G:0.31333
#5: D_erecta_CG34424-PA
position 1: T:0.11000 C:0.26000 A:0.32000 G:0.31000
position 2: T:0.30500 C:0.20000 A:0.33500 G:0.16000
position 3: T:0.08000 C:0.38000 A:0.07500 G:0.46500
Average T:0.16500 C:0.28000 A:0.24333 G:0.31167
#6: D_biarmipes_CG34424-PA
position 1: T:0.10000 C:0.26000 A:0.30500 G:0.33500
position 2: T:0.31000 C:0.19000 A:0.32500 G:0.17500
position 3: T:0.11500 C:0.41000 A:0.06500 G:0.41000
Average T:0.17500 C:0.28667 A:0.23167 G:0.30667
#7: D_elegans_CG34424-PA
position 1: T:0.10500 C:0.24000 A:0.33000 G:0.32500
position 2: T:0.30500 C:0.21500 A:0.33000 G:0.15000
position 3: T:0.12000 C:0.37500 A:0.09500 G:0.41000
Average T:0.17667 C:0.27667 A:0.25167 G:0.29500
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 2 | Tyr Y TAT 8 | Cys C TGT 1
TTC 44 | TCC 6 | TAC 34 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 11 | TCG 30 | TAG 0 | Trp W TGG 7
------------------------------------------------------------------------------
Leu L CTT 2 | Pro P CCT 4 | His H CAT 10 | Arg R CGT 9
CTC 28 | CCC 22 | CAC 35 | CGC 36
CTA 0 | CCA 0 | Gln Q CAA 12 | CGA 10
CTG 92 | CCG 18 | CAG 45 | CGG 29
------------------------------------------------------------------------------
Ile I ATT 23 | Thr T ACT 3 | Asn N AAT 4 | Ser S AGT 10
ATC 45 | ACC 45 | AAC 33 | AGC 42
ATA 7 | ACA 6 | Lys K AAA 3 | Arg R AGA 0
Met M ATG 82 | ACG 25 | AAG 104 | AGG 7
------------------------------------------------------------------------------
Val V GTT 1 | Ala A GCT 12 | Asp D GAT 25 | Gly G GGT 4
GTC 30 | GCC 53 | GAC 42 | GGC 45
GTA 9 | GCA 15 | Glu E GAA 12 | GGA 15
GTG 47 | GCG 42 | GAG 95 | GGG 7
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11071 C:0.25143 A:0.31357 G:0.32429
position 2: T:0.30500 C:0.20214 A:0.33000 G:0.16286
position 3: T:0.08857 C:0.39000 A:0.06357 G:0.45786
Average T:0.16810 C:0.28119 A:0.23571 G:0.31500
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG34424-PA
D_sechellia_CG34424-PA 0.2210 (0.0132 0.0595)
D_simulans_CG34424-PA 0.1165 (0.0087 0.0751) 0.1492 (0.0044 0.0292)
D_yakuba_CG34424-PA 0.1032 (0.0187 0.1812) 0.1587 (0.0232 0.1459) 0.1282 (0.0187 0.1458)
D_erecta_CG34424-PA 0.0903 (0.0176 0.1948) 0.1386 (0.0220 0.1590) 0.1107 (0.0176 0.1588) 0.2046 (0.0220 0.1077)
D_biarmipes_CG34424-PA 0.0651 (0.0322 0.4941) 0.0749 (0.0356 0.4750) 0.0673 (0.0310 0.4609) 0.0613 (0.0321 0.5242) 0.0833 (0.0413 0.4953)
D_elegans_CG34424-PA 0.0875 (0.0425 0.4853) 0.1024 (0.0505 0.4936) 0.0906 (0.0459 0.5069) 0.0959 (0.0494 0.5149) 0.1044 (0.0494 0.4729) 0.1041 (0.0401 0.3855)
Model 0: one-ratio
TREE # 1: (1, (4, 5, (6, 7)), (2, 3)); MP score: 143
lnL(ntime: 10 np: 12): -1490.745894 +0.000000
8..1 8..9 9..4 9..5 9..10 10..6 10..7 8..11 11..2 11..3
0.050105 0.069576 0.074622 0.076777 0.215525 0.163812 0.239301 0.015741 0.018070 0.014591 2.280943 0.055464
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.93812
(1: 0.050105, (4: 0.074622, 5: 0.076777, (6: 0.163812, 7: 0.239301): 0.215525): 0.069576, (2: 0.018070, 3: 0.014591): 0.015741);
(D_melanogaster_CG34424-PA: 0.050105, (D_yakuba_CG34424-PA: 0.074622, D_erecta_CG34424-PA: 0.076777, (D_biarmipes_CG34424-PA: 0.163812, D_elegans_CG34424-PA: 0.239301): 0.215525): 0.069576, (D_sechellia_CG34424-PA: 0.018070, D_simulans_CG34424-PA: 0.014591): 0.015741);
Detailed output identifying parameters
kappa (ts/tv) = 2.28094
omega (dN/dS) = 0.05546
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.050 508.7 91.3 0.0555 0.0047 0.0839 2.4 7.7
8..9 0.070 508.7 91.3 0.0555 0.0065 0.1164 3.3 10.6
9..4 0.075 508.7 91.3 0.0555 0.0069 0.1249 3.5 11.4
9..5 0.077 508.7 91.3 0.0555 0.0071 0.1285 3.6 11.7
9..10 0.216 508.7 91.3 0.0555 0.0200 0.3607 10.2 32.9
10..6 0.164 508.7 91.3 0.0555 0.0152 0.2742 7.7 25.0
10..7 0.239 508.7 91.3 0.0555 0.0222 0.4005 11.3 36.6
8..11 0.016 508.7 91.3 0.0555 0.0015 0.0263 0.7 2.4
11..2 0.018 508.7 91.3 0.0555 0.0017 0.0302 0.9 2.8
11..3 0.015 508.7 91.3 0.0555 0.0014 0.0244 0.7 2.2
tree length for dN: 0.0871
tree length for dS: 1.5701
Time used: 0:03
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, 5, (6, 7)), (2, 3)); MP score: 143
lnL(ntime: 10 np: 13): -1480.313209 +0.000000
8..1 8..9 9..4 9..5 9..10 10..6 10..7 8..11 11..2 11..3
0.051551 0.073075 0.075378 0.077736 0.239802 0.167924 0.260606 0.014545 0.018212 0.014803 2.406010 0.937928 0.028338
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.99363
(1: 0.051551, (4: 0.075378, 5: 0.077736, (6: 0.167924, 7: 0.260606): 0.239802): 0.073075, (2: 0.018212, 3: 0.014803): 0.014545);
(D_melanogaster_CG34424-PA: 0.051551, (D_yakuba_CG34424-PA: 0.075378, D_erecta_CG34424-PA: 0.077736, (D_biarmipes_CG34424-PA: 0.167924, D_elegans_CG34424-PA: 0.260606): 0.239802): 0.073075, (D_sechellia_CG34424-PA: 0.018212, D_simulans_CG34424-PA: 0.014803): 0.014545);
Detailed output identifying parameters
kappa (ts/tv) = 2.40601
dN/dS (w) for site classes (K=2)
p: 0.93793 0.06207
w: 0.02834 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.052 508.4 91.6 0.0887 0.0067 0.0754 3.4 6.9
8..9 0.073 508.4 91.6 0.0887 0.0095 0.1069 4.8 9.8
9..4 0.075 508.4 91.6 0.0887 0.0098 0.1103 5.0 10.1
9..5 0.078 508.4 91.6 0.0887 0.0101 0.1137 5.1 10.4
9..10 0.240 508.4 91.6 0.0887 0.0311 0.3509 15.8 32.1
10..6 0.168 508.4 91.6 0.0887 0.0218 0.2457 11.1 22.5
10..7 0.261 508.4 91.6 0.0887 0.0338 0.3813 17.2 34.9
8..11 0.015 508.4 91.6 0.0887 0.0019 0.0213 1.0 1.9
11..2 0.018 508.4 91.6 0.0887 0.0024 0.0266 1.2 2.4
11..3 0.015 508.4 91.6 0.0887 0.0019 0.0217 1.0 2.0
Time used: 0:07
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, 5, (6, 7)), (2, 3)); MP score: 143
lnL(ntime: 10 np: 15): -1480.313209 +0.000000
8..1 8..9 9..4 9..5 9..10 10..6 10..7 8..11 11..2 11..3
0.051552 0.073075 0.075378 0.077736 0.239802 0.167924 0.260606 0.014545 0.018212 0.014803 2.406009 0.937928 0.062072 0.028338 36.566942
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.99363
(1: 0.051552, (4: 0.075378, 5: 0.077736, (6: 0.167924, 7: 0.260606): 0.239802): 0.073075, (2: 0.018212, 3: 0.014803): 0.014545);
(D_melanogaster_CG34424-PA: 0.051552, (D_yakuba_CG34424-PA: 0.075378, D_erecta_CG34424-PA: 0.077736, (D_biarmipes_CG34424-PA: 0.167924, D_elegans_CG34424-PA: 0.260606): 0.239802): 0.073075, (D_sechellia_CG34424-PA: 0.018212, D_simulans_CG34424-PA: 0.014803): 0.014545);
Detailed output identifying parameters
kappa (ts/tv) = 2.40601
dN/dS (w) for site classes (K=3)
p: 0.93793 0.06207 0.00000
w: 0.02834 1.00000 36.56694
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.052 508.4 91.6 0.0887 0.0067 0.0754 3.4 6.9
8..9 0.073 508.4 91.6 0.0887 0.0095 0.1069 4.8 9.8
9..4 0.075 508.4 91.6 0.0887 0.0098 0.1103 5.0 10.1
9..5 0.078 508.4 91.6 0.0887 0.0101 0.1137 5.1 10.4
9..10 0.240 508.4 91.6 0.0887 0.0311 0.3509 15.8 32.1
10..6 0.168 508.4 91.6 0.0887 0.0218 0.2457 11.1 22.5
10..7 0.261 508.4 91.6 0.0887 0.0338 0.3813 17.2 34.9
8..11 0.015 508.4 91.6 0.0887 0.0019 0.0213 1.0 1.9
11..2 0.018 508.4 91.6 0.0887 0.0024 0.0266 1.2 2.4
11..3 0.015 508.4 91.6 0.0887 0.0019 0.0217 1.0 2.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG34424-PA)
Pr(w>1) post mean +- SE for w
69 S 0.561 1.396 +- 0.618
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.809 0.102 0.030 0.015 0.010 0.008 0.007 0.007 0.007 0.006
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.999
sum of density on p0-p1 = 1.000000
Time used: 0:20
Model 3: discrete (3 categories)
TREE # 1: (1, (4, 5, (6, 7)), (2, 3)); MP score: 143
lnL(ntime: 10 np: 16): -1476.413374 +0.000000
8..1 8..9 9..4 9..5 9..10 10..6 10..7 8..11 11..2 11..3
0.051366 0.072090 0.075696 0.078228 0.229523 0.163913 0.251202 0.015246 0.018313 0.014884 2.349591 0.471820 0.317925 0.000018 0.005266 0.295118
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.97046
(1: 0.051366, (4: 0.075696, 5: 0.078228, (6: 0.163913, 7: 0.251202): 0.229523): 0.072090, (2: 0.018313, 3: 0.014884): 0.015246);
(D_melanogaster_CG34424-PA: 0.051366, (D_yakuba_CG34424-PA: 0.075696, D_erecta_CG34424-PA: 0.078228, (D_biarmipes_CG34424-PA: 0.163913, D_elegans_CG34424-PA: 0.251202): 0.229523): 0.072090, (D_sechellia_CG34424-PA: 0.018313, D_simulans_CG34424-PA: 0.014884): 0.015246);
Detailed output identifying parameters
kappa (ts/tv) = 2.34959
dN/dS (w) for site classes (K=3)
p: 0.47182 0.31792 0.21026
w: 0.00002 0.00527 0.29512
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.051 508.5 91.5 0.0637 0.0053 0.0829 2.7 7.6
8..9 0.072 508.5 91.5 0.0637 0.0074 0.1164 3.8 10.6
9..4 0.076 508.5 91.5 0.0637 0.0078 0.1222 4.0 11.2
9..5 0.078 508.5 91.5 0.0637 0.0080 0.1263 4.1 11.6
9..10 0.230 508.5 91.5 0.0637 0.0236 0.3706 12.0 33.9
10..6 0.164 508.5 91.5 0.0637 0.0169 0.2646 8.6 24.2
10..7 0.251 508.5 91.5 0.0637 0.0258 0.4056 13.1 37.1
8..11 0.015 508.5 91.5 0.0637 0.0016 0.0246 0.8 2.3
11..2 0.018 508.5 91.5 0.0637 0.0019 0.0296 1.0 2.7
11..3 0.015 508.5 91.5 0.0637 0.0015 0.0240 0.8 2.2
Naive Empirical Bayes (NEB) analysis
Time used: 0:34
Model 7: beta (10 categories)
TREE # 1: (1, (4, 5, (6, 7)), (2, 3)); MP score: 143
lnL(ntime: 10 np: 13): -1476.535763 +0.000000
8..1 8..9 9..4 9..5 9..10 10..6 10..7 8..11 11..2 11..3
0.051287 0.072147 0.075518 0.078073 0.231286 0.164166 0.252714 0.015207 0.018280 0.014841 2.349212 0.118511 1.575227
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.97352
(1: 0.051287, (4: 0.075518, 5: 0.078073, (6: 0.164166, 7: 0.252714): 0.231286): 0.072147, (2: 0.018280, 3: 0.014841): 0.015207);
(D_melanogaster_CG34424-PA: 0.051287, (D_yakuba_CG34424-PA: 0.075518, D_erecta_CG34424-PA: 0.078073, (D_biarmipes_CG34424-PA: 0.164166, D_elegans_CG34424-PA: 0.252714): 0.231286): 0.072147, (D_sechellia_CG34424-PA: 0.018280, D_simulans_CG34424-PA: 0.014841): 0.015207);
Detailed output identifying parameters
kappa (ts/tv) = 2.34921
Parameters in M7 (beta):
p = 0.11851 q = 1.57523
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00007 0.00063 0.00340 0.01402 0.04771 0.14438 0.43484
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.051 508.5 91.5 0.0645 0.0053 0.0825 2.7 7.5
8..9 0.072 508.5 91.5 0.0645 0.0075 0.1161 3.8 10.6
9..4 0.076 508.5 91.5 0.0645 0.0078 0.1215 4.0 11.1
9..5 0.078 508.5 91.5 0.0645 0.0081 0.1257 4.1 11.5
9..10 0.231 508.5 91.5 0.0645 0.0240 0.3722 12.2 34.0
10..6 0.164 508.5 91.5 0.0645 0.0170 0.2642 8.7 24.2
10..7 0.253 508.5 91.5 0.0645 0.0262 0.4067 13.3 37.2
8..11 0.015 508.5 91.5 0.0645 0.0016 0.0245 0.8 2.2
11..2 0.018 508.5 91.5 0.0645 0.0019 0.0294 1.0 2.7
11..3 0.015 508.5 91.5 0.0645 0.0015 0.0239 0.8 2.2
Time used: 0:55
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, 5, (6, 7)), (2, 3)); MP score: 143
lnL(ntime: 10 np: 15): -1476.535886 +0.000000
8..1 8..9 9..4 9..5 9..10 10..6 10..7 8..11 11..2 11..3
0.051287 0.072148 0.075518 0.078073 0.231288 0.164167 0.252715 0.015207 0.018280 0.014841 2.349213 0.999990 0.118518 1.575471 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.97352
(1: 0.051287, (4: 0.075518, 5: 0.078073, (6: 0.164167, 7: 0.252715): 0.231288): 0.072148, (2: 0.018280, 3: 0.014841): 0.015207);
(D_melanogaster_CG34424-PA: 0.051287, (D_yakuba_CG34424-PA: 0.075518, D_erecta_CG34424-PA: 0.078073, (D_biarmipes_CG34424-PA: 0.164167, D_elegans_CG34424-PA: 0.252715): 0.231288): 0.072148, (D_sechellia_CG34424-PA: 0.018280, D_simulans_CG34424-PA: 0.014841): 0.015207);
Detailed output identifying parameters
kappa (ts/tv) = 2.34921
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.11852 q = 1.57547
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00008 0.00063 0.00340 0.01402 0.04771 0.14437 0.43479 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.051 508.5 91.5 0.0645 0.0053 0.0825 2.7 7.5
8..9 0.072 508.5 91.5 0.0645 0.0075 0.1161 3.8 10.6
9..4 0.076 508.5 91.5 0.0645 0.0078 0.1215 4.0 11.1
9..5 0.078 508.5 91.5 0.0645 0.0081 0.1257 4.1 11.5
9..10 0.231 508.5 91.5 0.0645 0.0240 0.3722 12.2 34.0
10..6 0.164 508.5 91.5 0.0645 0.0170 0.2642 8.7 24.2
10..7 0.253 508.5 91.5 0.0645 0.0262 0.4067 13.3 37.2
8..11 0.015 508.5 91.5 0.0645 0.0016 0.0245 0.8 2.2
11..2 0.018 508.5 91.5 0.0645 0.0019 0.0294 1.0 2.7
11..3 0.015 508.5 91.5 0.0645 0.0015 0.0239 0.8 2.2
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG34424-PA)
Pr(w>1) post mean +- SE for w
45 I 0.573 1.147 +- 0.651
69 S 0.721 1.365 +- 0.709
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.001 0.007 0.037 0.119 0.284 0.551
ws: 0.840 0.093 0.024 0.011 0.007 0.006 0.005 0.005 0.004 0.004
Time used: 1:31
Model 1: NearlyNeutral -1480.313209 Model 2: PositiveSelection -1480.313209 Model 0: one-ratio -1490.745894 Model 3: discrete -1476.413374 Model 7: beta -1476.535763 Model 8: beta&w>1 -1476.535886 Model 0 vs 1 20.865369999999984 Model 2 vs 1 0.0 Model 8 vs 7 2.459999996062834E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
