--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Nov 03 10:36:23 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/132/CG34423-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -498.22 -509.43
2 -497.96 -507.14
--------------------------------------
TOTAL -498.08 -508.83
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.490172 0.028990 0.216450 0.834828 0.464532 894.60 1046.77 1.000
r(A<->C){all} 0.138992 0.006903 0.000370 0.296134 0.126904 228.56 254.94 1.000
r(A<->G){all} 0.417974 0.017217 0.176580 0.677018 0.416337 263.62 323.31 1.003
r(A<->T){all} 0.054292 0.003038 0.000009 0.162620 0.036712 468.46 479.04 1.001
r(C<->G){all} 0.081767 0.003128 0.000311 0.184175 0.070334 523.53 640.02 1.002
r(C<->T){all} 0.259696 0.012545 0.054789 0.474981 0.248233 285.50 303.97 1.003
r(G<->T){all} 0.047278 0.001917 0.000003 0.133044 0.034882 427.70 547.92 1.001
pi(A){all} 0.266089 0.000680 0.214965 0.315388 0.265517 1206.09 1267.93 1.000
pi(C){all} 0.243173 0.000682 0.191715 0.292195 0.242894 1222.02 1361.51 1.000
pi(G){all} 0.338345 0.000805 0.287186 0.396404 0.337185 1178.53 1313.30 1.000
pi(T){all} 0.152392 0.000442 0.113976 0.195240 0.151354 1049.40 1275.20 1.000
alpha{1,2} 0.072436 0.003629 0.000129 0.172846 0.061860 1221.82 1254.52 1.000
alpha{3} 1.233273 0.398202 0.276553 2.455511 1.101590 1051.36 1224.61 1.000
pinvar{all} 0.697953 0.006217 0.535812 0.828561 0.708311 1149.13 1161.50 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -475.282011
Model 2: PositiveSelection -475.281862
Model 0: one-ratio -475.281862
Model 3: discrete -475.281862
Model 7: beta -475.295576
Model 8: beta&w>1 -475.295725
Model 0 vs 1 2.980000000434302E-4
Model 2 vs 1 2.980000000434302E-4
Model 8 vs 7 2.980000000434302E-4
>C1
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGK
MEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C2
MFALRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C3
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C4
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKTKTEPKAPEAPKK
>C5
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKAKTEPKAPEAPKK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=85
C1 MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGK
C2 MFALRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
C3 MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
C4 MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
C5 MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
**:*****************************:*****************
C1 MEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
C2 IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
C3 IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
C4 MEAAREEEFFHKQQKEQLKNLKTKTEPKAPEAPKK
C5 MEAAREEEFFHKQQKEQLKNLKAKTEPKAPEAPKK
:*********:***********:************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1700]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [1700]--->[1700]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.240 Mb, Max= 30.404 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGK
MEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C2
MFALRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C3
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C4
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKTKTEPKAPEAPKK
>C5
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKAKTEPKAPEAPKK
FORMAT of file /tmp/tmp3965904905160445378aln Not Supported[FATAL:T-COFFEE]
>C1
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGK
MEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C2
MFALRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C3
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C4
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKTKTEPKAPEAPKK
>C5
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKAKTEPKAPEAPKK
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:85 S:100 BS:85
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 96.47 C1 C2 96.47
TOP 1 0 96.47 C2 C1 96.47
BOT 0 2 97.65 C1 C3 97.65
TOP 2 0 97.65 C3 C1 97.65
BOT 0 3 97.65 C1 C4 97.65
TOP 3 0 97.65 C4 C1 97.65
BOT 0 4 96.47 C1 C5 96.47
TOP 4 0 96.47 C5 C1 96.47
BOT 1 2 98.82 C2 C3 98.82
TOP 2 1 98.82 C3 C2 98.82
BOT 1 3 96.47 C2 C4 96.47
TOP 3 1 96.47 C4 C2 96.47
BOT 1 4 95.29 C2 C5 95.29
TOP 4 1 95.29 C5 C2 95.29
BOT 2 3 97.65 C3 C4 97.65
TOP 3 2 97.65 C4 C3 97.65
BOT 2 4 96.47 C3 C5 96.47
TOP 4 2 96.47 C5 C3 96.47
BOT 3 4 98.82 C4 C5 98.82
TOP 4 3 98.82 C5 C4 98.82
AVG 0 C1 * 97.06
AVG 1 C2 * 96.76
AVG 2 C3 * 97.65
AVG 3 C4 * 97.65
AVG 4 C5 * 96.76
TOT TOT * 97.18
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTTTACACTGCGACGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
C2 ATGTTTGCATTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
C3 ATGTTTACATTGCGGCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
C4 ATGTTTACACTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
C5 ATGTTTACACTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
******.** **** ***********************************
C1 GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAACG
C2 GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG
C3 GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG
C4 GCACTTGAAAATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGAAAGG
C5 GCACTTGAAAATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG
*********.***********************************.** *
C1 GCGGCGGCGGCGGCGGATCCATCCGGGAGGCGGGCGGTTCATTTGGCAAA
C2 GGGGCGGCGGAGGCGGATCCATCCGGGAGGCGGGCGGTTCCTTTGGCAAA
C3 GGGGCGGCGGAGGCGGATCCATCCGGGAGGCGGGCGGTTCCTTTGGCAAA
C4 GGGGCGGTGGCGGGGGATCCATTCGGGAGGCGGGCGGGTCCTTTGGCAAA
C5 GTGGCGGTGGCGGAGGATCCATTCGGGAGGCAGGCGGATCCTTTGGCAAA
* ***** **.** ******** ********.***** **.*********
C1 ATGGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA
C2 ATAGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA
C3 ATAGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA
C4 ATGGAGGCTGCCCGCGAGGAGGAGTTCTTCCATAAGCAGCAAAAGGAGCA
C5 ATGGAGGCTGCTCGCGAGGAGGAGTTCTTCCATAAGCAGCAAAAGGAGCA
**.******** ****************** * *****************
C1 ACTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA
C2 GCTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA
C3 GCTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA
C4 GCTGAAGAACCTGAAGACGAAAACGGAACCCAAGGCACCAGAGGCTCCCA
C5 GCTGAAGAACCTGAAGGCCAAGACGGAACCCAAGGCACCAGAGGCTCCCA
.***************.* **.*****.** *******************
C1 AGAAG
C2 AGAAG
C3 AGAAG
C4 AGAAG
C5 AGAAG
*****
>C1
ATGTTTACACTGCGACGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAACG
GCGGCGGCGGCGGCGGATCCATCCGGGAGGCGGGCGGTTCATTTGGCAAA
ATGGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA
ACTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA
AGAAG
>C2
ATGTTTGCATTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG
GGGGCGGCGGAGGCGGATCCATCCGGGAGGCGGGCGGTTCCTTTGGCAAA
ATAGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA
GCTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA
AGAAG
>C3
ATGTTTACATTGCGGCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG
GGGGCGGCGGAGGCGGATCCATCCGGGAGGCGGGCGGTTCCTTTGGCAAA
ATAGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA
GCTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA
AGAAG
>C4
ATGTTTACACTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
GCACTTGAAAATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGAAAGG
GGGGCGGTGGCGGGGGATCCATTCGGGAGGCGGGCGGGTCCTTTGGCAAA
ATGGAGGCTGCCCGCGAGGAGGAGTTCTTCCATAAGCAGCAAAAGGAGCA
GCTGAAGAACCTGAAGACGAAAACGGAACCCAAGGCACCAGAGGCTCCCA
AGAAG
>C5
ATGTTTACACTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
GCACTTGAAAATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG
GTGGCGGTGGCGGAGGATCCATTCGGGAGGCAGGCGGATCCTTTGGCAAA
ATGGAGGCTGCTCGCGAGGAGGAGTTCTTCCATAAGCAGCAAAAGGAGCA
GCTGAAGAACCTGAAGGCCAAGACGGAACCCAAGGCACCAGAGGCTCCCA
AGAAG
>C1
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGK
MEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C2
MFALRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C3
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C4
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKTKTEPKAPEAPKK
>C5
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKAKTEPKAPEAPKK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 255 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478169239
Setting output file names to "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1461126660
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 6104885926
Seed = 1833019423
Swapseed = 1478169239
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 8 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 21 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -650.490860 -- -25.624409
Chain 2 -- -623.554495 -- -25.624409
Chain 3 -- -635.101925 -- -25.624409
Chain 4 -- -647.631498 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -635.101925 -- -25.624409
Chain 2 -- -635.101925 -- -25.624409
Chain 3 -- -650.490860 -- -25.624409
Chain 4 -- -635.101925 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-650.491] (-623.554) (-635.102) (-647.631) * [-635.102] (-635.102) (-650.491) (-635.102)
500 -- (-510.217) (-518.474) (-519.287) [-510.269] * (-513.901) (-512.259) [-513.778] (-517.039) -- 0:00:00
1000 -- (-512.609) (-516.030) [-512.471] (-518.281) * (-513.886) [-510.862] (-508.847) (-517.338) -- 0:00:00
1500 -- [-506.431] (-513.897) (-515.923) (-517.905) * (-513.332) (-516.418) (-516.150) [-510.758] -- 0:11:05
2000 -- (-509.431) [-508.298] (-513.835) (-511.860) * (-514.311) [-514.879] (-511.125) (-509.087) -- 0:08:19
2500 -- (-507.915) (-512.971) (-508.238) [-511.040] * [-509.710] (-518.229) (-511.155) (-510.358) -- 0:06:39
3000 -- (-508.801) [-507.107] (-509.159) (-510.069) * (-514.965) (-514.892) (-511.036) [-507.545] -- 0:05:32
3500 -- (-505.368) [-506.199] (-509.958) (-509.915) * (-511.011) [-513.369] (-514.545) (-507.571) -- 0:04:44
4000 -- [-505.085] (-512.481) (-505.356) (-507.156) * (-509.257) (-510.902) (-511.607) [-512.264] -- 0:04:09
4500 -- (-503.376) (-515.078) [-512.380] (-516.931) * (-521.558) (-509.092) (-507.248) [-513.570] -- 0:03:41
5000 -- (-502.204) (-508.777) [-506.224] (-519.364) * (-509.564) (-515.403) [-506.409] (-509.900) -- 0:03:19
Average standard deviation of split frequencies: 0.000000
5500 -- (-507.963) [-503.754] (-509.901) (-512.436) * [-507.009] (-510.162) (-505.522) (-514.682) -- 0:03:00
6000 -- (-501.835) [-508.714] (-507.489) (-512.086) * (-510.221) (-512.721) [-502.747] (-509.804) -- 0:02:45
6500 -- (-501.132) (-509.765) (-508.767) [-508.441] * [-502.831] (-514.034) (-504.532) (-510.566) -- 0:02:32
7000 -- (-507.997) [-501.814] (-512.705) (-512.012) * (-502.928) (-510.215) [-502.060] (-511.580) -- 0:02:21
7500 -- (-504.285) (-506.144) [-510.160] (-515.603) * (-500.334) (-512.366) (-509.282) [-511.234] -- 0:04:24
8000 -- (-503.859) (-507.314) [-506.077] (-523.225) * [-501.702] (-512.565) (-500.906) (-507.133) -- 0:04:08
8500 -- (-497.536) (-504.920) [-505.549] (-519.224) * [-499.028] (-515.869) (-503.678) (-510.507) -- 0:03:53
9000 -- (-498.973) [-501.127] (-505.078) (-508.640) * (-501.094) (-513.581) [-499.810] (-503.381) -- 0:03:40
9500 -- [-501.918] (-506.756) (-501.513) (-510.005) * (-500.851) (-515.911) (-502.004) [-506.708] -- 0:03:28
10000 -- (-501.144) (-504.818) [-504.817] (-506.595) * [-502.209] (-509.376) (-504.872) (-511.377) -- 0:03:18
Average standard deviation of split frequencies: 0.022097
10500 -- [-497.584] (-503.429) (-505.132) (-506.019) * [-505.966] (-510.408) (-503.901) (-508.849) -- 0:03:08
11000 -- (-500.103) [-499.209] (-504.344) (-504.245) * (-502.854) (-510.847) [-499.652] (-502.390) -- 0:02:59
11500 -- (-500.478) [-499.784] (-505.705) (-503.787) * [-501.957] (-508.277) (-500.016) (-510.068) -- 0:02:51
12000 -- [-504.969] (-502.920) (-507.300) (-510.955) * (-509.188) (-510.900) (-499.832) [-505.179] -- 0:02:44
12500 -- (-503.739) (-504.991) [-505.410] (-503.221) * (-503.943) (-510.300) [-497.299] (-505.288) -- 0:02:38
13000 -- [-501.980] (-503.595) (-507.592) (-509.037) * [-501.182] (-512.481) (-507.930) (-510.008) -- 0:02:31
13500 -- (-503.791) (-507.068) (-507.188) [-508.499] * (-500.370) [-500.116] (-501.748) (-507.617) -- 0:02:26
14000 -- (-500.245) [-498.333] (-498.687) (-502.724) * (-499.109) [-499.950] (-506.600) (-505.826) -- 0:02:20
14500 -- (-504.510) [-497.916] (-502.619) (-506.679) * [-498.378] (-503.302) (-501.477) (-505.024) -- 0:02:15
15000 -- (-500.893) (-502.484) [-498.250] (-507.012) * (-497.451) (-498.142) [-500.490] (-505.940) -- 0:02:11
Average standard deviation of split frequencies: 0.019642
15500 -- [-500.119] (-500.671) (-501.043) (-505.175) * (-502.254) [-505.906] (-503.276) (-511.799) -- 0:02:07
16000 -- [-499.135] (-498.964) (-504.983) (-502.649) * (-504.868) (-501.556) [-501.222] (-504.034) -- 0:02:03
16500 -- (-501.965) (-498.847) [-500.349] (-502.612) * [-502.628] (-504.594) (-500.293) (-504.732) -- 0:01:59
17000 -- [-497.487] (-504.198) (-503.251) (-505.767) * [-503.276] (-502.593) (-507.794) (-505.427) -- 0:02:53
17500 -- (-497.836) [-503.494] (-508.477) (-502.870) * (-499.865) [-505.540] (-501.656) (-508.034) -- 0:02:48
18000 -- [-498.199] (-502.901) (-500.902) (-503.040) * (-509.115) (-506.450) [-500.266] (-501.127) -- 0:02:43
18500 -- (-506.149) [-503.377] (-500.628) (-501.313) * [-502.262] (-512.555) (-499.111) (-502.531) -- 0:02:39
19000 -- [-499.176] (-507.326) (-511.718) (-500.296) * (-499.167) (-507.150) [-503.385] (-496.714) -- 0:02:34
19500 -- (-501.738) [-502.259] (-502.292) (-503.186) * (-501.246) (-506.236) (-501.108) [-499.316] -- 0:02:30
20000 -- [-498.837] (-505.590) (-504.250) (-505.039) * (-500.417) (-509.357) (-500.888) [-501.011] -- 0:02:27
Average standard deviation of split frequencies: 0.060826
20500 -- (-498.637) (-500.049) [-499.585] (-505.398) * [-495.582] (-508.923) (-511.770) (-497.735) -- 0:02:23
21000 -- (-504.003) [-501.104] (-501.191) (-497.569) * (-503.386) (-507.011) [-507.063] (-499.903) -- 0:02:19
21500 -- (-501.523) (-504.880) [-499.038] (-500.940) * (-505.083) (-509.340) (-501.193) [-500.024] -- 0:02:16
22000 -- (-501.265) (-499.224) (-502.260) [-497.797] * (-507.353) (-513.276) (-507.748) [-501.381] -- 0:02:13
22500 -- [-502.229] (-501.913) (-498.104) (-499.610) * (-503.366) [-502.410] (-506.913) (-500.850) -- 0:02:10
23000 -- (-499.800) (-500.101) [-500.665] (-502.034) * (-502.206) [-504.771] (-503.488) (-505.107) -- 0:02:07
23500 -- (-497.966) (-502.710) (-502.363) [-501.394] * (-498.534) (-507.513) [-504.534] (-497.331) -- 0:02:04
24000 -- [-497.155] (-502.910) (-506.536) (-505.750) * (-503.061) (-504.840) (-505.705) [-503.615] -- 0:02:02
24500 -- (-500.875) (-504.104) [-502.577] (-503.842) * [-498.523] (-506.470) (-507.523) (-498.383) -- 0:01:59
25000 -- (-499.555) [-500.794] (-503.192) (-498.402) * [-500.515] (-509.848) (-512.361) (-504.014) -- 0:01:57
Average standard deviation of split frequencies: 0.027196
25500 -- (-510.185) (-504.931) [-503.125] (-504.747) * (-503.906) (-508.449) (-502.949) [-501.673] -- 0:01:54
26000 -- (-502.673) (-502.963) (-496.358) [-501.500] * (-500.792) (-502.612) (-504.615) [-501.299] -- 0:01:52
26500 -- (-499.087) (-506.133) (-499.782) [-506.163] * (-503.414) (-501.783) (-509.984) [-500.479] -- 0:01:50
27000 -- [-504.013] (-504.293) (-496.570) (-504.171) * (-503.000) (-502.654) (-508.971) [-496.339] -- 0:02:24
27500 -- (-508.352) [-504.060] (-498.534) (-503.210) * (-503.264) [-508.125] (-506.678) (-502.523) -- 0:02:21
28000 -- (-507.909) (-505.834) (-503.580) [-498.383] * [-506.292] (-501.311) (-501.605) (-500.069) -- 0:02:18
28500 -- (-501.064) [-501.516] (-499.811) (-502.716) * [-506.906] (-504.701) (-501.154) (-501.098) -- 0:02:16
29000 -- [-500.807] (-506.135) (-502.538) (-507.792) * (-502.433) (-502.875) [-499.461] (-510.694) -- 0:02:13
29500 -- (-501.372) (-502.623) [-499.631] (-508.125) * (-507.887) (-502.595) (-500.147) [-502.612] -- 0:02:11
30000 -- (-502.920) [-502.140] (-502.837) (-506.079) * (-501.241) (-501.101) (-499.760) [-503.130] -- 0:02:09
Average standard deviation of split frequencies: 0.025620
30500 -- (-503.368) [-505.982] (-500.626) (-504.242) * [-500.336] (-505.964) (-503.502) (-500.791) -- 0:02:07
31000 -- (-502.046) [-500.881] (-502.666) (-503.229) * (-502.813) (-503.647) [-508.211] (-508.509) -- 0:02:05
31500 -- [-500.287] (-501.818) (-501.830) (-504.104) * [-503.382] (-506.903) (-503.256) (-504.119) -- 0:02:02
32000 -- (-503.787) (-500.584) (-504.113) [-512.263] * (-507.986) (-509.268) (-499.201) [-500.928] -- 0:02:01
32500 -- (-508.571) (-502.617) [-500.075] (-505.670) * [-502.501] (-507.593) (-496.908) (-499.435) -- 0:01:59
33000 -- (-505.489) (-500.326) (-505.720) [-504.232] * [-504.756] (-504.793) (-495.412) (-501.839) -- 0:01:57
33500 -- [-502.380] (-504.282) (-499.671) (-504.685) * (-499.782) (-508.846) (-501.771) [-498.416] -- 0:01:55
34000 -- [-502.759] (-500.637) (-509.436) (-504.951) * [-501.404] (-506.047) (-506.946) (-500.239) -- 0:01:53
34500 -- (-501.098) (-501.096) [-503.176] (-499.614) * [-499.678] (-508.277) (-498.683) (-497.210) -- 0:01:51
35000 -- (-501.922) (-502.077) [-500.712] (-500.858) * [-498.717] (-511.254) (-500.866) (-502.353) -- 0:01:50
Average standard deviation of split frequencies: 0.013095
35500 -- (-499.171) [-498.414] (-506.032) (-498.756) * (-501.067) (-504.648) (-501.477) [-495.688] -- 0:01:48
36000 -- (-504.095) [-500.870] (-507.335) (-503.222) * [-496.952] (-502.547) (-499.434) (-499.189) -- 0:01:47
36500 -- (-510.627) [-503.031] (-503.055) (-502.627) * (-500.444) (-507.423) (-503.003) [-503.316] -- 0:01:45
37000 -- (-497.811) (-500.597) [-506.864] (-508.164) * (-499.749) (-504.756) (-500.430) [-503.956] -- 0:02:10
37500 -- [-502.075] (-502.852) (-504.773) (-502.824) * [-499.758] (-497.571) (-503.562) (-500.010) -- 0:02:08
38000 -- (-501.015) (-504.130) [-502.471] (-501.469) * (-502.444) (-499.290) (-505.686) [-497.671] -- 0:02:06
38500 -- (-497.107) (-498.534) [-499.579] (-503.466) * (-507.348) [-496.698] (-498.207) (-501.441) -- 0:02:04
39000 -- (-498.492) (-504.749) [-498.040] (-500.281) * (-502.861) (-497.834) [-500.703] (-506.262) -- 0:02:03
39500 -- (-500.859) [-501.433] (-504.673) (-499.845) * [-499.480] (-502.959) (-503.175) (-507.605) -- 0:02:01
40000 -- (-503.829) (-500.385) (-506.938) [-503.029] * (-501.291) (-501.740) [-500.628] (-496.354) -- 0:02:00
Average standard deviation of split frequencies: 0.034776
40500 -- (-504.182) [-500.303] (-498.506) (-501.762) * (-506.953) (-502.260) (-503.540) [-496.582] -- 0:01:58
41000 -- (-501.834) (-499.390) (-503.316) [-500.046] * (-499.451) (-501.618) (-502.312) [-497.524] -- 0:01:56
41500 -- (-502.547) (-506.305) (-505.979) [-498.985] * (-499.076) [-503.072] (-506.866) (-500.288) -- 0:01:55
42000 -- (-499.796) (-498.749) (-502.195) [-498.858] * (-507.227) (-500.879) (-506.242) [-501.105] -- 0:01:54
42500 -- [-496.617] (-504.164) (-499.163) (-501.944) * (-498.236) (-503.136) (-500.969) [-499.158] -- 0:01:52
43000 -- (-500.826) (-502.187) (-501.941) [-497.064] * [-496.995] (-502.548) (-504.582) (-498.238) -- 0:01:51
43500 -- (-499.418) (-501.507) (-501.512) [-498.508] * (-499.236) [-500.276] (-499.779) (-498.558) -- 0:01:49
44000 -- (-499.557) (-501.392) [-502.389] (-506.769) * (-501.307) (-504.138) (-500.627) [-499.660] -- 0:01:48
44500 -- (-496.691) (-498.643) [-498.020] (-501.422) * (-498.285) (-505.590) [-495.855] (-498.654) -- 0:01:47
45000 -- (-501.867) (-503.557) (-500.949) [-505.309] * (-502.073) (-503.645) (-498.893) [-495.419] -- 0:01:46
Average standard deviation of split frequencies: 0.023912
45500 -- (-503.986) (-500.586) (-499.796) [-502.547] * (-502.749) (-502.010) (-506.210) [-499.018] -- 0:01:44
46000 -- (-497.720) (-502.509) (-499.607) [-498.969] * [-500.915] (-503.932) (-501.134) (-500.511) -- 0:01:43
46500 -- (-497.276) (-501.291) [-500.259] (-499.332) * [-500.343] (-502.255) (-504.275) (-498.573) -- 0:01:42
47000 -- (-500.105) (-502.258) (-501.940) [-501.245] * (-504.306) (-501.241) [-504.451] (-506.308) -- 0:01:41
47500 -- (-499.271) [-501.419] (-506.532) (-504.307) * (-505.144) [-502.815] (-505.427) (-503.807) -- 0:02:00
48000 -- [-498.529] (-498.083) (-505.574) (-508.269) * [-504.692] (-504.925) (-503.470) (-503.492) -- 0:01:59
48500 -- (-502.005) (-502.628) [-504.612] (-508.647) * (-506.958) (-494.887) [-504.211] (-502.226) -- 0:01:57
49000 -- (-503.823) [-499.877] (-498.105) (-508.629) * (-504.353) (-499.745) [-504.495] (-504.425) -- 0:01:56
49500 -- (-498.386) (-500.377) [-507.143] (-509.182) * [-504.293] (-498.788) (-500.216) (-503.006) -- 0:01:55
50000 -- (-502.149) (-500.389) (-504.011) [-508.822] * (-505.313) (-508.288) (-500.135) [-499.671] -- 0:01:54
Average standard deviation of split frequencies: 0.031013
50500 -- (-502.534) (-498.525) (-502.816) [-510.366] * (-502.240) [-500.824] (-499.588) (-503.684) -- 0:01:52
51000 -- [-502.178] (-498.769) (-508.386) (-508.999) * (-503.886) (-501.295) (-501.625) [-497.870] -- 0:01:51
51500 -- (-502.767) [-499.517] (-502.444) (-508.860) * (-501.722) (-501.012) (-499.639) [-498.901] -- 0:01:50
52000 -- (-502.369) (-501.225) [-504.662] (-504.297) * (-501.342) [-503.551] (-502.522) (-503.856) -- 0:01:49
52500 -- (-507.529) [-500.831] (-499.138) (-500.675) * (-502.884) (-503.463) [-503.882] (-503.193) -- 0:01:48
53000 -- [-501.950] (-495.336) (-500.751) (-504.144) * (-502.063) (-505.844) (-511.553) [-503.678] -- 0:01:47
53500 -- (-502.531) (-501.930) (-498.519) [-502.725] * (-503.717) [-503.375] (-509.610) (-500.724) -- 0:01:46
54000 -- (-510.382) (-501.150) [-500.496] (-502.392) * [-500.693] (-501.636) (-505.034) (-502.439) -- 0:01:45
54500 -- (-506.145) (-500.564) [-497.097] (-509.185) * (-505.054) (-500.013) (-507.056) [-496.955] -- 0:01:44
55000 -- (-502.759) [-500.703] (-501.304) (-501.829) * (-503.336) [-500.900] (-506.289) (-502.325) -- 0:01:43
Average standard deviation of split frequencies: 0.019642
55500 -- (-503.508) (-502.872) (-498.137) [-498.657] * (-502.661) (-502.652) [-498.468] (-508.154) -- 0:01:42
56000 -- [-498.588] (-501.378) (-498.643) (-503.402) * (-502.664) (-503.620) [-497.413] (-507.398) -- 0:01:41
56500 -- (-496.961) [-498.551] (-500.803) (-499.798) * (-505.830) (-504.336) [-503.500] (-507.572) -- 0:01:40
57000 -- (-498.922) (-499.437) [-498.229] (-510.828) * [-502.557] (-499.660) (-501.991) (-509.244) -- 0:01:39
57500 -- [-502.446] (-496.979) (-504.869) (-502.984) * (-510.116) [-503.577] (-503.602) (-517.324) -- 0:01:54
58000 -- (-498.500) (-496.392) (-504.466) [-496.132] * (-510.649) (-499.857) [-498.759] (-505.638) -- 0:01:53
58500 -- [-502.067] (-499.318) (-504.377) (-503.047) * (-506.598) (-496.434) [-501.143] (-509.903) -- 0:01:52
59000 -- [-505.707] (-496.328) (-507.076) (-504.775) * (-507.409) [-502.616] (-502.607) (-510.498) -- 0:01:51
59500 -- (-505.253) [-497.726] (-503.131) (-498.182) * (-506.714) (-497.378) (-500.801) [-507.903] -- 0:01:50
60000 -- [-504.293] (-499.701) (-500.578) (-498.463) * [-504.178] (-498.468) (-500.410) (-503.061) -- 0:01:49
Average standard deviation of split frequencies: 0.018131
60500 -- (-504.460) [-497.644] (-499.119) (-502.202) * (-507.297) [-497.880] (-501.696) (-505.310) -- 0:01:48
61000 -- (-502.378) [-497.841] (-502.146) (-501.603) * (-501.228) (-500.647) [-502.589] (-506.804) -- 0:01:47
61500 -- (-503.419) (-504.434) [-502.087] (-498.497) * (-503.980) [-499.943] (-501.583) (-503.227) -- 0:01:46
62000 -- (-505.117) [-499.207] (-498.980) (-504.158) * (-510.635) (-497.896) [-499.202] (-503.634) -- 0:01:45
62500 -- [-501.575] (-506.380) (-501.665) (-501.021) * (-499.445) (-503.937) [-502.888] (-504.171) -- 0:01:45
63000 -- [-505.963] (-500.578) (-499.424) (-506.042) * (-501.562) [-499.393] (-507.487) (-507.024) -- 0:01:44
63500 -- (-508.303) (-503.035) (-499.327) [-500.358] * [-498.918] (-498.977) (-500.521) (-501.771) -- 0:01:43
64000 -- [-509.719] (-504.429) (-501.115) (-497.744) * (-502.722) (-500.263) (-502.009) [-505.930] -- 0:01:42
64500 -- [-500.047] (-507.797) (-503.193) (-499.901) * [-498.750] (-498.719) (-503.919) (-506.424) -- 0:01:41
65000 -- (-509.265) (-506.784) [-497.401] (-502.439) * (-499.386) (-502.769) (-500.349) [-502.316] -- 0:01:40
Average standard deviation of split frequencies: 0.011904
65500 -- [-501.881] (-499.714) (-499.898) (-501.463) * (-509.277) (-503.704) [-497.145] (-500.971) -- 0:01:39
66000 -- [-503.870] (-502.210) (-499.802) (-501.516) * (-504.045) (-500.794) [-501.340] (-498.325) -- 0:01:39
66500 -- (-502.897) (-501.523) [-502.211] (-503.362) * (-503.323) (-495.085) [-497.891] (-501.183) -- 0:01:38
67000 -- (-504.685) (-501.685) (-502.335) [-499.645] * (-502.679) (-501.562) (-499.959) [-498.595] -- 0:01:37
67500 -- (-509.942) (-502.601) [-502.228] (-500.748) * [-502.715] (-506.011) (-505.028) (-497.255) -- 0:01:36
68000 -- (-507.713) (-505.066) (-506.037) [-497.568] * (-503.732) [-505.002] (-500.868) (-503.945) -- 0:01:49
68500 -- (-512.010) [-503.874] (-514.132) (-499.925) * (-503.471) (-501.787) (-500.278) [-498.194] -- 0:01:48
69000 -- (-510.538) (-499.690) [-502.566] (-501.877) * (-497.077) (-505.146) [-501.794] (-498.497) -- 0:01:47
69500 -- (-501.268) (-503.176) (-503.142) [-500.613] * (-500.191) [-501.241] (-502.166) (-502.495) -- 0:01:47
70000 -- (-504.517) (-497.779) (-497.646) [-497.069] * (-500.810) [-501.870] (-504.845) (-498.987) -- 0:01:46
Average standard deviation of split frequencies: 0.008894
70500 -- (-510.798) (-501.723) (-498.615) [-499.865] * (-502.265) (-503.053) [-501.805] (-502.547) -- 0:01:45
71000 -- (-503.742) (-501.431) [-500.548] (-498.525) * [-499.034] (-504.713) (-505.545) (-517.791) -- 0:01:44
71500 -- (-502.727) [-497.073] (-496.577) (-505.722) * [-495.465] (-508.667) (-499.861) (-503.863) -- 0:01:43
72000 -- (-500.803) [-502.054] (-498.308) (-502.336) * [-498.782] (-504.403) (-503.505) (-502.872) -- 0:01:43
72500 -- (-507.951) (-500.227) (-497.506) [-501.172] * (-494.351) (-503.300) (-501.847) [-499.463] -- 0:01:42
73000 -- [-506.549] (-497.327) (-505.613) (-498.290) * (-494.606) (-504.429) (-499.765) [-498.755] -- 0:01:41
73500 -- (-507.220) (-497.211) (-502.841) [-496.958] * (-499.930) (-510.648) (-500.531) [-502.317] -- 0:01:40
74000 -- (-499.321) (-498.334) (-508.622) [-496.577] * (-498.012) (-501.961) [-501.457] (-501.541) -- 0:01:40
74500 -- (-508.827) (-498.305) [-503.093] (-494.768) * (-500.545) [-496.406] (-496.844) (-505.949) -- 0:01:39
75000 -- (-504.539) (-503.476) (-501.127) [-497.902] * (-498.226) (-502.223) [-502.932] (-499.625) -- 0:01:38
Average standard deviation of split frequencies: 0.004135
75500 -- [-504.334] (-499.367) (-503.350) (-494.857) * [-497.126] (-498.701) (-502.429) (-499.995) -- 0:01:37
76000 -- (-496.732) (-501.770) [-500.843] (-499.701) * [-501.849] (-504.347) (-499.720) (-499.395) -- 0:01:37
76500 -- [-501.039] (-499.826) (-499.200) (-499.210) * (-505.012) (-503.655) (-499.681) [-500.221] -- 0:01:36
77000 -- (-504.115) (-502.284) [-503.678] (-500.076) * (-498.056) [-501.334] (-500.906) (-503.968) -- 0:01:35
77500 -- [-501.900] (-500.959) (-501.010) (-504.134) * (-499.248) (-497.942) [-498.061] (-502.573) -- 0:01:35
78000 -- (-502.305) (-503.280) [-498.757] (-505.990) * (-500.980) (-501.778) (-498.200) [-504.057] -- 0:01:34
78500 -- (-502.265) (-501.194) [-500.804] (-497.831) * (-499.989) (-497.610) [-501.208] (-504.790) -- 0:01:45
79000 -- (-502.108) (-504.336) [-500.446] (-503.861) * (-497.541) (-498.923) [-498.179] (-507.076) -- 0:01:44
79500 -- [-495.700] (-505.332) (-506.180) (-499.326) * (-497.137) (-498.741) (-500.029) [-501.351] -- 0:01:44
80000 -- (-503.326) (-502.954) (-499.551) [-496.877] * (-500.763) (-504.352) (-503.926) [-495.544] -- 0:01:43
Average standard deviation of split frequencies: 0.003896
80500 -- (-499.268) (-510.123) (-502.340) [-498.736] * [-497.236] (-511.281) (-495.951) (-496.523) -- 0:01:42
81000 -- [-502.467] (-500.340) (-500.015) (-502.259) * (-502.006) (-499.508) [-504.257] (-498.075) -- 0:01:42
81500 -- [-499.761] (-499.172) (-502.204) (-501.470) * (-509.103) (-504.363) [-497.057] (-499.921) -- 0:01:41
82000 -- (-500.070) [-510.117] (-499.202) (-501.533) * (-504.633) (-501.617) (-498.266) [-500.237] -- 0:01:40
82500 -- (-500.129) [-502.228] (-497.039) (-500.185) * (-497.282) (-506.943) [-498.699] (-504.236) -- 0:01:40
83000 -- (-500.800) (-503.930) [-500.442] (-503.467) * (-498.600) (-506.602) (-506.235) [-498.703] -- 0:01:39
83500 -- (-500.193) [-502.370] (-501.425) (-499.242) * (-500.574) (-498.753) (-502.747) [-499.661] -- 0:01:38
84000 -- (-499.963) [-497.889] (-508.782) (-500.651) * (-503.721) [-498.851] (-498.387) (-498.775) -- 0:01:38
84500 -- (-504.182) (-501.277) [-502.196] (-506.330) * (-506.006) (-505.225) [-499.784] (-497.766) -- 0:01:37
85000 -- (-502.830) [-501.581] (-505.758) (-505.417) * (-501.791) (-501.707) [-500.072] (-508.220) -- 0:01:36
Average standard deviation of split frequencies: 0.007309
85500 -- (-501.434) [-502.075] (-502.619) (-499.273) * (-506.639) (-504.554) [-501.206] (-498.768) -- 0:01:36
86000 -- (-506.446) (-500.146) [-502.794] (-500.064) * (-502.911) [-499.659] (-500.626) (-502.479) -- 0:01:35
86500 -- (-503.506) (-501.557) [-505.059] (-506.524) * (-499.016) [-499.864] (-498.902) (-511.361) -- 0:01:35
87000 -- (-506.712) [-500.500] (-507.698) (-499.596) * [-497.113] (-499.595) (-502.007) (-505.695) -- 0:01:34
87500 -- [-504.864] (-505.964) (-506.898) (-501.828) * [-500.496] (-502.185) (-499.439) (-505.667) -- 0:01:33
88000 -- [-504.044] (-502.839) (-508.607) (-500.755) * (-505.276) (-498.188) [-496.773] (-512.412) -- 0:01:33
88500 -- [-500.131] (-500.202) (-503.991) (-508.539) * [-504.322] (-501.329) (-498.012) (-502.121) -- 0:01:32
89000 -- (-501.197) (-498.932) (-500.895) [-500.913] * (-505.289) (-502.584) (-501.588) [-504.078] -- 0:01:42
89500 -- (-505.375) [-499.544] (-500.425) (-507.775) * [-502.887] (-499.795) (-500.105) (-499.023) -- 0:01:41
90000 -- [-497.833] (-497.060) (-501.285) (-507.224) * (-500.832) (-503.940) [-500.024] (-499.520) -- 0:01:41
Average standard deviation of split frequencies: 0.008666
90500 -- (-503.300) [-498.021] (-498.378) (-503.359) * (-502.724) [-501.113] (-500.934) (-501.722) -- 0:01:40
91000 -- (-502.777) (-499.327) (-504.075) [-505.567] * (-503.687) (-496.813) (-504.646) [-502.673] -- 0:01:39
91500 -- (-506.410) [-500.887] (-502.739) (-500.564) * [-500.464] (-498.642) (-501.440) (-501.664) -- 0:01:39
92000 -- (-504.935) [-499.271] (-498.627) (-500.966) * (-501.157) (-498.247) (-507.307) [-498.690] -- 0:01:38
92500 -- (-499.138) (-502.099) [-498.641] (-500.303) * (-499.549) [-498.939] (-503.631) (-496.361) -- 0:01:38
93000 -- (-503.212) (-497.748) [-496.684] (-501.011) * (-498.762) (-505.890) [-502.022] (-499.243) -- 0:01:37
93500 -- (-502.860) (-501.133) (-505.544) [-504.053] * (-504.996) (-502.564) (-501.090) [-506.963] -- 0:01:36
94000 -- (-502.404) [-501.788] (-499.933) (-503.307) * (-506.454) (-500.257) (-498.800) [-497.782] -- 0:01:36
94500 -- (-509.260) (-502.825) (-497.781) [-498.908] * (-500.482) (-499.212) (-497.244) [-499.720] -- 0:01:35
95000 -- (-510.631) [-501.713] (-500.258) (-501.568) * (-502.546) (-498.881) [-503.628] (-499.409) -- 0:01:35
Average standard deviation of split frequencies: 0.006547
95500 -- (-501.802) (-503.633) (-499.148) [-497.931] * (-504.432) [-496.846] (-510.080) (-505.447) -- 0:01:34
96000 -- (-512.286) (-502.309) [-498.847] (-504.506) * (-501.053) (-500.672) [-509.952] (-501.133) -- 0:01:34
96500 -- (-500.755) [-501.349] (-506.015) (-501.868) * (-500.072) [-501.922] (-503.445) (-497.701) -- 0:01:33
97000 -- (-503.387) (-507.944) (-501.959) [-502.636] * (-504.003) [-504.630] (-496.959) (-505.474) -- 0:01:33
97500 -- (-510.741) (-501.952) [-504.570] (-501.891) * (-501.289) (-505.070) (-502.292) [-504.056] -- 0:01:32
98000 -- (-503.794) (-498.616) [-501.514] (-503.367) * (-499.030) [-500.487] (-499.938) (-502.444) -- 0:01:32
98500 -- (-505.818) (-498.164) (-496.835) [-499.415] * (-499.805) (-505.577) (-498.950) [-499.782] -- 0:01:31
99000 -- (-507.758) (-499.217) [-497.551] (-504.423) * [-496.220] (-504.320) (-501.846) (-500.921) -- 0:01:40
99500 -- (-504.640) (-506.512) [-497.521] (-506.560) * [-499.569] (-506.495) (-503.899) (-497.100) -- 0:01:39
100000 -- (-498.650) [-503.343] (-500.893) (-501.698) * (-500.089) (-500.873) [-501.614] (-504.129) -- 0:01:39
Average standard deviation of split frequencies: 0.003122
100500 -- (-501.371) [-506.748] (-501.649) (-507.748) * (-505.783) (-499.831) [-499.317] (-499.371) -- 0:01:38
101000 -- (-503.162) [-508.487] (-507.545) (-500.479) * (-500.052) (-506.302) [-505.271] (-501.959) -- 0:01:37
101500 -- (-501.863) (-506.550) (-503.350) [-500.506] * (-500.829) (-499.305) [-499.898] (-507.970) -- 0:01:37
102000 -- (-506.118) (-503.881) [-499.500] (-498.241) * (-503.885) (-507.926) [-500.791] (-505.561) -- 0:01:36
102500 -- (-504.473) (-499.213) (-499.702) [-497.767] * [-500.823] (-503.121) (-507.032) (-500.577) -- 0:01:36
103000 -- (-505.033) (-498.225) (-499.482) [-498.117] * (-501.678) (-510.075) (-500.401) [-498.834] -- 0:01:35
103500 -- (-505.261) (-503.264) (-504.559) [-496.564] * [-497.128] (-506.027) (-506.291) (-507.894) -- 0:01:35
104000 -- (-506.604) (-506.392) (-502.844) [-498.536] * (-496.788) [-503.797] (-501.329) (-502.145) -- 0:01:34
104500 -- (-499.829) [-499.203] (-500.714) (-503.394) * (-497.677) (-503.536) [-503.543] (-508.523) -- 0:01:34
105000 -- (-509.147) (-501.126) (-499.419) [-503.295] * [-502.210] (-503.073) (-504.203) (-505.442) -- 0:01:33
Average standard deviation of split frequencies: 0.005930
105500 -- (-502.270) [-499.231] (-501.487) (-497.627) * (-500.477) (-501.940) (-502.252) [-502.240] -- 0:01:33
106000 -- (-501.626) [-497.882] (-502.925) (-501.710) * (-501.056) [-499.591] (-504.855) (-502.769) -- 0:01:32
106500 -- (-499.546) [-502.522] (-507.975) (-498.956) * [-501.214] (-501.886) (-504.780) (-505.838) -- 0:01:32
107000 -- (-497.651) (-503.613) (-501.555) [-501.938] * (-502.889) (-501.443) [-496.265] (-506.472) -- 0:01:31
107500 -- [-499.241] (-500.020) (-502.938) (-498.376) * (-511.216) [-502.820] (-499.079) (-514.703) -- 0:01:31
108000 -- (-499.678) (-503.986) (-502.825) [-498.978] * (-500.744) [-501.375] (-503.509) (-511.767) -- 0:01:30
108500 -- [-497.942] (-502.940) (-502.253) (-500.687) * (-507.855) (-507.879) (-501.145) [-506.474] -- 0:01:30
109000 -- (-499.788) [-504.282] (-503.684) (-500.812) * [-500.662] (-507.435) (-508.160) (-509.252) -- 0:01:38
109500 -- (-501.808) [-504.154] (-499.415) (-501.138) * [-496.358] (-515.528) (-501.636) (-501.596) -- 0:01:37
110000 -- (-499.561) [-498.682] (-502.454) (-499.592) * [-498.390] (-504.763) (-499.960) (-504.060) -- 0:01:37
Average standard deviation of split frequencies: 0.004260
110500 -- [-500.089] (-500.612) (-503.401) (-508.445) * [-498.447] (-500.341) (-501.912) (-507.477) -- 0:01:36
111000 -- [-503.457] (-500.505) (-502.128) (-500.663) * (-499.573) (-510.172) (-501.310) [-503.325] -- 0:01:36
111500 -- (-504.671) [-499.160] (-505.517) (-505.507) * (-504.556) (-504.207) [-498.801] (-506.491) -- 0:01:35
112000 -- (-502.052) (-499.985) [-499.147] (-498.697) * (-504.589) (-502.339) [-501.019] (-506.890) -- 0:01:35
112500 -- (-505.405) [-496.894] (-502.722) (-505.331) * [-500.907] (-504.384) (-503.685) (-506.606) -- 0:01:34
113000 -- (-501.565) (-505.516) (-499.414) [-505.546] * (-508.152) (-507.545) [-501.831] (-507.833) -- 0:01:34
113500 -- (-498.643) [-501.033] (-498.606) (-506.553) * [-503.110] (-505.111) (-502.860) (-504.379) -- 0:01:33
114000 -- (-496.798) (-500.374) (-496.423) [-500.829] * (-502.234) (-501.551) (-500.758) [-505.520] -- 0:01:33
114500 -- (-500.353) [-498.373] (-501.281) (-499.655) * (-504.504) (-503.708) (-497.701) [-503.589] -- 0:01:32
115000 -- (-496.511) (-501.070) (-507.211) [-499.598] * (-502.300) [-501.107] (-503.642) (-501.027) -- 0:01:32
Average standard deviation of split frequencies: 0.002709
115500 -- (-497.197) (-497.865) (-499.853) [-498.734] * (-503.116) (-500.632) (-504.316) [-504.261] -- 0:01:31
116000 -- (-500.641) (-496.615) (-504.513) [-499.130] * (-499.472) (-499.660) (-502.912) [-499.764] -- 0:01:31
116500 -- [-496.807] (-502.525) (-505.720) (-502.311) * (-498.866) (-499.958) (-497.998) [-501.343] -- 0:01:31
117000 -- (-499.019) [-500.631] (-503.326) (-502.505) * (-501.521) (-501.474) [-497.553] (-504.925) -- 0:01:30
117500 -- (-504.350) (-499.073) (-503.449) [-501.384] * (-506.529) [-498.279] (-504.823) (-503.137) -- 0:01:30
118000 -- [-502.842] (-497.248) (-504.792) (-499.954) * [-499.432] (-504.546) (-506.435) (-501.975) -- 0:01:29
118500 -- (-504.028) [-497.448] (-505.775) (-506.386) * (-501.853) (-499.682) [-502.150] (-508.164) -- 0:01:29
119000 -- (-508.300) (-500.591) [-502.324] (-507.646) * (-499.701) (-504.330) (-500.287) [-502.818] -- 0:01:28
119500 -- (-497.769) [-496.299] (-501.479) (-499.468) * (-501.449) (-511.544) (-497.979) [-501.130] -- 0:01:35
120000 -- (-501.590) (-495.691) (-508.684) [-501.919] * (-497.116) (-503.981) (-500.079) [-500.846] -- 0:01:35
Average standard deviation of split frequencies: 0.006511
120500 -- (-500.031) [-500.062] (-511.718) (-500.056) * (-498.840) (-498.896) [-501.824] (-502.139) -- 0:01:34
121000 -- (-499.262) (-502.473) (-507.653) [-503.486] * (-510.065) [-495.674] (-498.757) (-502.314) -- 0:01:34
121500 -- (-502.975) [-500.237] (-504.254) (-508.085) * (-503.944) (-500.267) [-498.055] (-504.653) -- 0:01:33
122000 -- (-499.737) (-502.698) (-510.317) [-500.553] * (-500.792) (-497.124) [-498.795] (-503.037) -- 0:01:33
122500 -- [-499.949] (-502.155) (-501.224) (-501.885) * [-498.019] (-499.230) (-500.844) (-500.209) -- 0:01:33
123000 -- (-508.830) [-505.294] (-503.763) (-509.959) * (-501.059) (-500.196) [-500.364] (-502.904) -- 0:01:32
123500 -- (-504.179) [-500.176] (-503.501) (-500.861) * [-501.393] (-504.017) (-497.579) (-504.597) -- 0:01:32
124000 -- (-498.877) [-505.826] (-507.588) (-501.161) * [-506.518] (-498.383) (-496.965) (-508.698) -- 0:01:31
124500 -- (-509.963) [-500.568] (-504.127) (-505.325) * (-505.077) (-497.758) (-497.668) [-504.716] -- 0:01:31
125000 -- (-503.782) (-499.330) [-503.922] (-496.805) * (-505.394) (-498.176) (-499.439) [-498.555] -- 0:01:31
Average standard deviation of split frequencies: 0.004988
125500 -- (-507.247) (-502.108) (-504.245) [-502.178] * (-508.997) (-499.107) (-500.443) [-497.289] -- 0:01:30
126000 -- (-507.418) [-500.308] (-503.499) (-501.579) * (-506.874) (-507.085) (-508.873) [-503.461] -- 0:01:30
126500 -- [-504.176] (-500.534) (-498.268) (-506.111) * (-503.980) [-499.737] (-504.522) (-504.152) -- 0:01:29
127000 -- [-500.247] (-500.559) (-505.205) (-504.077) * [-502.422] (-502.189) (-504.081) (-502.133) -- 0:01:29
127500 -- [-500.609] (-499.046) (-498.356) (-502.813) * [-508.668] (-505.065) (-500.221) (-497.025) -- 0:01:28
128000 -- (-498.925) (-498.768) [-499.316] (-501.595) * (-512.915) (-502.385) (-499.435) [-500.864] -- 0:01:28
128500 -- (-501.411) (-498.619) [-498.607] (-508.182) * (-500.701) (-503.253) [-497.717] (-502.839) -- 0:01:28
129000 -- (-504.933) (-498.085) (-504.189) [-504.038] * (-501.891) (-497.180) (-498.279) [-502.004] -- 0:01:27
129500 -- (-501.959) [-497.162] (-501.644) (-500.852) * (-502.108) (-503.093) (-499.621) [-499.513] -- 0:01:34
130000 -- [-500.378] (-502.031) (-503.613) (-502.243) * [-499.969] (-499.454) (-500.675) (-499.392) -- 0:01:33
Average standard deviation of split frequencies: 0.009621
130500 -- (-506.426) [-499.034] (-501.262) (-508.983) * (-507.646) (-499.232) (-506.629) [-502.861] -- 0:01:33
131000 -- [-502.333] (-505.061) (-503.074) (-505.894) * (-507.864) (-501.072) (-502.201) [-503.078] -- 0:01:32
131500 -- [-501.217] (-502.119) (-498.450) (-503.577) * (-500.763) [-499.299] (-509.755) (-501.888) -- 0:01:32
132000 -- [-504.222] (-508.715) (-500.851) (-505.410) * (-508.501) (-501.227) [-500.568] (-498.601) -- 0:01:32
132500 -- (-501.719) (-502.296) (-500.905) [-505.882] * (-501.032) [-496.078] (-507.134) (-498.973) -- 0:01:31
133000 -- (-503.191) (-506.429) [-499.678] (-506.443) * [-503.246] (-501.799) (-507.458) (-497.476) -- 0:01:31
133500 -- (-504.815) (-499.673) (-504.245) [-504.050] * (-495.933) (-496.604) (-507.542) [-498.336] -- 0:01:30
134000 -- (-505.134) (-503.022) (-506.565) [-502.287] * (-499.279) [-498.320] (-506.098) (-497.199) -- 0:01:30
134500 -- (-502.899) (-500.384) [-504.105] (-504.250) * (-504.697) (-498.991) (-499.256) [-500.640] -- 0:01:30
135000 -- (-510.991) (-499.397) [-504.942] (-503.477) * [-498.920] (-498.344) (-500.215) (-500.684) -- 0:01:29
Average standard deviation of split frequencies: 0.010399
135500 -- (-510.893) [-497.011] (-501.325) (-506.037) * (-504.796) (-499.326) [-502.439] (-505.808) -- 0:01:29
136000 -- (-511.053) [-498.716] (-501.949) (-500.866) * (-503.167) [-498.154] (-503.892) (-497.488) -- 0:01:28
136500 -- (-511.996) [-500.927] (-500.197) (-505.897) * [-504.863] (-510.299) (-506.483) (-505.743) -- 0:01:28
137000 -- (-509.808) [-498.520] (-505.799) (-501.848) * (-503.398) (-498.910) (-500.822) [-503.094] -- 0:01:28
137500 -- (-504.192) (-500.503) (-503.090) [-502.390] * [-498.385] (-507.701) (-499.121) (-501.259) -- 0:01:27
138000 -- (-510.199) (-508.352) (-500.618) [-510.036] * [-496.003] (-504.477) (-499.366) (-504.959) -- 0:01:27
138500 -- (-506.876) [-495.756] (-498.391) (-501.693) * [-497.837] (-501.167) (-499.552) (-504.237) -- 0:01:27
139000 -- (-505.327) [-498.366] (-500.234) (-504.901) * (-501.831) [-497.791] (-501.812) (-496.686) -- 0:01:26
139500 -- (-503.933) [-501.516] (-501.323) (-506.473) * (-500.357) [-498.427] (-501.270) (-502.531) -- 0:01:26
140000 -- (-502.183) [-501.018] (-499.828) (-500.336) * (-502.736) [-499.019] (-497.651) (-497.678) -- 0:01:32
Average standard deviation of split frequencies: 0.006702
140500 -- (-504.876) [-501.425] (-499.397) (-501.699) * [-495.609] (-502.726) (-497.581) (-498.698) -- 0:01:31
141000 -- (-507.770) [-498.223] (-498.348) (-500.999) * (-503.622) [-499.264] (-500.945) (-500.394) -- 0:01:31
141500 -- (-507.406) [-508.104] (-499.827) (-500.654) * (-502.016) (-503.690) (-498.059) [-501.526] -- 0:01:31
142000 -- (-505.101) (-503.551) [-500.837] (-501.087) * [-498.117] (-502.535) (-502.019) (-502.951) -- 0:01:30
142500 -- (-503.686) [-503.578] (-499.607) (-498.284) * (-496.509) [-500.295] (-498.806) (-503.484) -- 0:01:30
143000 -- (-503.021) [-497.136] (-501.434) (-504.115) * (-497.723) [-495.970] (-497.735) (-498.841) -- 0:01:29
143500 -- (-510.903) (-499.093) [-497.645] (-502.376) * [-500.839] (-500.729) (-500.374) (-505.504) -- 0:01:29
144000 -- (-501.236) (-498.477) (-500.922) [-503.325] * (-501.507) [-499.195] (-506.974) (-498.936) -- 0:01:29
144500 -- (-506.061) (-498.724) [-502.180] (-502.281) * (-506.855) [-498.465] (-502.582) (-499.436) -- 0:01:28
145000 -- (-502.558) (-506.322) (-497.257) [-499.678] * (-500.684) [-496.951] (-501.797) (-503.986) -- 0:01:28
Average standard deviation of split frequencies: 0.002153
145500 -- (-502.984) (-496.341) [-500.602] (-503.433) * (-500.620) (-499.884) (-504.020) [-498.955] -- 0:01:28
146000 -- (-504.714) [-497.847] (-502.547) (-505.870) * (-498.546) (-503.704) (-502.548) [-503.166] -- 0:01:27
146500 -- (-502.308) (-502.208) [-498.044] (-502.221) * [-500.689] (-498.314) (-500.661) (-498.503) -- 0:01:27
147000 -- (-502.972) (-500.173) (-499.353) [-499.421] * (-500.756) (-503.835) (-506.114) [-497.901] -- 0:01:27
147500 -- (-506.542) [-497.675] (-501.517) (-500.135) * (-496.542) (-510.614) [-501.116] (-499.641) -- 0:01:26
148000 -- (-506.136) (-498.130) [-498.243] (-496.648) * [-500.439] (-498.396) (-503.104) (-495.888) -- 0:01:26
148500 -- (-498.751) [-504.935] (-497.710) (-500.021) * (-503.720) (-499.603) (-502.891) [-499.835] -- 0:01:26
149000 -- (-501.994) [-505.766] (-500.616) (-495.231) * (-502.942) (-501.985) (-502.007) [-501.050] -- 0:01:25
149500 -- (-503.959) [-504.008] (-498.177) (-499.413) * [-499.296] (-502.878) (-499.867) (-501.021) -- 0:01:25
150000 -- (-507.578) [-497.652] (-497.477) (-500.051) * (-497.398) (-499.803) (-500.630) [-497.152] -- 0:01:25
Average standard deviation of split frequencies: 0.003129
150500 -- (-502.834) [-500.134] (-507.205) (-496.880) * (-505.232) (-501.912) [-500.821] (-501.670) -- 0:01:30
151000 -- (-502.184) [-500.938] (-502.325) (-499.822) * (-505.172) [-497.461] (-500.254) (-497.613) -- 0:01:29
151500 -- (-500.439) (-506.117) (-503.200) [-499.135] * (-500.413) (-500.360) [-505.116] (-506.523) -- 0:01:29
152000 -- (-500.002) [-500.933] (-500.531) (-496.603) * (-504.094) [-499.667] (-500.777) (-499.139) -- 0:01:29
152500 -- (-501.808) (-507.824) (-510.393) [-500.623] * (-497.422) [-501.430] (-496.212) (-497.948) -- 0:01:28
153000 -- [-501.599] (-498.476) (-502.641) (-501.792) * (-500.771) (-498.005) (-501.466) [-500.903] -- 0:01:28
153500 -- (-503.978) (-506.401) (-504.437) [-501.430] * [-497.564] (-496.626) (-500.100) (-496.818) -- 0:01:28
154000 -- (-501.823) (-499.499) (-503.756) [-497.511] * [-497.388] (-497.228) (-507.443) (-503.010) -- 0:01:27
154500 -- (-508.677) [-495.597] (-501.072) (-499.507) * [-499.543] (-500.698) (-506.524) (-501.419) -- 0:01:27
155000 -- (-504.625) (-507.627) (-499.018) [-503.459] * [-502.912] (-499.493) (-507.072) (-500.936) -- 0:01:27
Average standard deviation of split frequencies: 0.003022
155500 -- [-501.506] (-502.591) (-499.890) (-507.325) * [-500.590] (-502.679) (-507.520) (-499.681) -- 0:01:26
156000 -- (-503.108) (-502.171) (-501.605) [-506.394] * (-504.723) (-502.829) (-503.281) [-497.039] -- 0:01:26
156500 -- [-503.095] (-503.948) (-501.640) (-505.033) * (-505.606) [-498.372] (-500.092) (-496.193) -- 0:01:26
157000 -- (-501.064) (-502.075) [-498.588] (-509.996) * (-509.668) (-500.553) (-500.014) [-501.492] -- 0:01:25
157500 -- (-502.396) [-496.809] (-496.995) (-502.230) * (-504.859) (-503.231) (-503.359) [-504.648] -- 0:01:25
158000 -- [-501.088] (-502.342) (-500.242) (-508.368) * (-507.866) [-503.248] (-500.805) (-501.633) -- 0:01:25
158500 -- (-503.782) (-500.417) [-496.653] (-499.974) * [-501.636] (-498.633) (-500.915) (-498.117) -- 0:01:24
159000 -- (-502.280) (-501.684) (-504.377) [-499.648] * (-505.359) (-500.680) [-504.681] (-498.806) -- 0:01:24
159500 -- (-497.501) (-498.857) [-501.680] (-502.035) * (-500.660) (-504.631) [-504.882] (-501.746) -- 0:01:24
160000 -- (-501.110) (-497.312) (-501.425) [-501.474] * (-504.697) (-499.729) (-497.556) [-504.880] -- 0:01:24
Average standard deviation of split frequencies: 0.002934
160500 -- (-507.185) (-496.418) (-501.312) [-504.834] * (-504.961) (-502.072) (-507.388) [-503.401] -- 0:01:28
161000 -- (-504.637) (-505.119) [-504.937] (-501.889) * (-499.571) (-503.477) (-505.755) [-500.420] -- 0:01:28
161500 -- [-501.784] (-500.159) (-501.213) (-509.244) * (-510.406) [-501.330] (-503.533) (-502.825) -- 0:01:28
162000 -- [-502.023] (-497.716) (-501.172) (-506.132) * (-507.297) [-499.120] (-499.958) (-498.973) -- 0:01:27
162500 -- (-502.395) (-499.259) [-503.949] (-508.609) * (-501.004) (-500.766) (-501.558) [-498.993] -- 0:01:27
163000 -- [-501.276] (-505.028) (-502.625) (-505.034) * (-509.203) (-502.026) (-502.176) [-501.814] -- 0:01:27
163500 -- [-497.967] (-496.959) (-505.509) (-502.802) * (-501.290) (-502.198) (-509.558) [-499.663] -- 0:01:26
164000 -- [-501.767] (-495.333) (-497.034) (-501.950) * (-509.743) [-497.815] (-505.033) (-499.135) -- 0:01:26
164500 -- (-504.060) (-496.716) [-498.411] (-511.264) * (-501.169) (-499.880) (-500.052) [-499.074] -- 0:01:26
165000 -- [-499.968] (-497.921) (-499.117) (-506.839) * (-500.515) [-501.864] (-501.485) (-504.396) -- 0:01:26
Average standard deviation of split frequencies: 0.002840
165500 -- (-501.396) (-498.728) [-498.651] (-508.192) * [-498.692] (-510.293) (-503.180) (-500.220) -- 0:01:25
166000 -- (-499.076) (-498.701) (-503.311) [-505.915] * (-502.401) (-507.959) (-499.581) [-502.617] -- 0:01:25
166500 -- (-501.644) [-501.596] (-503.962) (-512.255) * (-508.754) (-511.312) (-498.523) [-498.016] -- 0:01:25
167000 -- (-499.555) (-505.581) (-498.555) [-499.485] * (-504.475) [-506.708] (-500.975) (-505.533) -- 0:01:24
167500 -- (-501.367) (-506.443) (-506.744) [-497.695] * (-509.558) [-504.495] (-506.233) (-499.775) -- 0:01:24
168000 -- (-505.818) (-504.937) [-495.153] (-501.062) * (-504.694) [-508.522] (-505.851) (-499.066) -- 0:01:24
168500 -- [-505.657] (-510.589) (-497.126) (-500.674) * (-505.949) (-504.609) (-502.932) [-497.544] -- 0:01:23
169000 -- (-507.799) (-504.087) [-495.050] (-500.094) * (-508.009) (-508.388) (-503.127) [-505.014] -- 0:01:23
169500 -- (-503.162) (-507.224) [-499.777] (-504.313) * (-506.807) (-508.002) (-506.109) [-503.837] -- 0:01:23
170000 -- (-503.820) (-502.499) (-497.908) [-500.670] * (-505.756) (-504.823) (-498.882) [-498.355] -- 0:01:23
Average standard deviation of split frequencies: 0.001841
170500 -- [-503.745] (-503.360) (-501.155) (-502.884) * (-502.082) (-505.784) [-500.409] (-501.638) -- 0:01:27
171000 -- (-502.683) (-498.223) [-502.671] (-505.442) * (-508.711) (-504.023) (-499.670) [-501.303] -- 0:01:27
171500 -- (-504.872) [-500.633] (-503.599) (-505.983) * (-501.138) (-500.825) [-497.408] (-500.975) -- 0:01:26
172000 -- [-506.115] (-504.197) (-501.627) (-502.454) * (-507.290) [-497.884] (-504.209) (-501.706) -- 0:01:26
172500 -- (-507.667) (-503.250) (-498.304) [-507.250] * (-499.064) [-499.075] (-503.040) (-502.603) -- 0:01:26
173000 -- (-508.716) (-505.058) [-500.498] (-501.315) * (-499.138) [-500.565] (-504.167) (-499.511) -- 0:01:26
173500 -- [-503.536] (-503.180) (-501.377) (-498.695) * [-499.816] (-498.073) (-497.083) (-500.261) -- 0:01:25
174000 -- (-506.077) (-502.472) [-500.903] (-501.344) * (-501.038) (-512.446) (-503.497) [-498.249] -- 0:01:25
174500 -- (-505.749) (-501.912) [-500.352] (-507.572) * (-497.738) (-501.089) (-508.474) [-499.329] -- 0:01:25
175000 -- (-506.975) (-500.057) [-505.530] (-498.110) * (-505.779) (-500.245) (-508.910) [-499.783] -- 0:01:24
Average standard deviation of split frequencies: 0.001786
175500 -- [-502.784] (-500.713) (-501.547) (-502.374) * [-497.554] (-498.020) (-500.461) (-508.927) -- 0:01:24
176000 -- (-501.113) (-507.114) [-499.854] (-505.162) * [-497.384] (-498.820) (-502.102) (-500.707) -- 0:01:24
176500 -- (-504.337) (-500.583) [-499.821] (-497.607) * [-501.379] (-502.988) (-508.232) (-502.538) -- 0:01:23
177000 -- (-504.228) [-500.333] (-501.492) (-499.413) * (-503.884) (-500.140) [-501.209] (-501.304) -- 0:01:23
177500 -- (-506.101) [-503.936] (-500.740) (-500.721) * [-500.601] (-504.549) (-503.733) (-506.244) -- 0:01:23
178000 -- (-505.315) (-501.990) [-501.503] (-499.411) * (-504.170) [-500.707] (-503.758) (-504.012) -- 0:01:23
178500 -- [-499.757] (-500.672) (-503.020) (-502.344) * (-499.625) (-501.130) [-500.815] (-501.699) -- 0:01:22
179000 -- (-499.287) [-498.170] (-502.861) (-505.765) * (-501.373) [-497.463] (-503.462) (-504.212) -- 0:01:22
179500 -- (-499.620) (-505.388) (-499.888) [-507.664] * (-499.697) [-501.242] (-501.308) (-503.157) -- 0:01:22
180000 -- (-499.636) [-502.977] (-501.476) (-501.762) * (-509.311) [-501.954] (-499.993) (-506.038) -- 0:01:22
Average standard deviation of split frequencies: 0.001740
180500 -- [-499.152] (-503.594) (-500.853) (-504.561) * (-501.114) (-499.668) (-506.031) [-504.714] -- 0:01:21
181000 -- [-500.004] (-497.658) (-497.904) (-503.748) * (-498.685) [-497.608] (-504.919) (-500.017) -- 0:01:25
181500 -- [-502.861] (-497.772) (-502.038) (-496.415) * (-501.258) (-498.672) [-502.579] (-502.836) -- 0:01:25
182000 -- (-497.301) (-504.855) (-500.552) [-500.651] * [-499.785] (-499.111) (-501.352) (-504.003) -- 0:01:25
182500 -- [-500.984] (-504.330) (-498.159) (-504.219) * (-503.315) [-501.305] (-504.254) (-498.228) -- 0:01:25
183000 -- [-496.773] (-505.705) (-497.267) (-504.036) * (-498.666) [-502.911] (-499.204) (-499.773) -- 0:01:24
183500 -- (-500.201) (-498.524) (-504.125) [-501.723] * (-503.465) (-503.441) [-501.244] (-500.465) -- 0:01:24
184000 -- (-495.815) (-503.651) [-500.594] (-506.309) * (-501.683) (-504.602) (-499.835) [-500.550] -- 0:01:24
184500 -- (-501.504) (-498.435) [-500.328] (-500.337) * (-502.443) [-502.666] (-498.514) (-500.067) -- 0:01:23
185000 -- (-506.084) (-498.737) [-501.851] (-502.540) * [-502.349] (-497.723) (-502.016) (-501.235) -- 0:01:23
Average standard deviation of split frequencies: 0.000845
185500 -- [-497.541] (-499.749) (-501.231) (-509.248) * (-505.647) [-503.141] (-496.888) (-498.138) -- 0:01:23
186000 -- (-502.574) (-502.903) [-500.830] (-501.892) * (-505.858) (-501.696) [-499.431] (-500.523) -- 0:01:23
186500 -- (-505.494) (-505.993) [-502.173] (-499.163) * (-500.633) (-497.801) (-502.259) [-496.764] -- 0:01:22
187000 -- [-501.691] (-498.458) (-502.174) (-503.124) * (-504.618) [-499.720] (-503.018) (-505.932) -- 0:01:22
187500 -- (-502.096) (-502.750) [-499.649] (-510.107) * (-506.501) [-498.781] (-500.790) (-501.966) -- 0:01:22
188000 -- [-499.901] (-497.084) (-502.639) (-505.455) * (-506.876) (-498.627) (-503.552) [-498.750] -- 0:01:22
188500 -- (-499.225) [-499.748] (-501.904) (-501.996) * (-508.753) [-504.251] (-499.943) (-495.803) -- 0:01:21
189000 -- (-498.408) (-497.506) [-498.530] (-499.321) * (-508.755) (-500.762) (-501.195) [-504.149] -- 0:01:21
189500 -- (-500.093) (-499.058) [-506.409] (-502.028) * [-505.713] (-499.335) (-509.206) (-505.319) -- 0:01:21
190000 -- (-499.181) (-505.948) (-504.579) [-500.840] * (-508.593) [-500.545] (-505.033) (-503.555) -- 0:01:21
Average standard deviation of split frequencies: 0.003297
190500 -- (-504.416) (-502.136) (-501.221) [-501.787] * (-507.356) (-506.221) [-507.476] (-502.999) -- 0:01:20
191000 -- [-507.593] (-508.486) (-498.877) (-500.636) * (-504.314) (-503.806) (-505.605) [-504.365] -- 0:01:24
191500 -- (-498.691) (-500.305) [-496.467] (-500.787) * (-503.326) (-499.420) (-510.915) [-505.963] -- 0:01:24
192000 -- (-497.895) (-497.365) [-501.000] (-499.488) * (-505.112) (-498.678) (-506.559) [-498.763] -- 0:01:24
192500 -- [-498.548] (-499.881) (-502.831) (-502.919) * (-501.798) (-500.942) [-510.950] (-503.425) -- 0:01:23
193000 -- [-503.366] (-500.641) (-501.405) (-500.771) * (-502.954) (-500.242) (-506.581) [-500.531] -- 0:01:23
193500 -- (-500.206) [-498.550] (-503.502) (-504.244) * [-503.263] (-499.382) (-507.972) (-503.090) -- 0:01:23
194000 -- [-496.009] (-501.110) (-500.881) (-505.492) * (-505.269) (-498.027) [-503.684] (-505.744) -- 0:01:23
194500 -- (-502.179) (-502.146) (-508.186) [-508.314] * (-497.468) (-498.540) (-506.644) [-499.894] -- 0:01:22
195000 -- (-504.479) (-499.449) (-502.492) [-505.243] * (-502.141) (-501.626) (-506.989) [-500.554] -- 0:01:22
Average standard deviation of split frequencies: 0.008017
195500 -- [-501.002] (-500.085) (-498.942) (-501.961) * [-504.315] (-501.074) (-502.446) (-499.745) -- 0:01:22
196000 -- (-502.975) [-503.092] (-500.592) (-506.135) * (-501.878) (-501.424) (-502.050) [-502.323] -- 0:01:22
196500 -- (-500.722) (-501.639) [-499.548] (-501.723) * (-502.513) (-506.580) (-506.210) [-499.442] -- 0:01:21
197000 -- (-500.183) (-499.038) (-502.218) [-504.214] * (-502.862) (-507.060) (-507.538) [-509.017] -- 0:01:21
197500 -- (-500.457) [-496.743] (-501.067) (-506.638) * (-501.183) (-502.106) (-508.513) [-502.848] -- 0:01:21
198000 -- (-503.395) (-499.908) [-500.945] (-509.852) * (-502.826) (-500.042) [-502.093] (-510.422) -- 0:01:21
198500 -- (-502.119) [-505.637] (-497.521) (-504.145) * (-502.475) (-499.372) (-512.801) [-502.401] -- 0:01:20
199000 -- (-500.552) (-500.552) (-499.690) [-504.532] * [-504.002] (-503.748) (-501.608) (-499.500) -- 0:01:20
199500 -- (-506.657) (-502.495) (-499.604) [-501.930] * (-504.245) [-504.721] (-503.694) (-506.484) -- 0:01:20
200000 -- (-510.549) (-497.202) [-495.908] (-506.530) * [-499.827] (-501.832) (-500.956) (-505.161) -- 0:01:20
Average standard deviation of split frequencies: 0.011746
200500 -- (-503.789) (-499.760) [-498.816] (-508.346) * (-506.078) [-499.744] (-509.143) (-504.393) -- 0:01:19
201000 -- (-511.229) [-500.154] (-503.204) (-502.046) * [-497.942] (-496.689) (-501.143) (-498.978) -- 0:01:23
201500 -- (-497.252) [-502.337] (-497.611) (-502.096) * [-499.356] (-495.849) (-499.231) (-499.615) -- 0:01:23
202000 -- (-500.917) (-499.606) (-509.123) [-497.158] * (-500.242) (-499.921) (-503.189) [-500.713] -- 0:01:22
202500 -- (-505.963) [-502.851] (-503.686) (-497.573) * (-500.546) (-501.568) [-498.547] (-507.228) -- 0:01:22
203000 -- (-505.513) (-500.879) (-504.467) [-499.898] * (-498.986) [-498.989] (-497.401) (-502.329) -- 0:01:22
203500 -- (-504.203) (-496.489) [-498.308] (-496.822) * [-496.947] (-501.487) (-499.998) (-503.502) -- 0:01:22
204000 -- (-505.157) (-498.785) [-496.412] (-502.185) * (-501.213) (-500.797) (-502.803) [-503.752] -- 0:01:21
204500 -- (-508.469) (-497.995) (-502.527) [-500.360] * (-503.622) (-498.212) [-504.488] (-511.999) -- 0:01:21
205000 -- (-509.558) [-501.041] (-499.847) (-499.589) * (-505.944) (-501.893) [-501.603] (-504.547) -- 0:01:21
Average standard deviation of split frequencies: 0.012967
205500 -- (-507.073) (-501.586) [-496.413] (-501.068) * [-496.993] (-497.612) (-502.064) (-507.530) -- 0:01:21
206000 -- (-505.515) (-500.094) (-497.934) [-502.518] * (-503.502) [-498.602] (-498.830) (-511.360) -- 0:01:20
206500 -- [-506.922] (-502.389) (-498.047) (-504.250) * (-502.033) [-500.356] (-502.058) (-508.001) -- 0:01:20
207000 -- (-504.996) (-504.384) [-503.174] (-502.826) * (-499.048) (-500.549) [-504.530] (-507.880) -- 0:01:20
207500 -- (-504.078) (-499.465) (-502.857) [-502.109] * (-498.035) (-505.572) [-500.060] (-503.735) -- 0:01:20
208000 -- (-501.595) (-498.992) (-501.043) [-510.277] * [-496.794] (-500.260) (-500.430) (-502.459) -- 0:01:19
208500 -- (-499.654) (-502.076) (-504.380) [-503.830] * (-501.111) (-502.126) [-503.270] (-503.098) -- 0:01:19
209000 -- (-502.530) [-502.506] (-504.109) (-506.146) * [-502.407] (-497.488) (-505.405) (-503.407) -- 0:01:19
209500 -- (-499.187) [-503.428] (-502.503) (-511.723) * (-506.426) [-496.295] (-509.120) (-503.036) -- 0:01:19
210000 -- (-500.319) (-499.653) [-505.032] (-502.095) * (-499.857) (-502.697) [-500.145] (-511.558) -- 0:01:19
Average standard deviation of split frequencies: 0.009697
210500 -- (-506.404) (-500.725) [-496.674] (-511.317) * (-498.875) [-502.359] (-503.663) (-508.768) -- 0:01:18
211000 -- [-504.727] (-500.015) (-500.732) (-508.430) * (-498.474) [-502.622] (-500.121) (-502.440) -- 0:01:22
211500 -- (-499.700) (-498.798) (-503.905) [-506.912] * (-498.941) [-500.826] (-497.896) (-501.002) -- 0:01:22
212000 -- (-501.470) (-500.209) [-498.457] (-507.570) * (-497.301) [-500.804] (-506.034) (-503.667) -- 0:01:21
212500 -- (-498.938) [-495.631] (-503.134) (-506.295) * (-498.414) (-509.773) (-500.635) [-502.283] -- 0:01:21
213000 -- (-499.664) [-498.365] (-497.294) (-513.735) * [-499.704] (-502.762) (-499.156) (-503.154) -- 0:01:21
213500 -- [-499.492] (-503.281) (-495.488) (-506.467) * (-502.793) [-502.231] (-497.518) (-505.494) -- 0:01:21
214000 -- [-500.440] (-500.373) (-504.553) (-510.746) * [-502.711] (-504.402) (-503.170) (-507.092) -- 0:01:20
214500 -- (-498.679) (-499.827) (-504.921) [-502.960] * [-499.667] (-499.884) (-500.302) (-501.729) -- 0:01:20
215000 -- (-496.924) (-499.139) [-498.795] (-505.145) * [-502.882] (-503.458) (-504.241) (-508.853) -- 0:01:20
Average standard deviation of split frequencies: 0.008002
215500 -- (-503.825) (-503.086) (-502.247) [-500.405] * [-500.876] (-503.545) (-502.651) (-499.705) -- 0:01:20
216000 -- [-501.701] (-507.910) (-507.383) (-504.739) * [-495.070] (-502.733) (-497.247) (-498.037) -- 0:01:19
216500 -- [-500.733] (-501.633) (-506.128) (-502.704) * [-500.217] (-502.341) (-497.213) (-500.575) -- 0:01:19
217000 -- (-497.635) (-499.038) [-502.379] (-503.525) * (-497.658) [-494.492] (-497.427) (-500.724) -- 0:01:19
217500 -- (-500.475) (-498.558) [-499.613] (-504.262) * (-502.020) (-505.499) (-502.543) [-500.745] -- 0:01:19
218000 -- (-496.577) (-503.025) (-500.796) [-506.679] * (-503.742) [-500.396] (-502.284) (-504.343) -- 0:01:18
218500 -- (-498.986) (-508.444) [-499.619] (-505.277) * (-505.824) (-500.905) [-499.587] (-503.531) -- 0:01:18
219000 -- (-500.498) [-496.702] (-497.897) (-499.869) * (-498.235) [-505.130] (-500.463) (-502.561) -- 0:01:18
219500 -- [-499.320] (-500.743) (-498.948) (-503.207) * (-503.935) [-504.425] (-498.260) (-502.633) -- 0:01:18
220000 -- (-498.339) [-499.530] (-497.533) (-503.586) * [-499.830] (-498.194) (-502.862) (-502.361) -- 0:01:18
Average standard deviation of split frequencies: 0.011393
220500 -- (-500.996) [-499.506] (-498.226) (-502.894) * (-501.220) [-499.088] (-498.622) (-503.506) -- 0:01:17
221000 -- (-505.245) [-502.206] (-501.317) (-503.719) * (-502.494) (-502.885) [-503.268] (-505.894) -- 0:01:21
221500 -- (-497.455) [-499.133] (-498.995) (-502.757) * (-503.735) [-497.436] (-502.653) (-501.681) -- 0:01:20
222000 -- [-500.375] (-498.367) (-498.016) (-506.352) * (-502.693) (-502.045) [-504.477] (-502.960) -- 0:01:20
222500 -- (-499.167) (-506.922) [-497.787] (-504.490) * (-502.130) (-499.988) (-505.205) [-496.677] -- 0:01:20
223000 -- (-501.745) (-507.602) [-499.749] (-504.636) * [-502.454] (-500.486) (-508.122) (-505.154) -- 0:01:20
223500 -- (-501.777) (-505.379) [-501.895] (-500.602) * (-499.535) [-502.547] (-503.057) (-500.139) -- 0:01:19
224000 -- (-498.857) (-499.038) (-497.644) [-499.338] * (-505.564) (-505.440) [-510.262] (-503.255) -- 0:01:19
224500 -- (-498.616) (-505.086) [-499.163] (-500.348) * [-502.107] (-505.849) (-502.170) (-506.735) -- 0:01:19
225000 -- [-497.832] (-504.749) (-498.761) (-500.581) * [-508.528] (-497.043) (-502.203) (-500.925) -- 0:01:19
Average standard deviation of split frequencies: 0.008343
225500 -- (-498.460) [-498.637] (-504.510) (-501.995) * (-500.380) [-496.733] (-498.547) (-507.932) -- 0:01:18
226000 -- (-504.489) (-505.261) [-505.418] (-503.670) * (-505.742) (-500.721) [-500.732] (-502.770) -- 0:01:18
226500 -- (-503.353) [-496.527] (-509.932) (-505.719) * (-511.453) (-498.574) (-501.763) [-500.291] -- 0:01:18
227000 -- (-505.074) (-496.268) (-502.968) [-503.615] * (-505.874) (-505.200) (-501.751) [-500.516] -- 0:01:18
227500 -- (-508.117) [-500.290] (-501.954) (-501.183) * [-500.399] (-498.314) (-507.787) (-502.376) -- 0:01:18
228000 -- (-500.809) (-504.350) (-507.663) [-503.806] * (-501.394) [-498.939] (-509.450) (-510.786) -- 0:01:17
228500 -- [-497.291] (-498.190) (-502.403) (-503.029) * [-502.410] (-499.587) (-506.402) (-504.182) -- 0:01:17
229000 -- (-500.636) (-507.263) (-499.742) [-502.229] * (-501.675) [-499.423] (-506.980) (-501.267) -- 0:01:17
229500 -- (-501.101) (-507.639) [-500.558] (-504.949) * [-501.492] (-501.903) (-512.305) (-507.680) -- 0:01:17
230000 -- (-498.211) [-501.066] (-502.283) (-501.070) * (-501.565) [-499.509] (-509.807) (-502.587) -- 0:01:17
Average standard deviation of split frequencies: 0.005450
230500 -- (-501.863) [-505.194] (-500.302) (-498.679) * [-504.576] (-497.424) (-512.002) (-506.346) -- 0:01:16
231000 -- [-501.355] (-503.991) (-505.167) (-504.605) * (-508.612) (-498.804) (-509.615) [-504.860] -- 0:01:16
231500 -- (-496.912) (-502.605) (-503.007) [-501.246] * (-507.923) [-498.671] (-504.683) (-503.298) -- 0:01:19
232000 -- (-500.094) [-496.918] (-504.762) (-502.842) * (-502.601) (-502.624) (-505.374) [-503.609] -- 0:01:19
232500 -- [-497.059] (-501.393) (-505.730) (-498.936) * [-501.950] (-505.784) (-507.297) (-507.281) -- 0:01:19
233000 -- [-498.458] (-495.097) (-500.116) (-499.828) * (-515.831) [-500.267] (-502.615) (-501.038) -- 0:01:19
233500 -- (-499.947) (-497.776) [-505.288] (-500.962) * (-511.628) (-499.403) [-507.853] (-503.788) -- 0:01:18
234000 -- (-504.451) (-506.338) [-504.650] (-508.376) * [-505.471] (-499.314) (-504.581) (-501.256) -- 0:01:18
234500 -- (-504.906) [-497.952] (-500.229) (-498.678) * (-505.242) (-505.441) [-502.583] (-506.262) -- 0:01:18
235000 -- [-499.256] (-500.548) (-498.827) (-500.407) * [-500.335] (-501.589) (-502.741) (-507.050) -- 0:01:18
Average standard deviation of split frequencies: 0.001997
235500 -- (-503.115) [-497.854] (-498.725) (-499.056) * (-507.025) [-496.605] (-505.182) (-506.244) -- 0:01:17
236000 -- (-501.280) (-495.778) (-501.259) [-500.976] * (-506.015) [-496.192] (-502.185) (-500.268) -- 0:01:17
236500 -- (-500.802) (-505.042) [-496.974] (-504.859) * (-502.370) [-499.935] (-500.942) (-501.476) -- 0:01:17
237000 -- (-499.082) [-502.511] (-496.163) (-500.221) * (-507.204) (-500.907) (-503.132) [-502.805] -- 0:01:17
237500 -- (-496.380) (-501.443) (-502.416) [-501.829] * [-501.439] (-500.027) (-501.186) (-504.259) -- 0:01:17
238000 -- (-498.781) [-500.691] (-499.806) (-503.732) * (-506.069) (-498.332) (-503.159) [-500.108] -- 0:01:16
238500 -- (-504.391) (-497.819) [-502.784] (-501.753) * (-507.392) [-497.121] (-501.951) (-500.836) -- 0:01:16
239000 -- (-506.308) [-496.527] (-497.788) (-499.712) * (-504.143) (-501.608) [-516.823] (-502.919) -- 0:01:16
239500 -- (-503.131) (-501.124) [-496.311] (-504.307) * (-505.780) [-498.095] (-501.963) (-497.700) -- 0:01:16
240000 -- (-507.448) (-502.124) (-497.434) [-498.815] * (-510.362) (-497.916) [-496.129] (-502.992) -- 0:01:16
Average standard deviation of split frequencies: 0.002612
240500 -- (-500.626) [-497.781] (-500.753) (-499.500) * (-508.224) (-506.527) (-500.901) [-498.877] -- 0:01:15
241000 -- (-498.314) [-497.397] (-505.650) (-508.294) * (-504.882) [-499.809] (-499.999) (-501.577) -- 0:01:15
241500 -- (-496.084) [-498.888] (-503.229) (-504.415) * (-509.514) (-502.793) (-497.687) [-502.207] -- 0:01:18
242000 -- (-500.629) [-499.967] (-499.690) (-501.037) * (-509.244) (-507.130) (-498.583) [-501.425] -- 0:01:18
242500 -- [-503.110] (-501.027) (-502.234) (-503.009) * (-507.578) [-503.408] (-498.856) (-509.330) -- 0:01:18
243000 -- (-508.493) (-500.225) (-506.410) [-500.272] * (-504.875) (-503.853) [-501.939] (-498.127) -- 0:01:17
243500 -- (-506.583) (-500.330) (-509.127) [-508.635] * (-504.254) (-500.161) [-499.438] (-495.651) -- 0:01:17
244000 -- (-506.147) [-501.342] (-503.373) (-499.596) * (-501.014) (-499.028) [-499.782] (-498.707) -- 0:01:17
244500 -- (-509.468) (-507.633) [-499.723] (-502.786) * (-508.093) [-499.531] (-499.227) (-500.445) -- 0:01:17
245000 -- [-504.825] (-503.697) (-500.483) (-503.789) * (-500.492) (-498.517) (-506.418) [-500.438] -- 0:01:17
Average standard deviation of split frequencies: 0.001278
245500 -- (-500.603) (-513.646) [-501.188] (-498.893) * [-498.199] (-498.569) (-503.433) (-499.512) -- 0:01:16
246000 -- (-500.441) [-497.082] (-500.254) (-500.612) * (-498.210) (-498.843) (-507.332) [-497.386] -- 0:01:16
246500 -- (-502.428) (-502.142) (-501.799) [-503.728] * (-499.239) [-501.032] (-498.872) (-498.400) -- 0:01:16
247000 -- (-503.418) (-503.413) [-497.881] (-500.562) * (-500.376) (-496.698) [-499.221] (-501.690) -- 0:01:16
247500 -- (-502.877) (-510.745) (-507.241) [-500.615] * (-498.948) (-500.070) (-499.245) [-501.042] -- 0:01:16
248000 -- [-498.100] (-500.183) (-497.046) (-502.345) * (-502.605) (-503.804) [-499.330] (-499.239) -- 0:01:15
248500 -- [-496.691] (-499.698) (-502.633) (-504.684) * (-502.374) [-504.230] (-500.487) (-510.874) -- 0:01:15
249000 -- (-500.026) (-503.496) [-495.959] (-504.729) * [-500.873] (-503.694) (-500.680) (-500.951) -- 0:01:15
249500 -- (-502.863) (-502.896) [-500.361] (-502.215) * [-499.280] (-497.829) (-499.142) (-500.142) -- 0:01:15
250000 -- (-498.715) (-498.862) [-496.662] (-502.683) * (-497.695) (-501.365) [-495.445] (-496.493) -- 0:01:15
Average standard deviation of split frequencies: 0.004388
250500 -- (-500.366) (-502.071) (-502.839) [-503.721] * (-506.569) (-499.084) [-498.879] (-498.048) -- 0:01:14
251000 -- (-500.577) (-501.632) [-503.504] (-495.081) * (-499.461) [-498.279] (-500.324) (-500.612) -- 0:01:14
251500 -- (-498.797) [-498.592] (-496.937) (-503.779) * [-506.700] (-501.762) (-497.238) (-501.875) -- 0:01:17
252000 -- (-504.403) (-503.036) [-500.604] (-504.895) * (-501.576) (-500.426) (-501.417) [-502.293] -- 0:01:17
252500 -- (-500.778) [-500.982] (-506.669) (-503.728) * [-504.895] (-500.780) (-499.755) (-511.883) -- 0:01:16
253000 -- [-500.393] (-504.961) (-505.013) (-505.705) * (-504.491) (-498.517) (-504.269) [-502.640] -- 0:01:16
253500 -- [-501.306] (-505.772) (-504.023) (-502.753) * [-500.395] (-501.528) (-501.171) (-509.286) -- 0:01:16
254000 -- [-503.652] (-498.692) (-498.415) (-505.989) * (-499.580) [-500.725] (-503.612) (-504.979) -- 0:01:16
254500 -- (-499.476) (-497.258) [-500.708] (-506.075) * (-500.953) (-500.630) (-499.765) [-508.462] -- 0:01:16
255000 -- (-502.944) (-496.001) [-500.379] (-499.340) * [-500.334] (-506.598) (-499.189) (-506.839) -- 0:01:15
Average standard deviation of split frequencies: 0.006138
255500 -- (-508.744) (-499.484) [-503.247] (-502.779) * (-503.936) (-508.703) [-497.532] (-510.756) -- 0:01:15
256000 -- [-502.603] (-501.580) (-502.802) (-501.405) * (-506.764) (-502.831) (-502.856) [-499.809] -- 0:01:15
256500 -- (-504.808) (-499.287) (-503.928) [-500.947] * [-502.833] (-508.598) (-498.565) (-500.581) -- 0:01:15
257000 -- (-505.748) [-498.739] (-499.965) (-496.463) * (-509.452) (-505.777) (-507.350) [-498.679] -- 0:01:15
257500 -- [-500.129] (-497.476) (-502.317) (-503.664) * [-501.113] (-501.270) (-496.058) (-498.094) -- 0:01:14
258000 -- [-500.663] (-498.315) (-498.904) (-498.477) * (-505.532) (-497.689) [-498.254] (-502.553) -- 0:01:14
258500 -- (-502.599) [-500.886] (-498.163) (-503.867) * (-508.071) [-500.630] (-504.969) (-505.059) -- 0:01:14
259000 -- [-500.397] (-505.585) (-500.519) (-503.434) * (-507.794) (-505.017) [-498.636] (-500.928) -- 0:01:14
259500 -- (-497.972) (-501.252) (-498.844) [-500.106] * (-506.545) (-501.025) (-501.865) [-503.296] -- 0:01:14
260000 -- (-504.470) (-503.008) (-497.775) [-497.962] * (-504.741) (-502.206) [-500.142] (-501.654) -- 0:01:14
Average standard deviation of split frequencies: 0.007234
260500 -- [-501.378] (-503.302) (-496.209) (-498.101) * (-508.302) (-499.537) (-500.585) [-504.295] -- 0:01:13
261000 -- [-502.449] (-503.766) (-496.632) (-499.193) * (-508.530) [-504.640] (-501.100) (-500.820) -- 0:01:13
261500 -- (-498.071) [-503.857] (-503.186) (-507.419) * (-503.982) [-506.698] (-504.494) (-497.725) -- 0:01:13
262000 -- (-505.103) [-498.786] (-504.194) (-500.528) * (-505.405) [-501.244] (-507.823) (-496.750) -- 0:01:16
262500 -- (-501.226) [-502.532] (-502.976) (-496.768) * (-515.234) (-502.261) (-507.095) [-499.301] -- 0:01:15
263000 -- (-503.339) [-502.162] (-496.184) (-502.085) * (-512.168) (-500.752) (-503.809) [-497.834] -- 0:01:15
263500 -- (-503.436) (-500.633) (-498.644) [-503.047] * (-506.218) [-500.866] (-509.274) (-497.788) -- 0:01:15
264000 -- (-504.373) (-500.867) [-509.357] (-502.728) * (-511.229) (-505.929) (-501.218) [-498.061] -- 0:01:15
264500 -- [-505.609] (-502.133) (-501.185) (-500.744) * (-510.360) (-502.218) [-510.264] (-499.811) -- 0:01:15
265000 -- [-505.528] (-499.163) (-500.526) (-502.589) * (-504.885) (-505.135) (-506.676) [-497.416] -- 0:01:14
Average standard deviation of split frequencies: 0.007089
265500 -- (-510.824) (-500.220) (-500.587) [-506.090] * (-504.243) (-502.903) (-501.275) [-500.494] -- 0:01:14
266000 -- [-505.723] (-499.825) (-497.583) (-500.935) * (-502.999) [-500.463] (-508.585) (-498.812) -- 0:01:14
266500 -- (-501.628) [-502.266] (-498.078) (-498.464) * (-506.570) (-496.823) [-497.878] (-499.980) -- 0:01:14
267000 -- (-507.619) (-506.129) [-497.309] (-502.402) * (-508.032) (-500.724) [-499.889] (-498.837) -- 0:01:14
267500 -- (-498.715) (-498.918) (-497.157) [-502.686] * (-506.591) (-498.947) [-498.723] (-497.611) -- 0:01:13
268000 -- (-505.349) [-500.397] (-497.654) (-501.979) * (-514.583) (-502.185) (-497.293) [-498.151] -- 0:01:13
268500 -- (-505.735) [-499.913] (-501.325) (-498.989) * (-511.093) (-499.286) [-497.735] (-502.949) -- 0:01:13
269000 -- (-502.941) (-500.659) [-497.722] (-498.815) * (-506.249) [-501.338] (-497.980) (-505.986) -- 0:01:13
269500 -- (-505.555) (-504.126) [-494.913] (-510.614) * (-501.109) [-498.156] (-500.507) (-498.837) -- 0:01:13
270000 -- (-505.958) (-499.481) (-502.465) [-505.531] * (-506.547) [-502.541] (-502.071) (-499.253) -- 0:01:13
Average standard deviation of split frequencies: 0.008708
270500 -- [-508.288] (-510.571) (-501.461) (-509.067) * (-502.453) (-502.782) (-497.904) [-497.060] -- 0:01:12
271000 -- (-504.597) (-507.603) (-498.740) [-503.413] * (-506.414) (-505.821) [-497.849] (-500.879) -- 0:01:12
271500 -- (-503.800) [-502.943] (-495.854) (-500.835) * (-512.376) (-501.619) (-500.590) [-498.756] -- 0:01:12
272000 -- (-503.771) (-505.589) (-500.136) [-512.564] * (-503.708) (-504.128) [-498.321] (-496.619) -- 0:01:14
272500 -- (-498.308) [-503.034] (-506.628) (-503.910) * (-516.656) (-502.098) (-503.212) [-500.215] -- 0:01:14
273000 -- (-498.355) (-500.971) (-499.523) [-502.010] * [-502.774] (-509.714) (-499.198) (-504.826) -- 0:01:14
273500 -- (-499.515) (-503.760) [-501.394] (-510.312) * (-505.480) [-497.462] (-499.191) (-501.464) -- 0:01:14
274000 -- [-501.570] (-506.575) (-499.510) (-507.918) * (-505.893) (-501.699) [-504.428] (-498.376) -- 0:01:14
274500 -- (-502.196) (-501.889) [-499.791] (-519.144) * (-500.022) (-503.988) (-502.942) [-498.239] -- 0:01:14
275000 -- [-498.828] (-501.747) (-504.993) (-509.121) * (-497.695) (-504.678) [-498.188] (-501.763) -- 0:01:13
Average standard deviation of split frequencies: 0.010248
275500 -- (-498.926) [-505.753] (-498.116) (-506.376) * (-497.301) (-499.155) [-500.235] (-498.497) -- 0:01:13
276000 -- [-501.010] (-503.815) (-500.651) (-509.302) * [-501.117] (-500.345) (-500.677) (-501.851) -- 0:01:13
276500 -- (-503.967) [-505.475] (-500.664) (-509.953) * (-509.876) (-499.112) [-499.890] (-499.010) -- 0:01:13
277000 -- [-499.055] (-504.868) (-497.374) (-510.943) * (-497.988) (-498.954) (-501.734) [-506.826] -- 0:01:13
277500 -- (-497.983) (-500.481) [-502.874] (-511.089) * [-498.799] (-500.673) (-501.178) (-497.098) -- 0:01:12
278000 -- (-504.711) [-497.800] (-497.889) (-505.206) * (-502.491) (-497.748) (-502.390) [-499.801] -- 0:01:12
278500 -- (-503.967) (-502.038) [-495.955] (-502.800) * (-497.785) [-496.665] (-504.222) (-498.786) -- 0:01:12
279000 -- (-500.059) (-502.134) (-501.077) [-503.311] * [-501.675] (-500.900) (-502.131) (-503.486) -- 0:01:12
279500 -- [-503.993] (-502.542) (-497.091) (-505.937) * (-505.500) [-496.555] (-502.495) (-500.358) -- 0:01:12
280000 -- [-499.696] (-499.899) (-495.772) (-500.037) * (-496.779) [-498.109] (-503.173) (-506.990) -- 0:01:12
Average standard deviation of split frequencies: 0.011197
280500 -- (-497.906) [-500.807] (-501.813) (-500.891) * [-497.085] (-498.372) (-501.193) (-502.589) -- 0:01:11
281000 -- (-501.426) (-500.411) [-499.268] (-502.447) * (-502.818) [-497.042] (-499.638) (-503.634) -- 0:01:11
281500 -- (-497.185) (-508.957) (-500.008) [-503.202] * (-501.981) (-506.871) [-496.921] (-502.030) -- 0:01:11
282000 -- [-497.557] (-502.876) (-501.830) (-508.278) * (-495.865) [-495.216] (-501.369) (-506.382) -- 0:01:11
282500 -- (-502.795) [-507.293] (-497.561) (-504.586) * (-499.331) [-503.057] (-502.170) (-506.461) -- 0:01:13
283000 -- (-500.932) [-499.239] (-494.527) (-507.500) * [-505.619] (-501.996) (-501.232) (-500.262) -- 0:01:13
283500 -- (-500.490) [-505.588] (-498.654) (-506.220) * (-511.118) [-500.583] (-496.402) (-495.881) -- 0:01:13
284000 -- (-501.861) (-501.574) [-501.832] (-505.428) * (-497.530) (-497.686) (-497.461) [-500.842] -- 0:01:13
284500 -- (-496.448) (-502.370) (-501.546) [-502.708] * (-499.060) (-497.914) (-501.800) [-498.623] -- 0:01:12
285000 -- (-499.985) [-500.928] (-498.391) (-506.496) * (-507.440) [-502.519] (-503.540) (-501.949) -- 0:01:12
Average standard deviation of split frequencies: 0.010988
285500 -- (-506.038) [-498.339] (-496.603) (-505.481) * [-502.749] (-498.289) (-505.018) (-500.011) -- 0:01:12
286000 -- [-506.500] (-500.018) (-498.892) (-506.867) * [-501.922] (-502.693) (-508.934) (-499.212) -- 0:01:12
286500 -- (-507.194) [-498.677] (-502.498) (-512.408) * (-507.781) (-500.508) (-506.003) [-499.930] -- 0:01:12
287000 -- (-505.485) (-503.131) [-498.090] (-501.306) * [-502.916] (-508.784) (-510.914) (-502.745) -- 0:01:12
287500 -- [-502.032] (-501.956) (-497.524) (-504.176) * [-496.466] (-503.571) (-506.265) (-504.844) -- 0:01:11
288000 -- (-499.617) (-501.118) (-503.774) [-502.700] * (-501.375) (-499.950) (-500.591) [-504.001] -- 0:01:11
288500 -- (-504.121) (-500.339) [-502.118] (-497.488) * (-497.662) [-506.452] (-503.444) (-500.608) -- 0:01:11
289000 -- (-512.315) [-496.629] (-503.748) (-501.678) * (-501.790) (-506.619) (-506.604) [-502.114] -- 0:01:11
289500 -- [-505.570] (-500.444) (-503.421) (-505.578) * (-500.599) (-502.146) [-501.939] (-497.302) -- 0:01:11
290000 -- (-502.849) [-497.990] (-507.315) (-506.196) * (-503.006) (-501.980) (-505.116) [-498.866] -- 0:01:11
Average standard deviation of split frequencies: 0.012434
290500 -- (-505.266) [-496.384] (-502.065) (-501.909) * (-497.613) (-504.964) (-502.431) [-498.580] -- 0:01:10
291000 -- [-500.635] (-500.436) (-501.577) (-506.899) * [-496.512] (-504.365) (-510.010) (-501.133) -- 0:01:10
291500 -- [-502.418] (-500.567) (-505.436) (-499.894) * (-498.671) (-507.386) [-503.517] (-500.891) -- 0:01:10
292000 -- [-497.583] (-502.973) (-500.087) (-500.809) * (-506.898) (-501.397) [-504.523] (-502.600) -- 0:01:10
292500 -- (-497.510) [-501.743] (-503.721) (-498.396) * (-501.346) (-500.196) [-503.291] (-497.688) -- 0:01:12
293000 -- [-499.531] (-499.162) (-509.871) (-503.727) * (-498.961) (-500.818) (-501.701) [-501.096] -- 0:01:12
293500 -- [-505.260] (-499.413) (-500.155) (-501.022) * (-500.294) (-501.935) [-501.346] (-498.332) -- 0:01:12
294000 -- (-501.024) (-501.252) (-507.353) [-507.177] * (-500.101) (-502.858) (-502.231) [-502.432] -- 0:01:12
294500 -- (-502.224) [-500.588] (-506.707) (-501.440) * (-501.977) (-506.684) [-501.836] (-496.466) -- 0:01:11
295000 -- [-504.356] (-498.896) (-506.705) (-503.672) * (-499.906) [-501.428] (-502.339) (-499.663) -- 0:01:11
Average standard deviation of split frequencies: 0.012210
295500 -- [-501.353] (-506.716) (-502.733) (-508.073) * [-498.779] (-500.640) (-505.066) (-506.898) -- 0:01:11
296000 -- (-499.121) [-498.668] (-507.863) (-503.880) * (-500.009) (-502.630) [-500.584] (-500.630) -- 0:01:11
296500 -- (-503.453) [-500.032] (-507.541) (-503.561) * (-503.110) (-505.061) (-501.515) [-499.926] -- 0:01:11
297000 -- (-500.143) [-500.062] (-505.946) (-504.582) * (-500.435) (-506.395) [-498.789] (-504.096) -- 0:01:11
297500 -- (-498.938) [-503.833] (-506.432) (-506.526) * (-502.472) (-502.141) (-504.100) [-501.127] -- 0:01:10
298000 -- (-502.737) (-505.011) [-502.847] (-510.842) * (-501.152) [-499.008] (-502.016) (-505.682) -- 0:01:10
298500 -- (-498.444) (-502.107) [-507.104] (-501.508) * (-506.222) (-501.904) (-498.332) [-500.360] -- 0:01:10
299000 -- (-506.445) (-501.108) (-511.002) [-501.749] * (-497.767) (-503.270) (-500.025) [-501.578] -- 0:01:10
299500 -- (-502.152) (-506.867) [-502.927] (-502.188) * (-505.791) (-501.019) [-500.517] (-499.371) -- 0:01:10
300000 -- [-501.120] (-507.919) (-502.254) (-505.855) * (-500.768) (-500.892) (-502.760) [-499.234] -- 0:01:10
Average standard deviation of split frequencies: 0.012020
300500 -- (-505.929) [-507.497] (-502.278) (-506.122) * (-501.935) (-510.022) [-501.506] (-502.195) -- 0:01:09
301000 -- [-499.118] (-502.405) (-506.249) (-500.379) * (-503.846) (-501.655) (-508.757) [-502.037] -- 0:01:09
301500 -- (-504.766) [-499.385] (-507.630) (-504.736) * (-501.959) [-498.379] (-504.019) (-499.324) -- 0:01:09
302000 -- (-504.127) [-501.763] (-502.517) (-498.347) * (-502.255) (-502.721) (-503.774) [-503.526] -- 0:01:09
302500 -- (-503.845) (-504.631) (-506.931) [-499.552] * (-499.367) (-502.958) (-505.683) [-497.401] -- 0:01:11
303000 -- (-507.354) (-502.491) (-500.158) [-498.064] * [-499.091] (-499.840) (-502.536) (-502.308) -- 0:01:11
303500 -- (-509.470) (-503.662) (-506.980) [-495.771] * [-496.617] (-506.228) (-499.200) (-500.446) -- 0:01:11
304000 -- (-505.292) (-500.232) (-502.812) [-497.996] * (-499.557) (-500.380) (-503.015) [-507.183] -- 0:01:10
304500 -- (-503.403) (-505.594) (-501.713) [-498.901] * (-498.181) [-506.988] (-496.146) (-500.377) -- 0:01:10
305000 -- (-500.397) (-498.951) (-498.679) [-498.180] * (-503.864) [-503.519] (-499.831) (-499.733) -- 0:01:10
Average standard deviation of split frequencies: 0.011811
305500 -- (-500.507) (-501.924) (-501.893) [-498.828] * [-501.512] (-501.142) (-497.980) (-499.331) -- 0:01:10
306000 -- (-500.613) (-501.956) (-505.183) [-499.420] * (-504.513) (-503.291) (-497.757) [-500.168] -- 0:01:10
306500 -- [-505.135] (-503.077) (-502.527) (-505.927) * [-500.189] (-500.438) (-500.425) (-503.191) -- 0:01:10
307000 -- (-500.489) (-501.254) [-499.410] (-500.748) * (-496.459) (-504.365) [-506.383] (-500.344) -- 0:01:09
307500 -- (-499.746) (-503.461) [-500.256] (-503.027) * [-500.017] (-506.261) (-508.358) (-503.736) -- 0:01:09
308000 -- (-503.364) [-503.086] (-499.863) (-499.520) * (-507.274) (-501.433) [-507.783] (-500.696) -- 0:01:09
308500 -- (-498.924) (-506.867) [-500.112] (-504.252) * (-497.888) [-501.524] (-504.892) (-503.741) -- 0:01:09
309000 -- [-501.160] (-498.889) (-502.311) (-500.526) * [-499.672] (-505.230) (-505.799) (-503.536) -- 0:01:09
309500 -- (-498.322) [-496.817] (-499.830) (-505.018) * (-501.707) (-504.395) (-498.269) [-501.027] -- 0:01:09
310000 -- (-505.782) (-504.912) [-508.273] (-500.871) * (-501.433) (-500.614) (-500.453) [-495.056] -- 0:01:09
Average standard deviation of split frequencies: 0.011633
310500 -- [-501.233] (-500.799) (-502.324) (-497.737) * (-501.692) [-499.080] (-504.230) (-501.770) -- 0:01:08
311000 -- (-502.318) (-506.873) [-500.725] (-501.068) * (-503.127) [-505.127] (-500.900) (-503.545) -- 0:01:08
311500 -- (-497.202) (-501.819) [-496.494] (-500.825) * (-501.445) [-505.988] (-499.955) (-499.188) -- 0:01:08
312000 -- (-503.147) [-497.657] (-500.216) (-499.385) * [-500.160] (-502.776) (-507.599) (-500.872) -- 0:01:08
312500 -- (-499.146) (-499.831) (-497.804) [-500.762] * [-503.262] (-499.931) (-499.329) (-496.237) -- 0:01:08
313000 -- (-498.660) (-496.762) [-497.529] (-507.310) * (-505.940) [-497.447] (-497.280) (-495.837) -- 0:01:10
313500 -- (-507.688) [-497.446] (-498.560) (-499.633) * [-501.856] (-499.605) (-497.062) (-502.425) -- 0:01:10
314000 -- [-504.644] (-497.034) (-499.530) (-508.958) * [-512.980] (-498.042) (-501.502) (-501.629) -- 0:01:09
314500 -- [-511.861] (-499.755) (-503.525) (-501.443) * (-498.266) (-506.764) [-498.021] (-497.638) -- 0:01:09
315000 -- (-502.147) (-498.893) [-499.858] (-498.251) * (-500.034) (-508.038) (-499.125) [-496.779] -- 0:01:09
Average standard deviation of split frequencies: 0.013426
315500 -- [-500.007] (-497.818) (-499.365) (-502.743) * (-502.245) [-509.072] (-497.800) (-502.896) -- 0:01:09
316000 -- (-503.416) (-495.963) [-498.163] (-497.738) * (-498.044) (-502.230) [-498.828] (-501.077) -- 0:01:09
316500 -- (-499.254) (-503.513) [-499.314] (-500.505) * (-498.355) (-500.973) (-501.384) [-498.592] -- 0:01:09
317000 -- (-498.728) [-498.337] (-504.044) (-511.378) * (-503.400) (-500.782) (-508.064) [-502.244] -- 0:01:08
317500 -- (-507.074) [-503.356] (-502.625) (-500.533) * (-503.036) (-501.046) (-500.355) [-504.844] -- 0:01:08
318000 -- (-503.306) (-498.444) [-501.670] (-495.553) * (-501.743) [-506.961] (-496.879) (-497.379) -- 0:01:08
318500 -- (-504.187) [-502.035] (-498.480) (-501.204) * (-503.703) (-498.453) [-496.937] (-495.437) -- 0:01:08
319000 -- (-497.914) (-498.011) [-502.916] (-502.517) * (-502.187) (-500.819) (-503.144) [-496.082] -- 0:01:08
319500 -- (-502.316) (-505.451) [-497.701] (-506.393) * [-505.073] (-500.504) (-507.824) (-500.670) -- 0:01:08
320000 -- (-499.729) (-501.484) [-496.761] (-498.383) * (-497.059) (-497.763) (-505.599) [-498.704] -- 0:01:08
Average standard deviation of split frequencies: 0.012741
320500 -- (-498.187) (-500.013) (-503.874) [-500.984] * [-499.458] (-498.706) (-497.052) (-499.570) -- 0:01:07
321000 -- (-503.980) [-505.698] (-499.392) (-498.497) * (-504.185) (-503.449) [-499.865] (-502.123) -- 0:01:07
321500 -- (-502.656) (-502.391) [-501.399] (-501.937) * [-500.007] (-504.558) (-500.876) (-500.005) -- 0:01:07
322000 -- (-503.284) (-498.353) [-498.075] (-498.661) * [-500.347] (-501.209) (-498.918) (-498.878) -- 0:01:07
322500 -- (-499.239) (-496.040) (-498.320) [-500.997] * (-501.530) (-501.966) (-501.323) [-501.506] -- 0:01:07
323000 -- (-496.566) (-501.942) [-504.256] (-498.676) * [-498.740] (-503.804) (-505.784) (-497.838) -- 0:01:09
323500 -- (-497.416) [-501.284] (-502.071) (-498.679) * (-499.770) [-498.737] (-504.165) (-502.536) -- 0:01:09
324000 -- (-503.157) [-502.732] (-501.277) (-503.491) * (-499.643) [-507.084] (-498.187) (-501.167) -- 0:01:08
324500 -- [-501.126] (-501.596) (-500.581) (-498.673) * (-503.466) (-505.906) (-495.979) [-497.304] -- 0:01:08
325000 -- (-501.622) (-504.631) [-502.425] (-501.397) * (-501.153) [-497.770] (-499.024) (-501.158) -- 0:01:08
Average standard deviation of split frequencies: 0.013014
325500 -- [-499.759] (-500.169) (-497.825) (-502.274) * [-500.748] (-501.771) (-502.742) (-502.920) -- 0:01:08
326000 -- (-503.677) (-503.595) [-496.084] (-499.965) * (-501.797) (-502.152) (-496.929) [-495.151] -- 0:01:08
326500 -- (-503.665) (-507.108) [-496.447] (-498.418) * [-503.234] (-499.801) (-502.205) (-499.961) -- 0:01:08
327000 -- (-501.851) (-501.854) (-501.015) [-501.508] * (-503.767) (-497.433) (-500.197) [-496.271] -- 0:01:07
327500 -- (-505.684) (-508.221) (-500.773) [-497.662] * [-501.493] (-506.659) (-500.518) (-502.884) -- 0:01:07
328000 -- (-500.818) (-502.492) (-499.697) [-503.200] * (-502.119) [-494.997] (-506.327) (-508.231) -- 0:01:07
328500 -- (-501.437) (-503.053) [-499.752] (-504.076) * (-505.629) (-500.641) (-512.396) [-497.952] -- 0:01:07
329000 -- [-506.558] (-504.775) (-507.795) (-506.363) * (-499.446) (-497.732) [-499.643] (-502.263) -- 0:01:07
329500 -- (-500.342) (-511.724) (-501.297) [-501.664] * (-501.274) [-497.140] (-497.139) (-503.194) -- 0:01:07
330000 -- (-499.338) (-507.312) [-504.460] (-504.267) * (-499.542) [-500.637] (-498.371) (-503.486) -- 0:01:07
Average standard deviation of split frequencies: 0.013781
330500 -- (-502.240) (-507.645) (-504.483) [-504.721] * (-501.549) [-497.483] (-507.222) (-500.172) -- 0:01:06
331000 -- (-497.269) (-502.867) [-501.785] (-502.130) * (-507.236) (-499.264) (-508.577) [-498.461] -- 0:01:06
331500 -- [-500.884] (-506.045) (-503.684) (-503.901) * (-505.968) (-500.464) (-501.883) [-498.170] -- 0:01:06
332000 -- (-502.879) [-504.802] (-498.962) (-508.372) * (-503.899) [-499.137] (-505.271) (-506.042) -- 0:01:06
332500 -- (-497.641) [-500.733] (-500.902) (-501.180) * (-506.484) (-504.786) [-501.164] (-504.925) -- 0:01:06
333000 -- (-504.492) (-505.770) (-498.218) [-506.336] * (-504.825) (-501.070) (-503.506) [-502.437] -- 0:01:06
333500 -- [-502.251] (-502.898) (-503.543) (-508.340) * (-502.870) (-504.027) (-498.180) [-499.730] -- 0:01:07
334000 -- (-498.889) [-504.285] (-505.826) (-507.331) * (-501.284) [-497.280] (-503.432) (-502.079) -- 0:01:07
334500 -- (-505.935) [-499.116] (-500.001) (-506.668) * (-510.203) (-510.495) [-503.237] (-502.809) -- 0:01:07
335000 -- [-496.849] (-502.635) (-498.645) (-504.418) * (-508.158) (-501.132) (-497.698) [-498.033] -- 0:01:07
Average standard deviation of split frequencies: 0.015433
335500 -- (-499.597) (-503.900) [-498.208] (-509.339) * (-506.029) [-500.819] (-501.036) (-496.636) -- 0:01:07
336000 -- [-495.736] (-503.248) (-498.282) (-503.881) * (-507.805) [-500.393] (-499.627) (-497.636) -- 0:01:07
336500 -- [-497.248] (-503.526) (-497.000) (-508.539) * (-504.087) (-503.565) (-502.617) [-498.772] -- 0:01:07
337000 -- (-502.762) (-498.902) [-499.297] (-505.384) * (-501.049) [-498.251] (-496.238) (-501.356) -- 0:01:06
337500 -- [-500.797] (-500.654) (-498.924) (-514.113) * [-505.063] (-500.415) (-496.622) (-503.801) -- 0:01:06
338000 -- (-500.224) (-502.761) (-496.182) [-505.525] * (-502.181) (-500.813) (-499.997) [-505.180] -- 0:01:06
338500 -- [-498.297] (-498.198) (-500.243) (-506.684) * (-504.816) (-501.319) (-497.484) [-495.700] -- 0:01:06
339000 -- (-497.394) [-495.496] (-497.910) (-511.687) * (-505.064) [-500.032] (-498.448) (-499.840) -- 0:01:06
339500 -- (-501.121) (-500.749) (-502.479) [-506.415] * (-503.648) [-501.110] (-502.104) (-501.446) -- 0:01:06
340000 -- (-500.578) [-499.672] (-497.800) (-507.408) * (-501.579) (-500.910) [-502.105] (-499.992) -- 0:01:06
Average standard deviation of split frequencies: 0.015221
340500 -- [-498.369] (-497.775) (-500.957) (-500.732) * (-502.141) (-495.016) (-503.127) [-497.608] -- 0:01:05
341000 -- (-500.809) [-498.420] (-501.180) (-503.292) * [-503.601] (-498.196) (-497.198) (-496.861) -- 0:01:05
341500 -- (-500.206) [-497.675] (-502.452) (-504.722) * [-502.100] (-502.893) (-501.950) (-497.343) -- 0:01:05
342000 -- [-497.663] (-495.799) (-506.773) (-501.836) * (-504.245) [-501.007] (-498.297) (-504.365) -- 0:01:05
342500 -- (-498.051) (-499.168) [-503.764] (-502.954) * (-504.557) [-495.995] (-502.486) (-504.843) -- 0:01:05
343000 -- (-502.693) [-501.660] (-504.745) (-498.828) * (-504.461) [-500.288] (-505.435) (-504.597) -- 0:01:05
343500 -- [-495.934] (-504.269) (-498.930) (-503.748) * (-505.973) (-504.323) (-497.514) [-499.772] -- 0:01:06
344000 -- (-497.972) [-504.537] (-498.136) (-499.396) * [-503.623] (-504.030) (-498.889) (-501.051) -- 0:01:06
344500 -- (-503.417) (-502.822) [-497.819] (-505.248) * (-504.887) (-501.056) (-505.288) [-498.039] -- 0:01:06
345000 -- (-499.867) (-500.909) (-506.307) [-499.050] * (-502.486) (-499.474) [-503.997] (-501.985) -- 0:01:06
Average standard deviation of split frequencies: 0.014079
345500 -- (-499.299) (-502.209) [-498.303] (-502.266) * (-503.580) (-501.804) (-503.441) [-497.312] -- 0:01:06
346000 -- [-500.388] (-500.624) (-504.355) (-500.601) * (-501.413) (-505.451) (-498.172) [-500.404] -- 0:01:06
346500 -- (-497.731) (-498.520) (-499.111) [-502.904] * [-502.383] (-509.838) (-500.409) (-501.307) -- 0:01:06
347000 -- (-500.768) [-498.385] (-500.851) (-501.379) * (-503.172) (-505.638) (-506.161) [-503.274] -- 0:01:05
347500 -- (-502.107) [-496.735] (-503.049) (-503.555) * (-505.802) (-496.779) [-501.950] (-503.978) -- 0:01:05
348000 -- (-498.035) (-497.886) [-498.943] (-500.310) * (-512.815) [-501.426] (-505.810) (-500.903) -- 0:01:05
348500 -- (-502.527) [-500.959] (-497.360) (-499.506) * (-502.264) [-501.235] (-505.667) (-503.260) -- 0:01:05
349000 -- (-502.170) (-501.537) (-497.062) [-504.965] * (-505.960) [-504.355] (-501.744) (-505.070) -- 0:01:05
349500 -- (-500.231) (-498.392) (-502.916) [-499.270] * (-503.623) [-497.667] (-507.932) (-507.861) -- 0:01:05
350000 -- (-500.811) (-501.346) (-499.505) [-500.144] * (-505.321) [-496.649] (-501.495) (-503.646) -- 0:01:05
Average standard deviation of split frequencies: 0.013443
350500 -- (-509.692) (-500.729) [-498.448] (-500.470) * (-502.670) [-496.877] (-507.881) (-504.450) -- 0:01:04
351000 -- (-502.381) (-499.130) [-501.307] (-501.407) * (-500.008) [-505.197] (-501.428) (-501.934) -- 0:01:04
351500 -- (-500.905) (-498.877) [-503.201] (-499.126) * [-501.922] (-499.277) (-503.615) (-503.104) -- 0:01:04
352000 -- (-506.547) (-500.726) (-501.454) [-498.107] * (-498.795) (-500.096) [-502.478] (-506.891) -- 0:01:04
352500 -- (-504.796) (-501.997) (-499.220) [-497.473] * [-499.721] (-502.695) (-501.776) (-500.025) -- 0:01:04
353000 -- (-502.974) [-498.881] (-502.055) (-500.309) * (-500.162) (-501.337) [-503.010] (-507.077) -- 0:01:04
353500 -- [-499.946] (-505.437) (-504.451) (-499.089) * (-499.805) (-502.349) (-507.122) [-498.984] -- 0:01:05
354000 -- (-502.190) [-499.956] (-500.301) (-503.658) * (-496.372) [-498.162] (-506.703) (-499.773) -- 0:01:05
354500 -- (-505.053) (-504.933) (-497.892) [-503.535] * [-497.565] (-501.309) (-507.490) (-502.051) -- 0:01:05
355000 -- (-506.928) (-502.424) (-504.158) [-507.853] * (-503.700) (-503.817) [-498.601] (-498.983) -- 0:01:05
Average standard deviation of split frequencies: 0.012800
355500 -- (-501.021) [-498.782] (-502.049) (-502.957) * (-502.498) [-499.028] (-504.904) (-502.540) -- 0:01:05
356000 -- (-509.082) [-502.474] (-500.290) (-501.579) * [-506.555] (-502.824) (-509.568) (-499.800) -- 0:01:05
356500 -- [-501.786] (-501.562) (-502.840) (-503.768) * (-505.578) [-500.953] (-502.028) (-502.178) -- 0:01:04
357000 -- (-503.890) [-502.989] (-504.626) (-520.870) * [-500.061] (-503.821) (-504.072) (-497.072) -- 0:01:04
357500 -- [-502.877] (-500.924) (-496.745) (-505.526) * (-505.552) (-504.704) [-500.781] (-503.354) -- 0:01:04
358000 -- (-500.153) (-504.931) [-499.471] (-510.154) * [-498.752] (-502.926) (-495.398) (-502.811) -- 0:01:04
358500 -- [-503.933] (-507.884) (-503.044) (-509.169) * [-505.466] (-507.758) (-499.534) (-500.448) -- 0:01:04
359000 -- (-506.419) (-506.550) [-498.629] (-504.524) * (-506.038) [-501.870] (-508.301) (-501.539) -- 0:01:04
359500 -- (-503.567) (-512.662) (-500.305) [-503.260] * [-498.606] (-500.975) (-504.301) (-505.520) -- 0:01:04
360000 -- (-505.870) (-506.912) (-502.336) [-500.082] * (-497.329) [-497.864] (-502.887) (-505.206) -- 0:01:04
Average standard deviation of split frequencies: 0.013942
360500 -- (-508.122) (-505.456) [-502.587] (-499.717) * (-499.220) [-500.358] (-499.332) (-502.691) -- 0:01:03
361000 -- (-503.140) (-508.259) [-500.554] (-498.865) * (-500.581) (-497.665) (-504.963) [-500.546] -- 0:01:03
361500 -- (-505.316) (-509.541) (-498.805) [-500.577] * [-497.858] (-496.539) (-504.099) (-500.466) -- 0:01:03
362000 -- (-503.146) (-507.841) [-500.546] (-503.939) * (-498.101) [-497.021] (-508.606) (-501.543) -- 0:01:03
362500 -- (-510.444) (-506.935) (-505.166) [-499.788] * (-498.793) [-499.476] (-497.375) (-500.812) -- 0:01:03
363000 -- (-506.241) (-503.144) (-498.046) [-498.245] * (-497.091) [-499.450] (-505.541) (-501.422) -- 0:01:03
363500 -- (-505.012) (-503.985) (-499.157) [-502.640] * (-511.020) (-499.508) (-504.751) [-504.001] -- 0:01:03
364000 -- (-503.627) [-507.212] (-505.590) (-500.246) * (-502.792) (-500.382) (-501.952) [-498.953] -- 0:01:04
364500 -- [-503.125] (-498.829) (-505.752) (-496.844) * [-500.945] (-506.800) (-499.067) (-500.648) -- 0:01:04
365000 -- (-501.350) (-499.219) (-508.246) [-496.573] * (-499.669) [-504.315] (-500.162) (-499.812) -- 0:01:04
Average standard deviation of split frequencies: 0.012021
365500 -- (-504.625) [-501.395] (-504.549) (-501.136) * (-499.293) [-502.157] (-497.396) (-501.034) -- 0:01:04
366000 -- (-503.175) (-505.445) (-501.040) [-502.497] * (-501.965) (-505.946) [-500.630] (-500.503) -- 0:01:04
366500 -- (-501.321) (-509.727) [-503.061] (-504.124) * [-510.456] (-503.802) (-501.042) (-508.277) -- 0:01:03
367000 -- (-508.150) [-497.561] (-498.710) (-503.924) * (-512.225) (-504.965) (-508.518) [-499.753] -- 0:01:03
367500 -- (-504.058) (-503.669) [-502.838] (-499.807) * [-499.438] (-505.766) (-503.505) (-501.377) -- 0:01:03
368000 -- [-503.051] (-499.551) (-499.806) (-504.457) * [-500.360] (-510.934) (-506.138) (-507.781) -- 0:01:03
368500 -- (-504.613) (-500.852) [-499.913] (-504.600) * (-503.731) (-504.878) [-499.845] (-505.083) -- 0:01:03
369000 -- (-512.915) (-502.183) [-501.657] (-507.665) * [-500.929] (-507.145) (-502.143) (-498.766) -- 0:01:03
369500 -- (-504.274) (-496.117) (-501.493) [-500.615] * [-501.754] (-508.609) (-499.396) (-502.163) -- 0:01:03
370000 -- (-501.903) (-502.470) [-501.154] (-500.552) * (-504.003) (-506.273) [-499.191] (-501.064) -- 0:01:03
Average standard deviation of split frequencies: 0.013566
370500 -- (-501.730) (-498.548) [-500.084] (-501.020) * (-498.001) [-502.560] (-500.060) (-499.759) -- 0:01:02
371000 -- (-499.190) [-499.204] (-509.340) (-506.317) * [-497.567] (-505.144) (-498.008) (-497.770) -- 0:01:02
371500 -- (-498.794) (-493.857) [-497.364] (-502.185) * (-497.145) (-506.859) (-502.942) [-501.896] -- 0:01:02
372000 -- (-502.987) [-498.277] (-498.129) (-507.398) * (-500.789) (-505.235) (-502.902) [-499.361] -- 0:01:02
372500 -- (-503.277) [-498.166] (-502.683) (-503.776) * [-501.454] (-507.916) (-496.469) (-507.026) -- 0:01:02
373000 -- (-502.459) (-502.409) [-495.534] (-504.416) * [-495.893] (-501.323) (-499.988) (-506.117) -- 0:01:02
373500 -- (-501.471) (-499.361) [-499.120] (-504.011) * (-500.577) (-504.076) (-499.993) [-498.606] -- 0:01:02
374000 -- (-506.963) [-507.802] (-500.308) (-499.829) * (-505.823) (-497.354) (-502.404) [-500.664] -- 0:01:01
374500 -- (-502.139) [-506.078] (-502.128) (-502.883) * (-499.607) [-500.795] (-504.545) (-501.799) -- 0:01:03
375000 -- (-496.949) (-510.214) (-496.762) [-501.372] * (-509.172) (-504.451) [-511.087] (-503.976) -- 0:01:03
Average standard deviation of split frequencies: 0.015045
375500 -- (-500.436) [-499.729] (-502.829) (-502.607) * (-505.125) (-506.424) [-503.801] (-500.628) -- 0:01:03
376000 -- (-499.896) [-497.502] (-501.423) (-497.723) * (-503.253) [-498.033] (-510.977) (-504.984) -- 0:01:03
376500 -- [-501.000] (-502.327) (-501.086) (-498.670) * (-501.846) (-503.960) [-509.324] (-500.073) -- 0:01:02
377000 -- (-502.938) (-499.969) [-501.743] (-500.936) * (-506.769) (-504.652) [-500.148] (-505.151) -- 0:01:02
377500 -- (-507.142) (-502.243) [-498.469] (-499.321) * (-504.134) [-504.241] (-501.100) (-504.793) -- 0:01:02
378000 -- (-504.346) (-501.131) (-497.850) [-498.893] * (-504.079) (-501.570) (-502.855) [-498.078] -- 0:01:02
378500 -- (-505.456) [-506.101] (-507.514) (-502.673) * (-510.223) (-503.722) (-499.484) [-503.979] -- 0:01:02
379000 -- (-500.761) (-510.307) (-498.633) [-501.385] * (-504.509) (-502.660) (-500.013) [-500.161] -- 0:01:02
379500 -- (-506.695) (-504.371) (-504.794) [-500.234] * (-504.804) (-502.921) [-500.442] (-503.010) -- 0:01:02
380000 -- [-500.359] (-504.448) (-497.565) (-503.052) * (-503.184) [-504.616] (-499.908) (-499.378) -- 0:01:02
Average standard deviation of split frequencies: 0.015686
380500 -- (-504.774) [-507.541] (-497.867) (-496.343) * (-517.595) [-504.695] (-509.744) (-498.450) -- 0:01:01
381000 -- (-503.328) (-497.869) (-504.145) [-499.134] * (-502.861) [-499.460] (-499.151) (-504.706) -- 0:01:01
381500 -- (-506.532) (-503.363) [-497.955] (-499.673) * (-500.758) (-504.009) [-500.486] (-499.962) -- 0:01:01
382000 -- (-507.499) (-501.350) [-498.668] (-500.912) * (-499.642) [-506.793] (-498.214) (-501.617) -- 0:01:01
382500 -- (-500.013) (-497.635) [-501.199] (-506.237) * (-506.937) (-501.169) [-505.844] (-498.754) -- 0:01:01
383000 -- [-499.130] (-508.775) (-498.840) (-504.617) * [-507.288] (-504.316) (-501.052) (-495.407) -- 0:01:01
383500 -- (-496.311) [-504.890] (-503.388) (-502.211) * (-505.832) (-501.373) (-499.452) [-499.158] -- 0:01:01
384000 -- (-499.992) (-500.144) (-510.624) [-503.582] * (-508.264) [-496.909] (-503.979) (-504.289) -- 0:01:00
384500 -- (-499.478) (-508.720) [-499.713] (-497.798) * (-505.800) (-497.261) [-495.016] (-502.598) -- 0:01:02
385000 -- (-503.660) [-503.033] (-499.230) (-500.427) * (-498.977) (-498.907) [-503.764] (-498.717) -- 0:01:02
Average standard deviation of split frequencies: 0.014655
385500 -- [-498.400] (-503.040) (-498.240) (-505.640) * (-500.643) (-506.467) [-499.983] (-502.585) -- 0:01:02
386000 -- (-497.030) (-505.309) [-496.705] (-498.238) * (-503.737) (-502.272) (-510.580) [-503.800] -- 0:01:02
386500 -- (-501.086) [-505.596] (-502.781) (-499.148) * [-497.094] (-505.645) (-498.204) (-503.211) -- 0:01:01
387000 -- (-504.283) (-507.698) [-501.540] (-499.762) * (-502.021) (-500.311) [-495.787] (-505.598) -- 0:01:01
387500 -- (-502.490) [-504.251] (-501.577) (-505.384) * (-499.826) [-498.374] (-500.475) (-502.087) -- 0:01:01
388000 -- (-504.607) [-498.798] (-498.669) (-506.076) * (-500.161) (-508.186) [-501.325] (-505.683) -- 0:01:01
388500 -- (-498.195) (-497.425) (-499.347) [-500.525] * [-502.262] (-502.444) (-498.963) (-504.270) -- 0:01:01
389000 -- (-498.945) (-499.694) (-501.771) [-497.661] * (-499.704) (-504.839) [-501.306] (-505.276) -- 0:01:01
389500 -- [-498.901] (-503.344) (-500.438) (-500.464) * (-503.596) (-503.212) [-504.101] (-504.981) -- 0:01:01
390000 -- (-497.162) (-501.892) [-500.139] (-502.014) * (-499.812) (-503.359) [-500.612] (-505.900) -- 0:01:01
Average standard deviation of split frequencies: 0.016491
390500 -- [-499.978] (-504.971) (-506.434) (-501.852) * (-499.129) (-500.358) (-507.184) [-500.172] -- 0:01:00
391000 -- (-504.556) (-504.380) (-499.476) [-500.851] * (-503.504) (-507.183) (-503.922) [-499.155] -- 0:01:00
391500 -- (-501.604) (-506.771) [-499.122] (-504.624) * (-502.516) (-498.609) (-498.898) [-497.637] -- 0:01:00
392000 -- (-507.587) (-496.802) (-499.098) [-504.265] * [-499.616] (-499.547) (-502.935) (-502.906) -- 0:01:00
392500 -- (-500.118) (-500.196) (-505.539) [-502.229] * (-498.891) (-501.057) [-503.639] (-504.365) -- 0:01:00
393000 -- [-498.957] (-499.748) (-500.993) (-501.293) * (-501.263) [-500.176] (-505.156) (-502.720) -- 0:01:00
393500 -- (-498.743) (-499.396) (-502.152) [-499.426] * (-500.609) (-508.284) (-502.038) [-504.564] -- 0:01:00
394000 -- (-503.966) (-497.671) (-501.763) [-498.556] * (-507.044) (-503.104) (-499.072) [-501.608] -- 0:00:59
394500 -- (-498.434) (-498.996) (-500.418) [-500.791] * (-506.601) (-497.813) (-499.672) [-500.207] -- 0:00:59
395000 -- (-504.545) [-497.764] (-505.306) (-501.082) * (-498.193) (-503.039) [-497.529] (-503.376) -- 0:01:01
Average standard deviation of split frequencies: 0.013888
395500 -- [-502.113] (-503.736) (-505.537) (-504.608) * (-505.893) (-499.886) (-500.131) [-501.895] -- 0:01:01
396000 -- [-497.514] (-500.835) (-503.875) (-505.220) * [-496.789] (-507.199) (-499.790) (-503.773) -- 0:01:01
396500 -- (-506.501) [-499.221] (-508.659) (-502.618) * (-502.661) (-502.612) [-502.564] (-501.942) -- 0:01:00
397000 -- (-505.469) [-502.909] (-503.901) (-509.407) * (-500.746) [-500.408] (-502.206) (-509.335) -- 0:01:00
397500 -- (-499.424) [-503.420] (-506.167) (-513.447) * [-501.570] (-502.920) (-502.247) (-505.182) -- 0:01:00
398000 -- (-501.023) [-503.249] (-499.517) (-509.540) * [-499.226] (-503.380) (-501.332) (-499.472) -- 0:01:00
398500 -- (-497.893) (-507.314) [-497.039] (-511.227) * (-506.519) [-500.041] (-499.189) (-505.970) -- 0:01:00
399000 -- (-498.876) (-504.925) (-498.935) [-502.294] * (-499.720) [-501.288] (-498.026) (-505.251) -- 0:01:00
399500 -- (-499.315) (-506.689) (-500.175) [-504.381] * (-499.358) (-507.432) [-500.552] (-502.314) -- 0:01:00
400000 -- (-499.566) (-499.367) [-497.914] (-500.227) * (-504.186) (-501.473) (-500.355) [-501.047] -- 0:01:00
Average standard deviation of split frequencies: 0.014903
400500 -- (-503.146) (-508.877) [-496.986] (-503.381) * (-502.597) (-503.467) (-494.674) [-498.270] -- 0:00:59
401000 -- (-500.695) [-496.395] (-500.359) (-503.765) * (-506.423) [-498.663] (-496.287) (-501.046) -- 0:00:59
401500 -- (-503.237) (-502.071) (-503.426) [-502.962] * (-502.783) (-502.252) (-498.695) [-501.183] -- 0:00:59
402000 -- (-503.968) (-502.689) (-501.390) [-499.089] * (-503.560) (-500.396) [-500.475] (-499.169) -- 0:00:59
402500 -- (-503.714) [-501.993] (-503.603) (-496.132) * (-502.503) (-503.619) (-500.272) [-500.109] -- 0:00:59
403000 -- [-497.048] (-509.786) (-508.148) (-512.113) * [-501.473] (-503.733) (-503.252) (-503.503) -- 0:00:59
403500 -- (-500.122) (-500.028) (-500.006) [-509.142] * (-498.941) [-499.707] (-500.339) (-504.157) -- 0:00:59
404000 -- [-497.344] (-498.344) (-508.303) (-506.508) * [-501.137] (-498.709) (-506.708) (-502.639) -- 0:00:59
404500 -- (-500.297) (-502.297) [-500.278] (-500.518) * (-500.567) (-499.291) (-502.200) [-502.652] -- 0:00:58
405000 -- (-497.526) (-498.083) (-504.674) [-502.731] * (-501.772) [-498.939] (-504.283) (-505.786) -- 0:01:00
Average standard deviation of split frequencies: 0.011998
405500 -- (-499.391) (-501.055) (-499.509) [-500.429] * (-503.930) [-504.945] (-503.487) (-509.588) -- 0:01:00
406000 -- [-498.245] (-496.101) (-501.391) (-497.614) * (-506.929) (-500.572) [-506.428] (-506.540) -- 0:00:59
406500 -- (-500.456) [-498.732] (-505.680) (-502.622) * (-501.113) [-502.715] (-499.178) (-503.967) -- 0:00:59
407000 -- [-499.673] (-510.555) (-500.307) (-502.452) * (-498.180) (-504.508) (-499.280) [-498.995] -- 0:00:59
407500 -- [-498.072] (-501.827) (-504.391) (-504.323) * (-500.787) (-500.708) [-497.416] (-502.440) -- 0:00:59
408000 -- (-501.429) [-500.518] (-502.739) (-503.477) * (-502.875) (-506.646) (-502.087) [-498.686] -- 0:00:59
408500 -- (-497.405) (-497.797) [-503.374] (-501.816) * (-503.378) (-503.019) (-499.688) [-501.088] -- 0:00:59
409000 -- [-499.701] (-502.270) (-500.026) (-502.932) * (-495.987) (-512.740) (-499.374) [-501.172] -- 0:00:59
409500 -- (-501.946) [-497.062] (-502.996) (-496.014) * (-500.227) (-516.598) [-500.453] (-501.685) -- 0:00:59
410000 -- (-508.670) [-498.418] (-501.249) (-503.236) * (-499.610) (-510.201) (-496.819) [-498.308] -- 0:00:59
Average standard deviation of split frequencies: 0.011479
410500 -- (-499.776) [-501.299] (-501.054) (-497.387) * [-500.239] (-509.595) (-502.015) (-499.859) -- 0:00:58
411000 -- (-508.998) (-501.371) [-501.556] (-496.147) * (-501.529) (-508.043) [-501.685] (-501.286) -- 0:00:58
411500 -- [-498.563] (-500.545) (-503.979) (-499.648) * [-501.310] (-508.811) (-502.859) (-500.357) -- 0:00:58
412000 -- (-499.844) [-501.128] (-507.327) (-503.696) * [-499.396] (-505.749) (-502.588) (-508.231) -- 0:00:58
412500 -- (-497.532) (-497.910) (-506.581) [-496.755] * (-501.472) (-512.961) [-497.280] (-500.323) -- 0:00:58
413000 -- (-500.554) (-503.502) (-498.373) [-499.067] * (-504.730) (-522.388) (-502.977) [-504.994] -- 0:00:58
413500 -- (-496.834) (-507.371) [-500.715] (-503.765) * (-501.084) (-511.720) (-503.938) [-507.151] -- 0:00:58
414000 -- [-494.872] (-502.002) (-501.213) (-508.453) * (-502.912) (-511.760) [-505.759] (-501.658) -- 0:00:58
414500 -- (-496.256) [-501.419] (-497.093) (-508.799) * (-501.107) (-503.985) (-506.142) [-501.858] -- 0:00:57
415000 -- (-501.286) (-497.918) (-505.041) [-503.788] * (-506.309) (-510.277) (-509.769) [-506.726] -- 0:00:59
Average standard deviation of split frequencies: 0.012843
415500 -- (-501.689) (-507.531) [-498.981] (-502.962) * (-504.929) (-511.871) (-502.231) [-507.886] -- 0:00:59
416000 -- (-501.116) [-499.283] (-501.684) (-498.480) * (-505.883) (-508.398) (-498.756) [-504.207] -- 0:00:58
416500 -- [-500.042] (-508.141) (-503.169) (-499.753) * (-500.228) (-512.738) [-496.187] (-503.030) -- 0:00:58
417000 -- (-495.755) (-499.529) [-498.780] (-498.217) * (-497.978) (-505.623) [-498.282] (-503.265) -- 0:00:58
417500 -- [-496.727] (-502.598) (-504.716) (-497.976) * (-498.409) [-510.529] (-499.500) (-500.385) -- 0:00:58
418000 -- (-500.729) [-502.699] (-499.586) (-501.386) * (-502.637) (-513.227) [-499.000] (-503.562) -- 0:00:58
418500 -- (-499.058) (-506.944) [-502.992] (-501.644) * (-504.159) (-506.263) (-501.249) [-500.283] -- 0:00:58
419000 -- [-504.858] (-502.593) (-499.941) (-510.875) * (-497.148) (-507.084) (-499.105) [-502.296] -- 0:00:58
419500 -- (-500.408) (-501.303) [-497.845] (-502.546) * (-506.513) (-509.199) [-499.917] (-503.410) -- 0:00:58
420000 -- (-498.475) (-501.657) [-507.641] (-502.842) * (-506.733) (-511.135) (-508.076) [-507.872] -- 0:00:58
Average standard deviation of split frequencies: 0.012700
420500 -- [-498.551] (-512.211) (-496.350) (-502.640) * [-500.163] (-502.075) (-501.565) (-502.800) -- 0:00:57
421000 -- [-500.772] (-511.997) (-499.029) (-498.599) * (-501.789) [-503.910] (-507.454) (-513.536) -- 0:00:57
421500 -- (-499.231) (-502.029) [-499.657] (-504.818) * [-500.744] (-503.861) (-506.662) (-505.604) -- 0:00:57
422000 -- (-501.274) (-512.824) (-503.191) [-500.414] * (-502.656) (-505.253) (-506.337) [-501.766] -- 0:00:57
422500 -- (-498.636) [-516.667] (-499.033) (-496.979) * (-502.404) [-501.261] (-505.312) (-499.736) -- 0:00:57
423000 -- (-500.683) (-498.437) [-493.788] (-500.219) * (-502.893) (-499.994) [-499.914] (-502.400) -- 0:00:57
423500 -- [-495.907] (-501.052) (-505.166) (-504.024) * [-498.314] (-498.521) (-498.807) (-500.932) -- 0:00:57
424000 -- (-496.724) (-499.782) (-501.417) [-500.718] * [-498.464] (-505.514) (-498.265) (-510.177) -- 0:00:57
424500 -- (-505.191) (-504.255) [-498.937] (-501.162) * (-497.492) (-501.815) (-499.302) [-502.830] -- 0:00:56
425000 -- (-498.860) [-502.322] (-503.222) (-502.989) * (-501.328) [-501.417] (-502.249) (-502.190) -- 0:00:56
Average standard deviation of split frequencies: 0.014017
425500 -- (-502.974) (-504.892) [-497.428] (-508.720) * (-503.337) [-498.367] (-514.664) (-511.990) -- 0:00:58
426000 -- [-498.494] (-502.050) (-504.603) (-501.014) * (-503.749) (-505.721) [-500.623] (-505.911) -- 0:00:57
426500 -- (-499.753) [-500.804] (-500.781) (-505.506) * (-498.044) [-501.465] (-498.108) (-509.608) -- 0:00:57
427000 -- (-502.046) [-497.924] (-504.326) (-501.185) * (-500.206) [-501.579] (-500.795) (-501.102) -- 0:00:57
427500 -- (-500.344) [-504.965] (-500.634) (-500.970) * [-498.455] (-507.063) (-500.833) (-504.424) -- 0:00:57
428000 -- [-496.655] (-502.082) (-503.130) (-497.070) * [-503.295] (-496.622) (-506.706) (-499.552) -- 0:00:57
428500 -- (-503.802) (-499.256) [-502.988] (-500.735) * (-501.572) (-498.688) [-503.618] (-501.264) -- 0:00:57
429000 -- [-501.119] (-502.976) (-501.160) (-498.346) * (-499.791) [-499.098] (-501.574) (-503.865) -- 0:00:57
429500 -- (-502.807) (-500.435) (-503.721) [-504.900] * (-498.085) [-496.847] (-502.609) (-512.012) -- 0:00:57
430000 -- (-497.673) (-505.413) [-501.313] (-501.239) * [-501.018] (-500.143) (-500.161) (-502.740) -- 0:00:57
Average standard deviation of split frequencies: 0.016419
430500 -- (-498.352) (-496.234) [-507.036] (-497.570) * (-494.714) [-497.230] (-505.497) (-500.875) -- 0:00:56
431000 -- [-506.349] (-499.952) (-498.499) (-499.580) * (-497.724) [-499.563] (-499.382) (-506.058) -- 0:00:56
431500 -- (-505.097) (-504.799) (-498.799) [-501.013] * (-498.771) [-496.737] (-502.202) (-503.000) -- 0:00:56
432000 -- (-495.888) (-502.288) (-502.672) [-499.523] * (-501.822) (-496.914) (-504.168) [-501.243] -- 0:00:56
432500 -- (-506.323) (-500.248) [-502.861] (-501.430) * (-500.561) [-498.372] (-495.894) (-497.985) -- 0:00:56
433000 -- (-505.560) [-498.872] (-503.975) (-497.648) * (-500.372) (-500.257) (-494.711) [-502.504] -- 0:00:56
433500 -- [-503.636] (-499.345) (-498.103) (-502.834) * (-503.271) [-502.859] (-500.977) (-504.761) -- 0:00:56
434000 -- (-507.505) [-504.162] (-500.480) (-498.814) * (-506.150) (-500.429) (-503.029) [-510.886] -- 0:00:56
434500 -- [-501.288] (-508.565) (-498.484) (-499.371) * [-498.942] (-504.896) (-501.393) (-510.089) -- 0:00:55
435000 -- (-500.308) (-502.655) [-501.316] (-501.458) * [-497.744] (-502.559) (-499.354) (-511.566) -- 0:00:55
Average standard deviation of split frequencies: 0.017299
435500 -- (-506.511) [-505.241] (-506.228) (-501.162) * (-498.976) [-501.429] (-502.945) (-502.939) -- 0:00:55
436000 -- (-498.711) (-503.272) [-501.154] (-498.451) * (-501.716) (-502.672) [-499.134] (-505.993) -- 0:00:56
436500 -- (-501.695) (-497.614) (-503.530) [-498.231] * [-500.981] (-498.853) (-496.526) (-503.268) -- 0:00:56
437000 -- (-504.540) [-497.917] (-512.418) (-494.517) * (-504.502) (-508.983) [-499.415] (-507.790) -- 0:00:56
437500 -- (-502.185) (-500.887) (-507.282) [-499.438] * (-500.205) (-500.002) [-495.436] (-502.133) -- 0:00:56
438000 -- [-496.290] (-504.061) (-508.989) (-506.684) * (-501.587) (-503.344) [-494.415] (-523.287) -- 0:00:56
438500 -- [-502.141] (-501.674) (-503.833) (-509.284) * (-502.779) [-498.869] (-498.942) (-501.947) -- 0:00:56
439000 -- (-499.214) [-499.375] (-503.353) (-501.995) * (-500.710) (-497.359) [-502.377] (-501.421) -- 0:00:56
439500 -- (-504.379) [-504.739] (-505.787) (-497.030) * (-499.032) (-502.685) [-496.184] (-498.304) -- 0:00:56
440000 -- (-501.510) (-499.154) [-508.739] (-497.338) * (-498.039) (-501.664) [-497.214] (-497.812) -- 0:00:56
Average standard deviation of split frequencies: 0.016046
440500 -- (-502.145) (-502.533) (-502.189) [-495.953] * [-500.286] (-500.152) (-501.748) (-500.924) -- 0:00:55
441000 -- (-499.057) (-498.677) (-502.270) [-497.972] * (-499.622) (-496.502) [-499.257] (-504.534) -- 0:00:55
441500 -- [-498.014] (-504.657) (-501.411) (-501.712) * (-502.443) (-501.375) (-500.770) [-501.469] -- 0:00:55
442000 -- (-502.797) (-503.525) [-504.402] (-502.207) * [-501.442] (-502.326) (-494.654) (-512.801) -- 0:00:55
442500 -- (-497.479) [-500.213] (-506.645) (-500.943) * (-503.488) (-500.537) [-498.073] (-503.995) -- 0:00:55
443000 -- (-502.722) (-500.542) (-504.513) [-497.394] * (-504.031) (-507.375) [-501.437] (-508.103) -- 0:00:55
443500 -- (-501.092) [-497.311] (-498.761) (-501.171) * (-502.416) [-500.078] (-503.029) (-499.563) -- 0:00:55
444000 -- [-496.597] (-500.396) (-500.243) (-508.635) * (-507.457) (-497.409) (-499.184) [-497.176] -- 0:00:55
444500 -- (-501.223) (-500.250) (-498.713) [-508.759] * (-504.594) [-502.512] (-504.972) (-497.831) -- 0:00:54
445000 -- (-497.766) (-498.833) [-499.436] (-500.791) * (-504.229) (-503.701) (-503.032) [-498.963] -- 0:00:54
Average standard deviation of split frequencies: 0.014445
445500 -- (-502.747) [-509.701] (-498.550) (-502.679) * (-504.341) [-499.887] (-507.262) (-499.309) -- 0:00:56
446000 -- (-501.777) (-507.451) [-498.851] (-509.452) * [-499.281] (-499.378) (-500.722) (-503.973) -- 0:00:55
446500 -- (-504.918) (-502.297) (-507.474) [-500.590] * (-502.080) [-499.645] (-497.782) (-501.155) -- 0:00:55
447000 -- (-498.535) [-498.903] (-499.922) (-504.554) * [-498.557] (-500.711) (-500.232) (-503.546) -- 0:00:55
447500 -- (-501.126) (-500.494) [-498.168] (-502.901) * [-501.982] (-497.672) (-502.470) (-500.379) -- 0:00:55
448000 -- (-501.161) [-502.725] (-502.065) (-503.969) * (-506.494) (-500.505) [-500.044] (-497.032) -- 0:00:55
448500 -- (-500.320) [-499.164] (-501.845) (-501.862) * (-503.764) [-496.525] (-500.864) (-503.420) -- 0:00:55
449000 -- (-501.670) (-506.773) [-501.223] (-502.434) * (-499.528) (-504.001) [-501.277] (-511.095) -- 0:00:55
449500 -- [-497.129] (-504.116) (-498.693) (-502.192) * [-500.772] (-500.473) (-501.457) (-502.777) -- 0:00:55
450000 -- [-498.362] (-503.890) (-499.811) (-499.129) * (-508.205) [-501.039] (-504.290) (-499.399) -- 0:00:55
Average standard deviation of split frequencies: 0.014993
450500 -- (-506.895) [-503.392] (-498.094) (-505.526) * (-503.579) [-499.957] (-501.299) (-497.482) -- 0:00:54
451000 -- (-500.030) (-508.221) [-499.916] (-500.930) * [-501.777] (-501.627) (-504.737) (-497.600) -- 0:00:54
451500 -- (-500.927) (-508.911) [-501.060] (-502.618) * (-508.947) [-500.870] (-501.390) (-500.001) -- 0:00:54
452000 -- (-510.901) (-505.050) (-506.333) [-498.377] * (-505.613) (-498.947) [-503.979] (-502.720) -- 0:00:54
452500 -- (-497.765) (-506.112) [-499.935] (-499.849) * (-502.353) (-500.110) [-496.993] (-498.445) -- 0:00:54
453000 -- [-499.211] (-506.185) (-503.044) (-498.466) * [-501.423] (-501.633) (-503.860) (-502.219) -- 0:00:54
453500 -- [-498.096] (-503.425) (-500.656) (-503.891) * (-498.333) (-498.739) (-499.608) [-503.330] -- 0:00:54
454000 -- [-498.804] (-508.504) (-502.687) (-502.712) * (-502.014) (-501.272) (-496.014) [-501.382] -- 0:00:54
454500 -- (-501.252) (-507.652) [-499.030] (-504.852) * (-500.162) (-499.638) [-499.406] (-508.305) -- 0:00:54
455000 -- (-499.092) (-505.501) (-502.698) [-504.883] * (-495.864) (-502.703) [-500.607] (-505.867) -- 0:00:53
Average standard deviation of split frequencies: 0.015851
455500 -- (-500.443) (-509.133) [-501.833] (-506.258) * (-499.488) (-498.381) (-502.585) [-495.859] -- 0:00:53
456000 -- (-504.255) (-502.614) (-510.394) [-502.396] * (-502.145) (-501.102) (-500.764) [-502.341] -- 0:00:54
456500 -- (-499.533) (-506.362) [-500.697] (-503.620) * [-499.319] (-501.986) (-498.047) (-499.282) -- 0:00:54
457000 -- (-503.520) (-509.077) [-496.969] (-499.584) * (-507.657) (-503.363) (-498.087) [-498.892] -- 0:00:54
457500 -- (-496.705) (-501.197) (-500.784) [-495.469] * (-502.528) [-503.701] (-508.673) (-497.416) -- 0:00:54
458000 -- (-499.464) (-502.058) (-496.836) [-502.552] * [-504.080] (-498.961) (-510.029) (-502.599) -- 0:00:54
458500 -- (-497.772) [-503.997] (-502.650) (-504.254) * (-505.480) (-500.923) [-500.864] (-498.724) -- 0:00:54
459000 -- (-510.482) (-499.684) [-502.920] (-500.343) * [-496.094] (-507.803) (-503.023) (-500.044) -- 0:00:54
459500 -- (-506.706) [-501.374] (-497.104) (-504.152) * (-501.273) (-502.161) [-502.410] (-502.623) -- 0:00:54
460000 -- [-504.270] (-496.690) (-512.099) (-506.974) * (-500.220) (-497.610) (-502.265) [-506.986] -- 0:00:54
Average standard deviation of split frequencies: 0.017055
460500 -- (-499.848) (-497.959) (-501.302) [-503.993] * (-501.092) [-503.291] (-495.623) (-510.849) -- 0:00:53
461000 -- [-505.374] (-503.466) (-500.072) (-497.846) * (-501.675) (-498.310) [-501.529] (-506.680) -- 0:00:53
461500 -- (-498.937) [-500.369] (-505.479) (-500.560) * (-498.868) [-500.215] (-499.894) (-506.063) -- 0:00:53
462000 -- [-500.551] (-500.870) (-502.973) (-498.782) * [-501.299] (-498.627) (-499.477) (-505.871) -- 0:00:53
462500 -- [-501.506] (-502.235) (-500.422) (-503.175) * [-499.714] (-504.029) (-504.081) (-501.777) -- 0:00:53
463000 -- (-500.565) (-502.575) [-503.474] (-499.412) * (-502.161) (-502.205) [-504.853] (-502.719) -- 0:00:53
463500 -- (-497.021) (-499.096) [-499.330] (-504.374) * (-503.289) (-498.263) [-500.441] (-500.128) -- 0:00:53
464000 -- (-501.887) (-507.979) [-505.038] (-496.345) * (-501.394) (-500.420) [-501.641] (-497.136) -- 0:00:53
464500 -- [-501.628] (-501.524) (-504.823) (-500.195) * (-502.645) (-501.949) (-507.926) [-497.843] -- 0:00:53
465000 -- (-502.640) (-502.133) (-498.724) [-503.767] * (-508.079) [-506.932] (-497.898) (-497.753) -- 0:00:52
Average standard deviation of split frequencies: 0.014500
465500 -- (-503.695) (-509.641) (-498.169) [-501.112] * (-507.721) (-495.513) [-498.130] (-502.011) -- 0:00:52
466000 -- (-506.192) (-513.146) [-499.171] (-503.847) * [-503.674] (-501.417) (-497.312) (-498.243) -- 0:00:53
466500 -- (-504.301) (-502.178) (-500.646) [-499.425] * (-502.140) [-493.631] (-496.529) (-498.032) -- 0:00:53
467000 -- [-505.137] (-502.231) (-499.925) (-501.828) * (-504.792) [-497.371] (-497.297) (-501.772) -- 0:00:53
467500 -- (-500.824) [-499.924] (-503.905) (-501.132) * (-501.122) (-499.423) [-498.785] (-502.364) -- 0:00:53
468000 -- [-502.096] (-503.945) (-501.579) (-502.198) * (-504.310) (-504.791) (-496.620) [-503.307] -- 0:00:53
468500 -- (-507.499) (-505.942) [-497.258] (-497.511) * (-511.256) [-497.209] (-501.766) (-496.064) -- 0:00:53
469000 -- (-502.458) (-498.218) (-503.501) [-499.798] * (-507.660) [-500.060] (-504.248) (-504.417) -- 0:00:53
469500 -- (-501.126) [-499.811] (-501.923) (-497.842) * (-505.001) [-495.925] (-501.480) (-500.984) -- 0:00:53
470000 -- (-502.013) (-501.419) (-502.581) [-498.242] * (-507.928) (-499.917) (-499.732) [-502.269] -- 0:00:53
Average standard deviation of split frequencies: 0.013688
470500 -- (-500.007) [-499.650] (-503.837) (-501.031) * (-505.491) [-496.596] (-505.502) (-510.104) -- 0:00:52
471000 -- (-505.807) (-501.984) [-500.000] (-503.589) * (-502.933) (-504.074) [-503.030] (-503.735) -- 0:00:52
471500 -- (-504.615) (-498.297) (-501.850) [-497.758] * (-502.767) (-496.169) (-502.006) [-499.895] -- 0:00:52
472000 -- [-501.733] (-497.242) (-503.201) (-497.817) * (-501.493) [-497.831] (-500.167) (-504.475) -- 0:00:52
472500 -- [-499.213] (-505.165) (-505.890) (-503.718) * (-500.669) [-497.585] (-504.524) (-507.053) -- 0:00:52
473000 -- (-504.756) [-504.454] (-499.111) (-501.134) * (-502.100) (-500.904) [-503.465] (-501.449) -- 0:00:52
473500 -- (-501.562) (-502.377) [-508.060] (-502.485) * (-499.120) [-501.157] (-502.950) (-503.856) -- 0:00:52
474000 -- (-501.999) [-503.117] (-501.697) (-504.933) * [-500.799] (-500.769) (-503.322) (-503.565) -- 0:00:52
474500 -- (-506.336) [-498.243] (-502.186) (-507.558) * (-512.423) (-503.140) [-500.387] (-503.636) -- 0:00:52
475000 -- (-499.038) [-498.088] (-506.961) (-506.178) * (-498.873) (-500.046) [-501.371] (-506.982) -- 0:00:51
Average standard deviation of split frequencies: 0.014195
475500 -- [-498.580] (-511.545) (-505.192) (-499.816) * (-501.348) (-500.621) [-502.118] (-505.274) -- 0:00:51
476000 -- (-497.377) [-498.017] (-500.218) (-508.570) * [-500.708] (-498.426) (-501.210) (-505.802) -- 0:00:51
476500 -- [-502.900] (-501.978) (-503.707) (-501.875) * (-501.394) (-498.386) (-504.504) [-499.596] -- 0:00:52
477000 -- (-498.826) [-502.672] (-498.722) (-501.892) * (-500.877) (-497.098) (-501.891) [-497.481] -- 0:00:52
477500 -- (-499.562) [-499.471] (-498.983) (-498.576) * (-499.327) [-501.177] (-510.259) (-497.156) -- 0:00:52
478000 -- [-503.833] (-501.892) (-503.513) (-501.017) * (-503.666) (-499.172) [-501.663] (-503.389) -- 0:00:52
478500 -- [-500.757] (-499.583) (-506.458) (-496.824) * (-501.543) (-502.283) (-506.493) [-497.031] -- 0:00:52
479000 -- (-507.496) [-500.559] (-500.120) (-501.231) * [-502.624] (-502.316) (-506.860) (-497.874) -- 0:00:52
479500 -- [-501.700] (-500.343) (-504.854) (-503.255) * (-504.093) (-501.476) [-502.675] (-498.220) -- 0:00:52
480000 -- (-500.519) (-500.310) (-500.885) [-498.330] * (-517.094) (-503.197) [-497.875] (-500.588) -- 0:00:52
Average standard deviation of split frequencies: 0.011442
480500 -- (-502.184) (-499.143) [-500.164] (-499.525) * (-508.130) [-497.082] (-500.758) (-498.446) -- 0:00:51
481000 -- (-501.180) (-503.039) (-509.442) [-498.649] * (-503.282) (-498.037) (-497.286) [-509.927] -- 0:00:51
481500 -- (-504.239) [-504.697] (-501.541) (-504.263) * (-504.056) [-497.588] (-500.824) (-502.986) -- 0:00:51
482000 -- (-499.687) [-498.263] (-497.899) (-503.178) * [-497.935] (-499.733) (-499.620) (-514.621) -- 0:00:51
482500 -- [-501.446] (-499.703) (-497.527) (-498.501) * (-500.259) [-498.954] (-505.184) (-509.119) -- 0:00:51
483000 -- (-500.391) [-500.051] (-504.122) (-498.324) * [-502.312] (-500.952) (-502.336) (-503.573) -- 0:00:51
483500 -- [-497.454] (-503.067) (-499.431) (-504.779) * (-498.067) [-501.495] (-504.696) (-502.574) -- 0:00:51
484000 -- (-500.522) [-495.464] (-499.591) (-507.669) * (-500.055) (-500.615) (-499.965) [-507.850] -- 0:00:51
484500 -- (-498.887) [-497.715] (-502.062) (-499.138) * [-502.199] (-498.483) (-502.179) (-499.975) -- 0:00:51
485000 -- (-500.982) (-501.229) (-497.664) [-498.914] * (-502.318) (-500.752) [-504.016] (-499.486) -- 0:00:50
Average standard deviation of split frequencies: 0.012286
485500 -- (-499.778) (-497.738) (-514.415) [-496.500] * (-500.630) (-498.487) [-506.820] (-497.477) -- 0:00:50
486000 -- (-500.346) (-496.339) [-505.014] (-495.999) * (-498.890) (-495.979) [-501.844] (-500.456) -- 0:00:51
486500 -- (-500.135) [-496.061] (-494.378) (-498.779) * (-500.596) (-498.121) (-509.032) [-502.272] -- 0:00:51
487000 -- [-499.921] (-502.833) (-500.496) (-505.294) * [-502.189] (-501.722) (-510.964) (-502.282) -- 0:00:51
487500 -- (-497.120) (-510.278) (-497.538) [-498.236] * [-498.995] (-500.719) (-508.843) (-509.000) -- 0:00:51
488000 -- (-501.254) (-502.006) [-501.789] (-506.690) * (-505.474) (-503.417) (-503.298) [-503.145] -- 0:00:51
488500 -- [-499.592] (-498.839) (-502.565) (-507.337) * (-501.299) [-497.929] (-508.179) (-504.752) -- 0:00:51
489000 -- [-498.200] (-499.380) (-504.152) (-503.902) * (-498.324) [-501.330] (-502.760) (-506.730) -- 0:00:51
489500 -- [-496.234] (-496.494) (-500.378) (-502.646) * [-500.773] (-505.289) (-500.121) (-511.496) -- 0:00:51
490000 -- [-501.382] (-503.383) (-499.415) (-502.256) * [-497.892] (-503.715) (-508.933) (-507.098) -- 0:00:51
Average standard deviation of split frequencies: 0.012169
490500 -- [-504.605] (-505.926) (-497.792) (-502.670) * (-500.442) (-503.791) [-503.922] (-505.656) -- 0:00:50
491000 -- [-501.084] (-504.772) (-507.240) (-501.523) * (-499.307) [-502.254] (-504.591) (-500.101) -- 0:00:50
491500 -- [-506.046] (-504.820) (-499.504) (-503.651) * [-496.605] (-499.898) (-503.088) (-501.891) -- 0:00:50
492000 -- (-502.617) (-499.014) [-502.901] (-503.044) * (-502.639) [-498.376] (-510.834) (-500.870) -- 0:00:50
492500 -- (-504.551) (-498.571) [-501.408] (-497.518) * (-501.796) [-499.671] (-509.557) (-505.730) -- 0:00:50
493000 -- (-507.151) [-499.210] (-507.312) (-503.545) * (-500.852) [-497.196] (-510.372) (-504.053) -- 0:00:50
493500 -- [-508.911] (-502.391) (-503.620) (-505.873) * (-500.221) [-499.735] (-505.302) (-508.587) -- 0:00:50
494000 -- (-509.886) (-503.004) [-500.758] (-504.460) * (-504.872) (-499.855) [-499.804] (-506.732) -- 0:00:50
494500 -- [-503.379] (-500.418) (-502.209) (-497.814) * (-503.750) (-500.677) (-503.456) [-503.293] -- 0:00:50
495000 -- (-502.965) (-502.709) [-502.044] (-499.476) * (-503.610) (-498.260) (-511.369) [-503.076] -- 0:00:49
Average standard deviation of split frequencies: 0.012355
495500 -- [-502.397] (-501.685) (-498.506) (-496.607) * [-500.006] (-498.972) (-502.084) (-504.894) -- 0:00:49
496000 -- (-498.233) [-499.170] (-501.991) (-498.918) * [-499.836] (-497.390) (-500.309) (-500.113) -- 0:00:49
496500 -- [-498.392] (-503.372) (-505.008) (-504.809) * [-498.861] (-501.329) (-503.417) (-504.621) -- 0:00:50
497000 -- (-501.906) [-502.041] (-500.770) (-502.276) * (-501.335) [-502.010] (-498.772) (-506.404) -- 0:00:50
497500 -- (-499.449) [-497.862] (-506.556) (-503.089) * [-500.395] (-499.556) (-505.122) (-506.595) -- 0:00:50
498000 -- (-496.768) [-507.398] (-497.522) (-505.696) * (-506.771) [-500.780] (-508.918) (-503.790) -- 0:00:50
498500 -- (-497.246) (-500.679) (-497.097) [-499.790] * (-501.881) (-498.354) (-504.940) [-498.218] -- 0:00:50
499000 -- (-498.142) [-499.611] (-499.098) (-501.375) * (-504.452) (-505.886) [-503.669] (-504.591) -- 0:00:50
499500 -- (-500.675) (-504.032) [-495.645] (-500.754) * (-499.535) (-498.396) (-508.428) [-505.836] -- 0:00:50
500000 -- (-502.514) (-515.004) [-501.148] (-504.145) * (-503.517) [-498.158] (-503.390) (-500.849) -- 0:00:50
Average standard deviation of split frequencies: 0.012868
500500 -- (-512.254) (-507.146) [-501.751] (-501.643) * [-501.278] (-505.122) (-500.605) (-502.851) -- 0:00:49
501000 -- (-506.173) (-499.263) (-501.795) [-503.121] * (-502.253) (-513.602) (-504.849) [-500.428] -- 0:00:49
501500 -- (-508.388) (-503.158) [-496.710] (-501.673) * (-501.050) (-497.214) (-500.459) [-500.096] -- 0:00:49
502000 -- (-500.536) [-501.325] (-496.459) (-497.016) * (-500.124) (-500.780) (-503.033) [-505.300] -- 0:00:49
502500 -- (-502.159) (-498.910) [-502.210] (-501.635) * (-497.706) [-500.350] (-499.799) (-500.488) -- 0:00:49
503000 -- (-507.360) [-498.149] (-497.399) (-505.178) * (-502.187) [-503.168] (-501.053) (-499.445) -- 0:00:49
503500 -- (-500.210) (-497.082) (-497.797) [-498.721] * [-497.269] (-501.665) (-503.823) (-502.644) -- 0:00:49
504000 -- (-499.649) (-499.304) (-500.902) [-505.176] * (-501.937) [-498.185] (-504.604) (-503.880) -- 0:00:49
504500 -- (-503.913) (-499.887) [-505.404] (-501.460) * (-498.812) (-500.336) [-502.744] (-507.797) -- 0:00:49
505000 -- (-506.084) (-502.606) (-500.008) [-501.809] * (-499.674) [-502.121] (-504.340) (-504.311) -- 0:00:49
Average standard deviation of split frequencies: 0.012422
505500 -- [-499.377] (-502.646) (-497.947) (-498.912) * (-500.761) (-504.663) (-501.820) [-502.904] -- 0:00:48
506000 -- [-502.760] (-500.658) (-498.809) (-501.054) * (-504.710) (-511.267) (-507.812) [-504.236] -- 0:00:48
506500 -- [-502.860] (-501.959) (-509.763) (-502.443) * [-502.646] (-504.540) (-503.835) (-504.875) -- 0:00:49
507000 -- (-498.517) [-499.275] (-506.171) (-505.686) * (-499.415) (-506.391) [-501.643] (-513.818) -- 0:00:49
507500 -- (-502.365) (-501.027) (-509.938) [-498.440] * (-500.454) (-504.366) [-499.041] (-499.230) -- 0:00:49
508000 -- [-500.287] (-502.938) (-502.789) (-501.325) * (-500.808) (-506.518) [-498.253] (-504.081) -- 0:00:49
508500 -- (-501.000) [-503.346] (-498.719) (-504.343) * (-503.971) (-503.330) (-496.159) [-503.010] -- 0:00:49
509000 -- (-495.445) (-501.945) [-499.340] (-498.416) * (-498.779) [-501.679] (-499.860) (-504.116) -- 0:00:49
509500 -- (-499.695) (-505.534) (-503.469) [-501.837] * [-496.459] (-504.276) (-506.216) (-497.164) -- 0:00:49
510000 -- (-501.334) (-498.147) [-498.811] (-499.198) * (-495.510) (-505.095) [-497.705] (-495.516) -- 0:00:49
Average standard deviation of split frequencies: 0.012924
510500 -- (-497.287) [-501.008] (-503.452) (-498.995) * (-497.159) (-500.887) [-497.889] (-496.404) -- 0:00:48
511000 -- (-500.398) (-499.070) [-500.071] (-497.610) * (-503.409) (-500.010) [-499.364] (-498.091) -- 0:00:48
511500 -- (-501.823) (-498.661) (-497.529) [-498.997] * (-499.678) (-506.881) (-498.803) [-497.940] -- 0:00:48
512000 -- (-499.815) [-497.186] (-500.691) (-501.710) * [-500.692] (-502.527) (-498.716) (-504.749) -- 0:00:48
512500 -- [-501.142] (-496.597) (-503.237) (-498.786) * (-501.025) (-502.851) (-500.742) [-499.038] -- 0:00:48
513000 -- (-503.619) [-499.283] (-502.001) (-500.112) * (-493.852) [-501.021] (-502.301) (-494.161) -- 0:00:48
513500 -- (-505.318) (-497.356) [-499.809] (-501.608) * (-498.035) (-502.742) (-502.425) [-496.611] -- 0:00:48
514000 -- (-507.902) (-500.869) [-498.718] (-506.869) * (-498.680) (-499.852) [-501.305] (-497.870) -- 0:00:48
514500 -- [-497.755] (-498.953) (-500.572) (-502.004) * (-498.329) (-496.733) [-501.375] (-502.739) -- 0:00:48
515000 -- (-499.930) (-499.213) (-505.689) [-505.548] * [-495.903] (-508.348) (-500.917) (-497.436) -- 0:00:48
Average standard deviation of split frequencies: 0.014313
515500 -- (-505.335) (-504.070) (-501.421) [-500.769] * (-498.257) (-503.666) [-499.937] (-496.689) -- 0:00:47
516000 -- (-500.920) (-503.771) [-502.960] (-500.974) * (-499.586) [-498.066] (-501.437) (-496.890) -- 0:00:47
516500 -- (-501.137) (-502.496) (-503.318) [-498.591] * (-497.579) (-500.575) [-499.284] (-500.240) -- 0:00:47
517000 -- [-499.555] (-502.770) (-502.103) (-502.621) * (-497.100) [-501.409] (-503.016) (-502.812) -- 0:00:48
517500 -- (-502.025) [-502.569] (-502.366) (-510.115) * (-505.215) [-500.436] (-503.337) (-502.999) -- 0:00:48
518000 -- (-498.326) [-502.671] (-503.820) (-504.596) * (-500.974) (-504.948) [-502.571] (-502.783) -- 0:00:48
518500 -- (-500.241) (-503.366) [-506.214] (-507.177) * (-498.869) (-506.246) [-496.855] (-502.072) -- 0:00:48
519000 -- (-505.216) (-511.408) [-500.451] (-508.806) * (-507.467) [-500.252] (-497.276) (-502.075) -- 0:00:48
519500 -- (-500.508) [-502.732] (-505.025) (-508.760) * (-503.626) [-507.106] (-500.330) (-501.319) -- 0:00:48
520000 -- (-502.393) [-501.764] (-503.073) (-507.999) * (-499.257) (-500.733) [-497.572] (-507.623) -- 0:00:48
Average standard deviation of split frequencies: 0.014486
520500 -- (-506.404) (-501.424) [-500.107] (-505.661) * (-505.139) (-505.363) (-497.246) [-503.860] -- 0:00:47
521000 -- (-501.704) (-500.916) (-501.567) [-503.804] * [-502.502] (-505.369) (-498.494) (-496.714) -- 0:00:47
521500 -- (-506.833) [-501.262] (-498.407) (-504.243) * (-505.605) [-502.487] (-499.023) (-504.017) -- 0:00:47
522000 -- (-504.800) (-499.035) [-500.588] (-507.079) * (-502.989) [-500.044] (-503.843) (-507.327) -- 0:00:47
522500 -- [-497.931] (-498.877) (-501.537) (-510.479) * (-506.754) (-505.060) [-500.598] (-501.730) -- 0:00:47
523000 -- (-505.142) (-503.928) (-503.970) [-498.780] * (-506.358) (-513.095) (-499.608) [-500.642] -- 0:00:47
523500 -- (-505.574) (-500.941) [-497.772] (-500.994) * (-500.299) (-502.642) [-495.755] (-505.700) -- 0:00:47
524000 -- (-498.014) [-502.801] (-504.548) (-508.974) * (-504.408) [-500.515] (-504.238) (-499.568) -- 0:00:47
524500 -- (-500.642) (-499.334) (-503.877) [-497.959] * (-504.376) (-501.730) [-500.051] (-498.670) -- 0:00:47
525000 -- (-503.430) (-504.349) (-499.813) [-502.170] * [-497.747] (-511.042) (-500.052) (-499.535) -- 0:00:47
Average standard deviation of split frequencies: 0.014638
525500 -- [-498.788] (-501.125) (-498.382) (-504.702) * [-495.937] (-504.238) (-504.940) (-499.636) -- 0:00:46
526000 -- (-499.057) [-496.827] (-500.849) (-500.516) * [-498.447] (-500.673) (-498.097) (-498.616) -- 0:00:46
526500 -- [-503.048] (-498.133) (-502.593) (-505.807) * (-512.178) (-496.843) [-498.479] (-496.892) -- 0:00:47
527000 -- (-499.382) [-497.626] (-498.084) (-499.450) * (-499.676) [-500.857] (-498.988) (-500.369) -- 0:00:47
527500 -- (-503.384) (-501.035) [-499.508] (-503.146) * (-503.416) [-500.108] (-499.317) (-499.478) -- 0:00:47
528000 -- (-499.982) (-502.944) [-499.929] (-501.725) * (-503.096) (-504.307) [-499.701] (-497.634) -- 0:00:47
528500 -- [-499.952] (-500.034) (-502.237) (-501.157) * (-500.617) (-499.927) (-499.190) [-501.058] -- 0:00:47
529000 -- (-499.876) (-504.000) (-498.459) [-504.346] * (-503.791) (-504.046) [-499.730] (-500.825) -- 0:00:47
529500 -- (-503.577) [-499.262] (-499.967) (-497.735) * (-505.757) (-498.750) (-503.746) [-496.951] -- 0:00:47
530000 -- (-504.218) [-504.587] (-497.300) (-504.451) * (-508.186) (-500.177) [-499.475] (-501.860) -- 0:00:47
Average standard deviation of split frequencies: 0.015102
530500 -- (-505.043) [-501.819] (-500.077) (-505.207) * (-504.904) (-507.424) (-500.066) [-502.081] -- 0:00:46
531000 -- (-502.994) (-503.264) (-504.627) [-507.590] * (-499.662) [-498.311] (-506.394) (-504.944) -- 0:00:46
531500 -- (-501.010) [-503.221] (-500.132) (-503.432) * (-498.155) (-502.943) (-499.525) [-496.116] -- 0:00:46
532000 -- (-496.403) (-501.183) [-499.621] (-506.330) * [-505.501] (-501.702) (-502.395) (-507.466) -- 0:00:46
532500 -- (-500.549) [-500.911] (-501.774) (-498.332) * (-500.210) [-503.643] (-504.314) (-507.760) -- 0:00:46
533000 -- (-502.657) [-498.917] (-498.205) (-498.270) * (-504.080) [-497.970] (-505.477) (-506.294) -- 0:00:46
533500 -- (-506.508) (-503.444) [-498.099] (-497.612) * (-498.773) (-503.350) (-496.803) [-503.800] -- 0:00:46
534000 -- (-502.547) (-502.205) (-499.329) [-500.622] * (-499.142) (-500.688) (-502.882) [-506.590] -- 0:00:46
534500 -- (-503.941) (-500.433) [-499.538] (-498.025) * (-502.936) (-501.690) [-504.098] (-501.549) -- 0:00:46
535000 -- [-500.445] (-501.427) (-502.567) (-503.933) * [-501.299] (-505.922) (-500.937) (-506.407) -- 0:00:46
Average standard deviation of split frequencies: 0.015831
535500 -- (-501.743) (-499.564) [-500.991] (-500.278) * [-500.990] (-505.371) (-501.719) (-506.086) -- 0:00:45
536000 -- [-505.133] (-497.081) (-502.889) (-505.589) * (-504.889) (-499.419) (-504.485) [-499.786] -- 0:00:45
536500 -- (-511.611) (-499.373) [-500.727] (-505.963) * (-502.629) [-499.375] (-502.213) (-505.953) -- 0:00:45
537000 -- (-511.210) (-507.865) (-498.490) [-503.681] * (-503.529) (-502.645) [-498.364] (-502.265) -- 0:00:46
537500 -- (-501.902) (-500.284) [-498.995] (-498.806) * (-503.519) (-501.474) (-506.851) [-497.633] -- 0:00:46
538000 -- (-509.300) [-508.548] (-499.891) (-501.279) * (-502.147) [-501.950] (-501.597) (-503.690) -- 0:00:46
538500 -- (-498.042) (-496.356) (-496.895) [-497.429] * [-501.048] (-498.301) (-501.085) (-502.728) -- 0:00:46
539000 -- (-498.714) (-500.040) [-501.275] (-502.041) * (-501.502) (-502.848) [-500.985] (-501.499) -- 0:00:46
539500 -- (-501.022) (-505.564) (-499.440) [-503.872] * [-498.376] (-504.156) (-506.593) (-499.477) -- 0:00:46
540000 -- (-503.197) [-504.617] (-500.245) (-501.453) * (-501.920) (-502.152) (-502.245) [-494.743] -- 0:00:46
Average standard deviation of split frequencies: 0.013369
540500 -- [-502.345] (-499.365) (-500.033) (-499.527) * (-500.024) [-498.182] (-512.973) (-500.192) -- 0:00:45
541000 -- [-498.948] (-496.958) (-497.864) (-503.879) * (-504.557) [-497.574] (-501.534) (-497.520) -- 0:00:45
541500 -- (-506.639) [-499.358] (-499.731) (-501.801) * (-503.159) (-498.361) (-503.021) [-497.731] -- 0:00:45
542000 -- (-501.749) (-501.696) (-500.909) [-504.487] * (-502.700) [-501.924] (-503.874) (-500.942) -- 0:00:45
542500 -- (-503.473) (-498.688) [-494.838] (-503.362) * (-498.964) [-501.065] (-510.265) (-504.189) -- 0:00:45
543000 -- (-503.578) (-508.443) [-508.139] (-504.902) * (-499.502) (-508.276) (-506.880) [-499.359] -- 0:00:45
543500 -- (-499.408) (-504.249) [-502.544] (-502.629) * (-502.384) [-502.848] (-510.615) (-496.011) -- 0:00:45
544000 -- (-497.046) (-505.666) [-506.450] (-500.451) * (-503.484) [-498.184] (-506.435) (-502.418) -- 0:00:45
544500 -- (-499.676) (-502.646) [-502.686] (-502.537) * [-503.540] (-499.479) (-509.995) (-503.561) -- 0:00:45
545000 -- [-502.408] (-506.181) (-498.861) (-498.325) * (-500.309) (-503.087) [-504.144] (-503.373) -- 0:00:45
Average standard deviation of split frequencies: 0.012663
545500 -- (-503.865) (-500.915) [-500.630] (-499.638) * (-503.850) (-503.150) [-503.280] (-506.229) -- 0:00:44
546000 -- (-505.195) [-501.412] (-505.928) (-499.588) * (-499.796) [-501.278] (-511.903) (-508.380) -- 0:00:44
546500 -- (-503.086) (-506.316) [-498.566] (-500.267) * (-500.183) (-499.553) (-504.496) [-506.147] -- 0:00:44
547000 -- (-507.584) (-497.093) (-507.126) [-497.796] * (-498.706) (-497.146) (-502.129) [-505.078] -- 0:00:45
547500 -- [-498.348] (-502.260) (-503.586) (-506.520) * (-499.585) [-498.225] (-512.585) (-505.775) -- 0:00:45
548000 -- (-504.012) [-498.333] (-501.413) (-502.283) * (-501.090) (-499.321) (-507.448) [-502.487] -- 0:00:45
548500 -- (-503.168) [-500.763] (-500.005) (-501.767) * [-499.167] (-498.635) (-511.045) (-504.825) -- 0:00:45
549000 -- [-501.681] (-503.295) (-499.687) (-508.147) * (-509.381) [-502.531] (-500.361) (-507.745) -- 0:00:45
549500 -- (-499.041) [-507.396] (-502.447) (-498.760) * (-501.266) [-500.738] (-499.407) (-501.766) -- 0:00:45
550000 -- (-500.201) (-501.111) [-506.116] (-500.894) * (-496.982) (-506.439) [-498.058] (-510.276) -- 0:00:45
Average standard deviation of split frequencies: 0.011700
550500 -- (-500.083) (-510.380) [-504.619] (-499.918) * (-497.352) (-500.088) (-501.330) [-499.357] -- 0:00:44
551000 -- (-498.036) (-501.088) (-494.063) [-497.512] * (-501.595) (-500.085) (-498.782) [-503.670] -- 0:00:44
551500 -- (-500.140) (-499.087) (-499.392) [-496.461] * [-497.811] (-503.193) (-501.293) (-506.693) -- 0:00:44
552000 -- (-504.590) (-499.935) [-501.496] (-503.055) * (-502.513) [-501.091] (-508.627) (-503.154) -- 0:00:44
552500 -- (-498.309) (-505.069) [-500.886] (-496.228) * (-498.857) (-505.831) (-498.283) [-503.395] -- 0:00:44
553000 -- [-506.637] (-506.012) (-502.472) (-500.931) * (-504.645) [-502.035] (-502.129) (-501.103) -- 0:00:44
553500 -- (-501.882) (-497.192) [-505.239] (-503.332) * (-499.779) (-501.900) [-499.411] (-497.847) -- 0:00:44
554000 -- (-498.513) (-499.417) (-503.031) [-502.019] * (-498.032) (-499.593) [-501.096] (-501.351) -- 0:00:44
554500 -- [-504.286] (-496.880) (-500.095) (-507.241) * (-499.751) [-504.966] (-499.931) (-497.168) -- 0:00:44
555000 -- (-505.915) (-506.677) (-507.400) [-504.212] * (-502.840) (-498.122) [-501.277] (-496.523) -- 0:00:44
Average standard deviation of split frequencies: 0.011305
555500 -- (-506.137) (-498.233) (-499.848) [-496.386] * (-507.990) (-498.729) (-499.678) [-503.087] -- 0:00:44
556000 -- (-507.861) (-503.326) [-504.905] (-497.490) * (-497.230) [-502.019] (-500.067) (-496.512) -- 0:00:43
556500 -- (-508.683) (-505.110) (-501.932) [-499.626] * (-498.552) [-496.164] (-499.346) (-500.096) -- 0:00:43
557000 -- (-506.606) (-499.494) (-501.941) [-500.084] * (-500.822) [-505.696] (-498.944) (-502.034) -- 0:00:43
557500 -- [-495.369] (-508.256) (-508.360) (-503.300) * (-502.894) [-501.760] (-501.856) (-507.285) -- 0:00:44
558000 -- (-502.563) [-500.307] (-507.255) (-505.998) * (-508.982) [-502.308] (-505.368) (-497.703) -- 0:00:44
558500 -- (-499.741) [-502.704] (-505.919) (-499.662) * (-510.260) [-499.822] (-505.112) (-496.540) -- 0:00:44
559000 -- (-499.720) (-507.909) [-499.858] (-500.628) * (-498.569) (-496.696) [-505.066] (-499.823) -- 0:00:44
559500 -- (-498.085) (-504.170) (-502.166) [-500.914] * (-503.012) [-498.145] (-509.455) (-502.757) -- 0:00:44
560000 -- (-507.165) (-505.462) [-503.710] (-498.318) * (-502.139) (-503.098) [-504.895] (-499.284) -- 0:00:44
Average standard deviation of split frequencies: 0.012051
560500 -- (-506.336) (-507.672) (-502.135) [-509.524] * (-502.368) (-499.989) [-500.745] (-505.046) -- 0:00:43
561000 -- (-501.167) [-497.806] (-505.372) (-502.742) * (-498.706) (-496.892) (-505.611) [-496.464] -- 0:00:43
561500 -- (-506.901) (-501.584) (-501.733) [-497.621] * (-501.287) (-502.223) (-504.749) [-501.634] -- 0:00:43
562000 -- (-504.195) (-499.863) (-499.202) [-505.186] * (-500.087) [-497.865] (-503.662) (-503.218) -- 0:00:43
562500 -- (-501.779) [-497.699] (-504.940) (-504.876) * (-502.614) [-502.298] (-504.159) (-500.484) -- 0:00:43
563000 -- (-503.621) [-498.788] (-500.763) (-505.038) * (-499.887) [-503.500] (-500.246) (-508.914) -- 0:00:43
563500 -- (-505.200) (-503.334) [-500.952] (-500.455) * (-499.593) (-504.848) [-504.979] (-501.239) -- 0:00:43
564000 -- (-504.699) (-497.978) (-506.971) [-501.867] * (-499.993) (-499.816) [-504.767] (-498.310) -- 0:00:43
564500 -- (-500.304) (-497.961) [-496.864] (-503.912) * (-507.664) [-506.303] (-507.546) (-498.969) -- 0:00:43
565000 -- (-505.515) [-498.666] (-509.655) (-498.564) * (-520.309) (-503.269) (-511.565) [-501.664] -- 0:00:43
Average standard deviation of split frequencies: 0.012493
565500 -- [-500.896] (-503.253) (-505.986) (-501.406) * (-501.682) (-501.878) (-504.141) [-497.401] -- 0:00:43
566000 -- [-500.728] (-497.123) (-502.303) (-499.666) * (-507.098) (-511.415) (-499.694) [-497.228] -- 0:00:42
566500 -- [-504.130] (-498.760) (-506.636) (-510.752) * (-503.674) (-505.757) [-502.242] (-502.780) -- 0:00:42
567000 -- (-499.101) [-499.076] (-504.893) (-510.799) * (-504.365) (-508.129) (-498.692) [-498.111] -- 0:00:42
567500 -- (-507.861) [-499.263] (-500.576) (-503.578) * (-503.805) (-511.954) [-498.177] (-500.956) -- 0:00:43
568000 -- (-510.385) [-497.666] (-510.221) (-503.335) * (-509.254) (-503.893) [-503.921] (-510.448) -- 0:00:43
568500 -- (-500.332) (-504.042) (-495.562) [-503.140] * (-505.509) (-501.421) [-503.299] (-502.572) -- 0:00:43
569000 -- (-499.369) [-499.390] (-504.644) (-506.992) * [-501.785] (-504.180) (-502.760) (-499.295) -- 0:00:43
569500 -- [-511.520] (-503.064) (-502.854) (-507.249) * (-503.919) (-507.923) [-498.692] (-501.490) -- 0:00:43
570000 -- (-504.991) (-501.392) [-500.179] (-506.420) * (-500.598) (-507.184) (-502.571) [-500.516] -- 0:00:43
Average standard deviation of split frequencies: 0.014594
570500 -- (-510.418) [-501.854] (-503.083) (-504.936) * (-502.917) (-504.359) (-496.791) [-497.827] -- 0:00:42
571000 -- (-503.959) (-502.119) [-500.597] (-500.257) * (-502.756) (-503.853) [-500.910] (-499.805) -- 0:00:42
571500 -- (-511.761) (-507.016) [-500.962] (-501.803) * (-504.734) [-503.747] (-501.477) (-507.471) -- 0:00:42
572000 -- (-504.424) (-498.752) (-513.461) [-501.678] * [-498.291] (-502.413) (-503.652) (-504.722) -- 0:00:42
572500 -- (-500.714) (-498.210) [-501.697] (-505.975) * [-497.387] (-499.268) (-499.385) (-507.234) -- 0:00:42
573000 -- [-500.622] (-507.849) (-502.134) (-503.013) * [-494.403] (-507.933) (-502.688) (-500.036) -- 0:00:42
573500 -- (-503.758) [-505.370] (-505.460) (-506.081) * (-498.784) (-503.102) (-501.617) [-502.962] -- 0:00:42
574000 -- (-502.034) (-504.818) [-501.998] (-502.567) * (-505.334) [-509.915] (-506.853) (-502.866) -- 0:00:42
574500 -- [-496.394] (-503.290) (-497.774) (-498.256) * (-498.036) (-497.726) (-507.209) [-502.404] -- 0:00:42
575000 -- [-504.690] (-507.531) (-500.036) (-504.083) * (-506.599) (-503.310) [-494.318] (-504.960) -- 0:00:42
Average standard deviation of split frequencies: 0.015823
575500 -- (-501.346) (-505.019) (-499.860) [-506.429] * (-511.877) (-503.281) (-501.136) [-497.998] -- 0:00:42
576000 -- (-501.914) (-505.238) [-496.486] (-508.206) * [-506.346] (-504.169) (-497.342) (-502.452) -- 0:00:41
576500 -- [-502.172] (-510.726) (-503.103) (-504.794) * (-504.108) (-501.098) [-497.888] (-502.006) -- 0:00:41
577000 -- [-500.865] (-515.315) (-502.213) (-500.279) * (-506.295) [-498.256] (-501.426) (-500.211) -- 0:00:41
577500 -- (-502.471) [-501.349] (-505.392) (-503.331) * (-502.839) (-497.528) (-505.582) [-504.057] -- 0:00:41
578000 -- (-502.516) (-502.917) [-504.083] (-500.816) * (-506.540) (-500.254) (-503.991) [-499.505] -- 0:00:42
578500 -- (-508.978) (-499.372) [-502.128] (-506.737) * [-499.022] (-510.315) (-510.079) (-498.008) -- 0:00:42
579000 -- (-504.893) [-498.842] (-499.314) (-504.250) * [-502.710] (-500.120) (-495.276) (-506.638) -- 0:00:42
579500 -- [-500.468] (-498.198) (-500.358) (-502.564) * (-504.346) (-503.684) (-499.862) [-505.368] -- 0:00:42
580000 -- (-496.625) [-496.016] (-505.020) (-505.941) * [-497.087] (-504.542) (-497.393) (-501.633) -- 0:00:42
Average standard deviation of split frequencies: 0.016237
580500 -- (-503.788) [-500.285] (-501.327) (-506.326) * (-497.375) (-500.411) (-497.682) [-495.857] -- 0:00:41
581000 -- [-506.034] (-497.253) (-504.203) (-511.971) * (-498.930) (-501.715) (-501.692) [-498.103] -- 0:00:41
581500 -- [-499.394] (-502.055) (-504.585) (-507.885) * (-502.971) (-502.500) (-500.577) [-497.767] -- 0:00:41
582000 -- (-502.350) (-510.765) [-501.066] (-504.283) * (-497.631) (-503.147) [-498.872] (-498.989) -- 0:00:41
582500 -- (-500.580) (-499.358) (-501.891) [-510.450] * [-496.531] (-499.573) (-500.753) (-501.167) -- 0:00:41
583000 -- (-502.173) [-505.580] (-503.672) (-500.984) * (-500.827) (-503.551) [-499.640] (-498.618) -- 0:00:41
583500 -- [-503.376] (-498.474) (-498.904) (-500.066) * [-499.417] (-500.119) (-501.985) (-501.830) -- 0:00:41
584000 -- (-510.347) [-501.121] (-499.079) (-498.253) * [-497.976] (-505.607) (-504.075) (-498.032) -- 0:00:41
584500 -- (-506.559) [-498.745] (-502.678) (-498.395) * (-502.806) [-504.304] (-505.099) (-504.945) -- 0:00:41
585000 -- [-501.930] (-498.719) (-502.803) (-501.640) * [-495.002] (-498.389) (-501.758) (-502.065) -- 0:00:41
Average standard deviation of split frequencies: 0.013944
585500 -- (-503.123) [-506.638] (-501.799) (-505.399) * (-502.868) (-501.633) (-509.524) [-502.155] -- 0:00:41
586000 -- (-499.891) (-503.438) [-500.935] (-505.475) * (-499.659) [-500.549] (-500.940) (-506.945) -- 0:00:40
586500 -- (-501.558) (-503.567) (-505.719) [-510.761] * (-502.401) (-504.995) [-503.919] (-500.019) -- 0:00:40
587000 -- [-500.410] (-507.494) (-504.930) (-508.774) * (-503.784) (-498.802) (-503.224) [-498.337] -- 0:00:40
587500 -- (-499.336) [-499.046] (-499.083) (-499.890) * (-505.739) (-500.831) (-501.426) [-500.094] -- 0:00:40
588000 -- [-503.197] (-503.507) (-509.848) (-507.319) * (-507.645) (-502.086) (-502.193) [-501.081] -- 0:00:41
588500 -- (-500.370) (-503.241) (-499.478) [-498.032] * (-504.027) (-507.373) (-502.708) [-501.778] -- 0:00:41
589000 -- (-504.194) (-504.892) [-500.460] (-501.643) * (-503.869) (-502.641) (-501.693) [-499.208] -- 0:00:41
589500 -- (-501.400) (-510.666) (-499.644) [-502.456] * (-506.986) (-502.643) (-513.308) [-498.626] -- 0:00:41
590000 -- (-503.790) (-506.504) [-502.543] (-499.405) * (-505.318) (-506.375) (-500.232) [-502.220] -- 0:00:41
Average standard deviation of split frequencies: 0.013301
590500 -- [-497.375] (-505.372) (-501.337) (-500.474) * (-497.718) (-501.118) (-500.630) [-499.290] -- 0:00:40
591000 -- (-499.889) (-506.727) (-499.013) [-503.372] * (-502.725) [-500.770] (-499.095) (-499.009) -- 0:00:40
591500 -- (-499.875) [-500.974] (-502.650) (-502.847) * (-502.855) (-503.216) (-499.508) [-502.520] -- 0:00:40
592000 -- (-502.459) (-503.720) (-503.928) [-495.623] * (-500.514) [-503.231] (-509.078) (-499.981) -- 0:00:40
592500 -- (-502.986) (-500.650) (-505.520) [-498.967] * (-508.583) [-498.047] (-498.751) (-502.592) -- 0:00:40
593000 -- [-504.875] (-497.077) (-501.245) (-502.072) * (-501.437) (-499.740) [-499.097] (-506.886) -- 0:00:40
593500 -- (-503.824) [-500.148] (-503.551) (-499.860) * (-504.653) (-502.598) (-499.601) [-502.387] -- 0:00:40
594000 -- (-505.343) [-503.053] (-505.787) (-500.887) * (-496.966) (-507.917) [-497.805] (-501.951) -- 0:00:40
594500 -- [-502.345] (-500.627) (-502.595) (-504.774) * (-500.631) (-498.032) (-502.704) [-498.564] -- 0:00:40
595000 -- (-499.715) (-498.304) (-504.247) [-500.901] * (-510.131) (-499.290) (-502.680) [-497.079] -- 0:00:40
Average standard deviation of split frequencies: 0.012392
595500 -- (-504.011) (-505.062) [-502.485] (-500.143) * [-506.693] (-499.857) (-499.455) (-501.310) -- 0:00:40
596000 -- [-499.324] (-503.874) (-507.898) (-497.620) * (-503.719) (-505.367) (-501.481) [-501.709] -- 0:00:39
596500 -- (-504.274) (-508.379) (-507.058) [-500.521] * (-498.002) (-502.695) [-495.604] (-501.751) -- 0:00:39
597000 -- (-503.936) (-503.773) [-500.044] (-499.761) * (-501.902) [-502.479] (-517.941) (-502.113) -- 0:00:39
597500 -- (-507.101) (-504.611) (-504.963) [-497.783] * (-500.386) (-505.048) (-497.671) [-498.237] -- 0:00:39
598000 -- (-499.723) (-505.663) [-502.520] (-501.235) * [-508.712] (-504.125) (-514.053) (-498.412) -- 0:00:39
598500 -- (-502.323) [-502.165] (-508.126) (-500.425) * [-505.944] (-500.133) (-501.640) (-504.254) -- 0:00:40
599000 -- [-501.274] (-497.700) (-503.661) (-499.826) * (-502.690) (-502.536) [-498.888] (-496.784) -- 0:00:40
599500 -- (-500.669) [-499.266] (-507.023) (-504.190) * (-501.761) (-507.387) (-500.648) [-498.115] -- 0:00:40
600000 -- (-499.706) (-498.799) (-504.003) [-499.048] * (-500.878) (-506.428) (-511.263) [-496.669] -- 0:00:40
Average standard deviation of split frequencies: 0.013342
600500 -- (-499.992) [-498.143] (-502.440) (-507.193) * (-497.696) (-503.784) (-500.318) [-497.541] -- 0:00:39
601000 -- (-502.112) [-505.746] (-503.748) (-502.435) * (-501.522) (-498.382) [-500.487] (-498.909) -- 0:00:39
601500 -- (-501.371) (-503.588) [-498.454] (-502.188) * (-506.968) (-500.468) [-503.632] (-496.131) -- 0:00:39
602000 -- (-502.453) (-498.338) [-496.933] (-502.961) * (-499.391) [-498.951] (-511.425) (-502.777) -- 0:00:39
602500 -- [-498.723] (-501.255) (-499.177) (-505.540) * (-502.576) [-498.994] (-505.757) (-495.618) -- 0:00:39
603000 -- (-499.427) [-504.791] (-505.108) (-506.805) * (-503.694) [-499.407] (-508.788) (-497.064) -- 0:00:39
603500 -- (-499.498) [-502.658] (-500.329) (-513.369) * (-500.199) (-496.385) [-497.770] (-498.134) -- 0:00:39
604000 -- [-502.797] (-504.524) (-507.754) (-507.735) * (-500.189) (-498.317) (-498.800) [-500.082] -- 0:00:39
604500 -- [-500.644] (-504.178) (-499.132) (-498.219) * [-500.845] (-498.958) (-506.081) (-501.520) -- 0:00:39
605000 -- (-500.336) [-502.403] (-503.518) (-500.581) * (-504.004) (-499.992) (-502.227) [-501.711] -- 0:00:39
Average standard deviation of split frequencies: 0.013743
605500 -- (-506.005) [-500.205] (-503.490) (-499.479) * (-503.602) (-500.290) (-498.567) [-503.711] -- 0:00:39
606000 -- (-503.310) (-501.158) (-505.767) [-497.894] * (-503.928) (-497.546) (-500.894) [-499.387] -- 0:00:39
606500 -- (-502.959) [-502.430] (-501.380) (-498.585) * [-500.611] (-506.274) (-501.159) (-506.737) -- 0:00:38
607000 -- [-501.632] (-499.353) (-499.554) (-508.142) * (-502.226) [-499.102] (-500.597) (-501.529) -- 0:00:38
607500 -- (-501.968) (-506.249) (-500.838) [-504.359] * [-502.689] (-499.788) (-498.664) (-504.644) -- 0:00:38
608000 -- (-505.246) [-498.399] (-497.051) (-505.583) * (-503.260) (-496.496) [-496.434] (-505.463) -- 0:00:38
608500 -- (-505.739) (-502.514) (-504.666) [-506.620] * (-502.391) [-498.317] (-502.221) (-499.783) -- 0:00:39
609000 -- (-501.011) (-500.910) [-497.973] (-503.664) * (-511.022) [-496.995] (-501.880) (-500.760) -- 0:00:39
609500 -- (-499.376) [-497.258] (-500.947) (-499.670) * (-502.736) (-501.938) [-501.962] (-505.633) -- 0:00:39
610000 -- [-501.646] (-498.516) (-503.542) (-505.842) * (-508.844) [-501.264] (-500.861) (-503.252) -- 0:00:39
Average standard deviation of split frequencies: 0.013638
610500 -- (-504.231) (-496.475) (-504.176) [-499.302] * (-498.082) [-501.322] (-500.517) (-500.997) -- 0:00:38
611000 -- [-499.535] (-497.162) (-514.223) (-503.479) * (-500.789) (-505.668) [-501.691] (-500.688) -- 0:00:38
611500 -- (-500.516) [-499.243] (-509.956) (-499.138) * [-499.614] (-499.159) (-504.471) (-504.613) -- 0:00:38
612000 -- (-498.969) [-498.833] (-505.523) (-496.125) * [-497.271] (-504.969) (-500.346) (-500.888) -- 0:00:38
612500 -- (-503.605) (-498.613) (-501.543) [-501.371] * (-500.407) (-508.150) [-499.477] (-498.684) -- 0:00:38
613000 -- (-501.775) (-502.279) (-502.214) [-497.187] * (-500.987) (-513.005) [-499.617] (-499.625) -- 0:00:38
613500 -- (-504.809) (-500.016) (-505.527) [-496.170] * (-498.134) (-511.311) (-503.292) [-496.891] -- 0:00:38
614000 -- (-504.055) [-501.380] (-505.570) (-501.094) * [-497.501] (-502.033) (-497.506) (-496.629) -- 0:00:38
614500 -- (-499.249) (-501.274) (-509.312) [-502.625] * (-500.288) [-502.893] (-496.228) (-500.037) -- 0:00:38
615000 -- (-502.023) [-500.338] (-497.816) (-503.246) * (-499.542) (-501.770) [-500.016] (-498.688) -- 0:00:38
Average standard deviation of split frequencies: 0.013520
615500 -- (-501.645) (-499.233) (-500.683) [-499.726] * (-501.898) [-505.446] (-497.030) (-500.427) -- 0:00:38
616000 -- [-502.485] (-497.244) (-503.280) (-504.673) * (-500.582) (-500.522) [-499.681] (-508.777) -- 0:00:38
616500 -- (-499.996) [-502.455] (-504.241) (-503.995) * (-500.575) [-498.922] (-502.419) (-502.429) -- 0:00:37
617000 -- [-499.527] (-500.147) (-504.526) (-508.327) * (-497.040) (-503.361) (-500.142) [-500.243] -- 0:00:37
617500 -- (-499.084) [-503.395] (-499.688) (-499.037) * [-499.678] (-501.243) (-498.481) (-503.370) -- 0:00:37
618000 -- [-499.640] (-504.050) (-501.398) (-498.811) * (-499.094) (-503.573) [-498.038] (-504.424) -- 0:00:37
618500 -- (-500.047) (-500.087) (-499.769) [-495.989] * (-502.693) (-500.816) (-506.127) [-506.494] -- 0:00:37
619000 -- [-500.052] (-507.505) (-505.271) (-507.774) * (-500.952) (-501.295) (-502.422) [-503.922] -- 0:00:38
619500 -- (-501.851) [-501.366] (-499.428) (-501.734) * (-501.698) (-500.680) (-502.004) [-497.308] -- 0:00:38
620000 -- (-499.105) (-499.567) [-499.024] (-502.230) * [-504.582] (-501.235) (-498.635) (-504.018) -- 0:00:38
Average standard deviation of split frequencies: 0.013671
620500 -- (-498.178) [-501.793] (-499.722) (-506.420) * (-511.057) [-501.316] (-502.217) (-503.109) -- 0:00:37
621000 -- (-501.890) (-507.915) [-505.925] (-503.860) * (-505.694) [-500.314] (-499.566) (-507.147) -- 0:00:37
621500 -- (-501.771) [-501.636] (-501.245) (-501.648) * (-498.948) [-497.529] (-498.252) (-502.114) -- 0:00:37
622000 -- (-500.768) (-499.823) (-505.072) [-499.205] * (-501.105) (-497.685) (-498.078) [-500.340] -- 0:00:37
622500 -- (-502.325) (-500.512) (-500.314) [-505.235] * [-502.794] (-496.788) (-500.018) (-502.838) -- 0:00:37
623000 -- [-501.048] (-511.751) (-499.814) (-499.694) * (-501.302) [-499.065] (-500.030) (-505.626) -- 0:00:37
623500 -- [-496.094] (-507.668) (-499.834) (-502.818) * (-508.179) [-499.566] (-501.745) (-501.821) -- 0:00:37
624000 -- (-499.665) (-497.772) [-500.852] (-500.811) * (-498.679) (-508.836) [-503.593] (-503.146) -- 0:00:37
624500 -- [-499.211] (-504.872) (-506.820) (-497.416) * (-504.175) (-499.129) [-504.618] (-502.486) -- 0:00:37
625000 -- (-508.735) [-497.115] (-501.217) (-497.796) * (-504.350) (-504.220) [-504.903] (-504.165) -- 0:00:37
Average standard deviation of split frequencies: 0.014057
625500 -- [-503.916] (-499.222) (-502.131) (-498.290) * (-505.335) [-498.651] (-500.254) (-510.332) -- 0:00:37
626000 -- (-502.149) (-507.751) (-502.593) [-498.372] * (-504.588) (-502.020) [-499.677] (-503.121) -- 0:00:37
626500 -- [-501.761] (-502.713) (-504.740) (-503.882) * [-501.976] (-497.403) (-501.444) (-502.829) -- 0:00:36
627000 -- [-504.788] (-501.534) (-499.406) (-507.246) * (-498.386) (-503.375) (-499.714) [-500.375] -- 0:00:36
627500 -- (-499.295) [-504.521] (-499.941) (-500.884) * (-502.492) (-499.130) [-502.428] (-506.191) -- 0:00:36
628000 -- (-504.197) [-497.231] (-502.160) (-496.349) * (-502.153) (-500.255) [-499.659] (-507.961) -- 0:00:36
628500 -- (-506.408) (-500.989) (-506.655) [-504.536] * (-500.425) (-499.515) [-501.303] (-505.005) -- 0:00:36
629000 -- (-501.052) (-510.656) [-505.068] (-498.016) * (-498.172) (-501.462) (-501.261) [-509.160] -- 0:00:37
629500 -- (-500.773) (-513.709) (-502.414) [-497.517] * (-501.538) [-503.850] (-504.340) (-504.344) -- 0:00:37
630000 -- (-501.598) (-511.657) [-503.775] (-502.513) * (-502.159) (-506.005) (-497.670) [-503.761] -- 0:00:37
Average standard deviation of split frequencies: 0.012707
630500 -- [-496.321] (-499.490) (-500.203) (-503.908) * (-495.375) [-504.145] (-497.437) (-500.610) -- 0:00:36
631000 -- (-498.735) (-504.516) [-503.255] (-503.799) * (-496.689) (-500.712) (-502.063) [-494.985] -- 0:00:36
631500 -- (-496.276) (-499.523) [-499.762] (-505.378) * (-497.761) (-504.016) [-496.395] (-504.201) -- 0:00:36
632000 -- (-501.470) [-500.706] (-498.547) (-497.651) * (-505.607) (-498.752) [-497.876] (-506.111) -- 0:00:36
632500 -- [-502.329] (-502.072) (-502.762) (-499.763) * (-499.376) [-502.260] (-499.721) (-498.207) -- 0:00:36
633000 -- (-500.525) (-500.809) (-501.743) [-502.180] * (-501.805) (-506.521) (-502.797) [-501.147] -- 0:00:36
633500 -- (-497.690) (-506.393) (-502.333) [-496.752] * [-505.758] (-504.644) (-501.636) (-498.042) -- 0:00:36
634000 -- (-499.242) (-504.482) (-503.062) [-500.152] * [-498.896] (-499.643) (-499.763) (-509.550) -- 0:00:36
634500 -- (-505.657) (-500.446) (-500.273) [-498.805] * [-503.232] (-500.932) (-498.621) (-505.366) -- 0:00:36
635000 -- (-500.955) (-501.601) (-499.065) [-498.003] * (-501.213) (-505.328) (-500.459) [-499.353] -- 0:00:36
Average standard deviation of split frequencies: 0.013836
635500 -- (-501.869) [-501.616] (-506.184) (-502.135) * (-503.772) (-499.062) [-502.986] (-498.462) -- 0:00:36
636000 -- (-500.000) (-507.631) [-502.549] (-511.224) * (-500.930) [-501.810] (-514.372) (-505.258) -- 0:00:36
636500 -- (-503.828) [-502.462] (-501.990) (-498.425) * (-498.157) (-500.443) (-507.084) [-500.352] -- 0:00:35
637000 -- (-505.515) [-506.599] (-507.301) (-508.361) * [-498.935] (-499.059) (-499.998) (-498.685) -- 0:00:35
637500 -- (-497.411) (-504.096) (-504.071) [-501.757] * (-504.704) [-500.628] (-503.837) (-499.631) -- 0:00:35
638000 -- (-505.173) (-504.449) (-509.714) [-501.470] * (-505.679) (-502.373) (-502.591) [-505.703] -- 0:00:35
638500 -- (-497.631) (-505.780) (-499.459) [-500.280] * [-506.381] (-501.572) (-497.320) (-502.340) -- 0:00:35
639000 -- (-501.539) (-505.692) [-500.510] (-499.022) * (-509.437) (-506.762) [-504.053] (-505.126) -- 0:00:35
639500 -- (-496.602) (-502.734) (-507.000) [-502.330] * [-501.523] (-500.288) (-501.400) (-507.706) -- 0:00:36
640000 -- [-500.126] (-499.508) (-506.230) (-503.778) * [-501.854] (-506.949) (-499.252) (-505.084) -- 0:00:36
Average standard deviation of split frequencies: 0.012999
640500 -- (-501.501) (-502.558) [-499.439] (-501.338) * (-508.227) (-510.521) (-504.012) [-501.691] -- 0:00:35
641000 -- [-498.885] (-503.167) (-500.463) (-499.596) * (-504.661) (-510.067) (-504.505) [-496.274] -- 0:00:35
641500 -- (-504.818) [-501.644] (-497.660) (-497.709) * (-499.410) (-505.911) [-499.395] (-498.682) -- 0:00:35
642000 -- (-505.152) (-503.186) [-499.098] (-501.169) * (-499.281) (-510.422) [-498.989] (-502.373) -- 0:00:35
642500 -- (-504.605) [-502.222] (-497.370) (-504.371) * (-500.375) (-509.534) (-501.479) [-496.557] -- 0:00:35
643000 -- (-500.722) (-499.290) (-502.057) [-497.131] * (-501.386) [-502.124] (-502.602) (-501.169) -- 0:00:35
643500 -- [-498.541] (-510.135) (-500.009) (-497.506) * (-503.688) (-507.133) [-500.312] (-503.597) -- 0:00:35
644000 -- (-502.250) [-502.764] (-507.576) (-496.800) * (-503.204) (-508.909) (-501.329) [-498.228] -- 0:00:35
644500 -- [-498.620] (-503.013) (-506.865) (-501.931) * (-505.893) (-500.402) [-500.881] (-500.270) -- 0:00:35
645000 -- (-506.572) [-499.923] (-500.395) (-499.150) * (-503.817) (-510.423) (-499.365) [-504.871] -- 0:00:35
Average standard deviation of split frequencies: 0.013865
645500 -- (-507.977) (-505.282) [-499.654] (-499.546) * (-498.263) [-503.460] (-499.693) (-502.439) -- 0:00:35
646000 -- (-502.300) (-500.051) [-498.105] (-501.923) * (-500.480) (-505.234) [-498.588] (-499.549) -- 0:00:35
646500 -- (-501.083) (-498.972) (-498.166) [-502.061] * (-496.845) (-507.171) [-497.322] (-498.296) -- 0:00:34
647000 -- (-502.803) [-503.762] (-499.170) (-502.328) * (-503.319) (-504.940) [-501.695] (-496.699) -- 0:00:34
647500 -- (-499.809) [-500.808] (-501.732) (-495.709) * [-498.357] (-500.032) (-499.901) (-500.121) -- 0:00:34
648000 -- [-498.518] (-500.554) (-505.250) (-496.414) * (-500.459) (-506.769) (-501.223) [-500.777] -- 0:00:34
648500 -- (-503.670) [-504.512] (-502.133) (-504.475) * (-507.951) [-504.086] (-501.423) (-509.528) -- 0:00:34
649000 -- (-501.497) (-505.155) [-498.083] (-507.613) * (-501.928) (-501.571) (-506.230) [-498.694] -- 0:00:34
649500 -- (-502.194) (-511.442) (-501.332) [-498.181] * (-499.897) [-502.962] (-503.256) (-502.238) -- 0:00:35
650000 -- (-502.000) (-502.748) (-502.169) [-498.127] * (-506.163) [-500.881] (-510.777) (-503.310) -- 0:00:35
Average standard deviation of split frequencies: 0.013041
650500 -- (-496.298) [-504.704] (-499.300) (-500.372) * [-500.045] (-505.747) (-506.128) (-500.075) -- 0:00:34
651000 -- [-498.937] (-506.464) (-513.521) (-501.773) * [-500.449] (-497.248) (-505.368) (-503.492) -- 0:00:34
651500 -- (-501.170) [-498.664] (-503.165) (-500.854) * (-504.397) [-501.464] (-512.417) (-504.199) -- 0:00:34
652000 -- [-500.140] (-497.885) (-502.010) (-511.027) * (-501.179) (-499.506) [-508.295] (-500.517) -- 0:00:34
652500 -- (-501.649) [-499.605] (-505.338) (-502.740) * [-503.085] (-498.397) (-506.030) (-503.795) -- 0:00:34
653000 -- (-497.682) (-499.789) [-504.736] (-502.409) * (-506.232) (-499.974) (-504.674) [-505.224] -- 0:00:34
653500 -- (-504.099) (-499.410) (-504.114) [-506.946] * [-501.348] (-503.995) (-507.029) (-503.203) -- 0:00:34
654000 -- [-500.902] (-499.449) (-502.728) (-501.580) * [-500.944] (-499.024) (-503.996) (-505.922) -- 0:00:34
654500 -- (-506.768) (-498.338) [-503.170] (-501.937) * (-504.145) [-499.924] (-503.388) (-501.849) -- 0:00:34
655000 -- (-500.830) (-503.987) (-498.979) [-503.321] * (-502.856) (-504.353) (-506.353) [-500.082] -- 0:00:34
Average standard deviation of split frequencies: 0.012935
655500 -- (-504.219) (-505.284) (-502.996) [-502.301] * (-503.670) (-496.549) (-505.826) [-499.275] -- 0:00:34
656000 -- (-503.605) [-505.569] (-503.537) (-500.418) * (-501.652) (-498.705) (-498.123) [-500.122] -- 0:00:34
656500 -- (-503.448) (-508.137) (-498.294) [-500.609] * [-504.024] (-494.982) (-499.977) (-501.992) -- 0:00:34
657000 -- (-502.333) [-501.339] (-497.295) (-500.837) * (-504.168) (-501.453) [-498.501] (-504.787) -- 0:00:33
657500 -- (-507.474) (-507.555) [-496.299] (-500.172) * (-503.691) (-495.035) [-502.762] (-501.853) -- 0:00:33
658000 -- (-504.018) (-505.575) (-502.097) [-503.894] * (-503.812) (-502.387) (-505.470) [-503.727] -- 0:00:33
658500 -- (-503.249) [-507.585] (-507.267) (-500.284) * (-500.754) (-503.795) [-499.356] (-502.997) -- 0:00:33
659000 -- [-501.929] (-514.470) (-502.060) (-499.694) * (-501.337) (-502.146) (-498.734) [-506.884] -- 0:00:33
659500 -- [-510.074] (-509.505) (-503.108) (-501.381) * (-501.240) [-497.275] (-498.117) (-500.274) -- 0:00:33
660000 -- [-500.981] (-500.717) (-501.209) (-498.208) * (-503.105) (-504.522) (-498.406) [-498.154] -- 0:00:34
Average standard deviation of split frequencies: 0.012368
660500 -- (-502.349) [-504.900] (-502.199) (-499.653) * (-500.231) (-502.871) (-498.549) [-497.284] -- 0:00:33
661000 -- (-506.966) (-506.598) [-496.568] (-501.591) * (-503.863) (-498.659) (-505.696) [-496.964] -- 0:00:33
661500 -- (-511.417) (-507.416) (-500.522) [-500.992] * (-502.091) [-501.071] (-499.365) (-502.115) -- 0:00:33
662000 -- (-502.485) (-507.581) (-502.251) [-499.163] * (-505.454) [-506.370] (-498.370) (-502.843) -- 0:00:33
662500 -- (-502.166) (-508.285) (-500.060) [-499.842] * (-499.066) [-497.236] (-497.661) (-509.910) -- 0:00:33
663000 -- (-510.437) (-504.900) [-499.901] (-504.477) * (-502.098) (-505.303) (-496.873) [-506.394] -- 0:00:33
663500 -- (-507.343) [-503.820] (-504.963) (-502.477) * (-503.227) [-500.119] (-500.243) (-498.003) -- 0:00:33
664000 -- (-505.110) (-506.893) (-509.160) [-502.848] * [-500.472] (-514.057) (-498.155) (-498.291) -- 0:00:33
664500 -- (-502.370) (-511.915) [-499.086] (-500.745) * (-504.186) (-503.156) [-502.263] (-499.019) -- 0:00:33
665000 -- (-503.450) [-508.896] (-499.980) (-503.898) * (-508.109) [-500.162] (-503.603) (-500.377) -- 0:00:33
Average standard deviation of split frequencies: 0.012269
665500 -- (-508.140) (-514.771) (-499.837) [-505.156] * [-505.876] (-499.087) (-506.040) (-500.698) -- 0:00:33
666000 -- [-505.855] (-517.309) (-503.772) (-508.442) * (-510.728) (-500.389) (-498.516) [-499.860] -- 0:00:33
666500 -- [-501.535] (-508.938) (-505.689) (-499.703) * (-506.909) (-503.749) [-498.750] (-497.941) -- 0:00:33
667000 -- (-497.227) (-510.122) (-512.742) [-503.343] * (-509.303) (-495.108) (-499.115) [-501.302] -- 0:00:32
667500 -- (-499.975) [-503.873] (-512.569) (-506.457) * (-504.971) [-496.126] (-506.600) (-502.877) -- 0:00:32
668000 -- (-504.449) (-507.739) (-502.770) [-497.530] * (-509.139) [-494.342] (-501.745) (-500.449) -- 0:00:32
668500 -- (-515.427) [-502.666] (-504.374) (-502.791) * (-503.965) [-498.859] (-502.303) (-501.269) -- 0:00:32
669000 -- [-505.396] (-499.120) (-503.121) (-500.637) * (-506.297) [-500.810] (-496.862) (-507.406) -- 0:00:32
669500 -- (-505.829) (-505.912) (-501.671) [-502.255] * (-504.402) (-498.366) (-499.552) [-499.439] -- 0:00:32
670000 -- (-502.804) [-506.161] (-508.106) (-501.565) * (-506.552) (-500.660) [-498.568] (-497.088) -- 0:00:33
Average standard deviation of split frequencies: 0.011949
670500 -- [-501.429] (-500.260) (-506.270) (-496.554) * (-510.350) (-501.454) (-495.884) [-499.638] -- 0:00:32
671000 -- (-503.073) (-501.860) (-512.738) [-499.167] * [-502.260] (-504.540) (-499.951) (-504.704) -- 0:00:32
671500 -- (-505.288) (-500.327) (-519.059) [-500.724] * (-505.093) (-498.375) (-500.436) [-495.343] -- 0:00:32
672000 -- [-503.064] (-511.282) (-508.206) (-496.851) * [-503.582] (-505.471) (-496.625) (-499.341) -- 0:00:32
672500 -- [-500.872] (-504.381) (-501.933) (-500.198) * (-503.605) (-503.325) [-497.683] (-508.245) -- 0:00:32
673000 -- (-500.897) (-500.813) (-499.692) [-501.399] * (-503.764) [-499.998] (-503.070) (-498.810) -- 0:00:32
673500 -- (-501.476) [-496.850] (-509.714) (-499.293) * (-504.930) [-496.544] (-502.771) (-500.851) -- 0:00:32
674000 -- (-499.902) (-504.749) (-499.989) [-497.262] * [-507.685] (-501.183) (-511.522) (-498.902) -- 0:00:32
674500 -- (-507.967) (-499.646) [-498.900] (-499.826) * [-499.568] (-501.288) (-499.179) (-507.027) -- 0:00:32
675000 -- (-503.304) [-504.649] (-501.928) (-497.876) * (-511.839) (-496.356) (-505.476) [-500.267] -- 0:00:32
Average standard deviation of split frequencies: 0.011158
675500 -- (-502.112) (-497.368) [-499.310] (-500.180) * (-498.972) (-504.892) [-506.924] (-505.915) -- 0:00:32
676000 -- (-501.052) (-501.802) (-497.891) [-500.588] * [-505.126] (-502.845) (-503.080) (-502.431) -- 0:00:32
676500 -- (-505.410) (-505.279) [-498.880] (-507.810) * (-502.545) [-498.580] (-509.892) (-504.269) -- 0:00:32
677000 -- [-496.404] (-506.119) (-500.785) (-501.827) * (-499.376) [-495.925] (-509.101) (-505.160) -- 0:00:31
677500 -- (-503.522) [-500.274] (-501.241) (-503.332) * (-500.272) (-502.418) [-504.780] (-501.724) -- 0:00:31
678000 -- (-505.226) [-500.238] (-497.155) (-499.435) * (-501.920) [-501.484] (-500.706) (-513.321) -- 0:00:31
678500 -- [-506.913] (-501.342) (-499.934) (-498.186) * (-500.683) (-504.942) (-504.985) [-502.140] -- 0:00:31
679000 -- (-496.814) (-497.668) [-499.168] (-506.303) * (-509.384) [-503.606] (-507.678) (-496.856) -- 0:00:31
679500 -- (-500.840) (-503.219) [-497.923] (-499.438) * (-504.915) (-504.014) [-500.131] (-500.489) -- 0:00:31
680000 -- (-504.893) (-503.466) [-496.734] (-502.548) * (-497.580) (-503.187) (-506.599) [-499.152] -- 0:00:31
Average standard deviation of split frequencies: 0.011081
680500 -- (-497.767) [-498.653] (-500.869) (-499.717) * (-506.030) (-499.501) (-504.925) [-502.159] -- 0:00:31
681000 -- (-506.271) (-504.779) (-503.716) [-500.092] * [-494.680] (-499.720) (-501.012) (-498.429) -- 0:00:31
681500 -- (-500.971) (-498.772) (-499.901) [-496.896] * (-498.108) [-505.767] (-500.531) (-503.522) -- 0:00:31
682000 -- (-502.437) (-505.492) [-500.451] (-500.225) * (-499.783) (-501.855) (-507.510) [-502.547] -- 0:00:31
682500 -- (-503.473) [-505.092] (-501.806) (-498.031) * [-499.640] (-502.105) (-503.093) (-498.571) -- 0:00:31
683000 -- (-503.751) (-500.085) (-509.114) [-502.108] * (-503.381) (-502.979) [-500.260] (-499.580) -- 0:00:31
683500 -- [-499.902] (-500.878) (-501.159) (-501.026) * [-499.214] (-503.901) (-507.223) (-501.546) -- 0:00:31
684000 -- [-500.678] (-504.152) (-497.882) (-498.476) * (-507.051) [-501.716] (-498.704) (-498.047) -- 0:00:31
684500 -- (-504.115) (-501.647) [-502.832] (-497.812) * [-501.035] (-498.472) (-500.618) (-503.643) -- 0:00:31
685000 -- (-500.303) (-505.518) (-505.041) [-499.046] * (-499.025) (-501.385) [-498.868] (-503.062) -- 0:00:31
Average standard deviation of split frequencies: 0.012369
685500 -- (-507.524) [-497.866] (-496.848) (-502.302) * (-502.001) [-498.562] (-504.823) (-504.173) -- 0:00:31
686000 -- (-504.150) (-497.327) (-502.650) [-508.929] * (-500.361) [-500.498] (-504.941) (-500.321) -- 0:00:31
686500 -- (-514.470) (-503.358) (-498.138) [-496.252] * (-502.335) (-501.947) (-502.532) [-500.453] -- 0:00:31
687000 -- (-506.297) (-504.604) [-509.012] (-496.116) * [-497.990] (-501.250) (-506.039) (-501.091) -- 0:00:30
687500 -- (-502.340) (-503.286) (-505.459) [-497.511] * (-499.209) (-501.658) (-502.696) [-495.301] -- 0:00:30
688000 -- [-498.453] (-504.022) (-501.075) (-497.401) * (-502.633) [-500.498] (-504.554) (-497.072) -- 0:00:30
688500 -- [-497.553] (-506.293) (-498.859) (-495.096) * (-500.238) (-503.342) (-506.794) [-501.146] -- 0:00:30
689000 -- (-501.331) [-505.498] (-499.366) (-503.414) * (-497.220) (-502.723) [-510.605] (-498.442) -- 0:00:30
689500 -- [-500.479] (-505.304) (-504.665) (-502.513) * (-508.229) (-496.817) (-499.035) [-499.510] -- 0:00:30
690000 -- (-500.490) (-506.399) [-497.479] (-497.922) * (-503.106) [-501.721] (-501.746) (-500.508) -- 0:00:30
Average standard deviation of split frequencies: 0.012286
690500 -- (-498.903) (-505.394) (-499.156) [-498.375] * (-502.431) (-501.673) [-501.125] (-499.981) -- 0:00:30
691000 -- (-504.061) [-501.278] (-496.342) (-501.806) * (-503.501) [-502.071] (-502.607) (-503.593) -- 0:00:30
691500 -- (-497.951) (-504.082) [-501.497] (-501.751) * (-499.870) [-498.447] (-498.827) (-510.488) -- 0:00:30
692000 -- [-498.991] (-504.925) (-498.881) (-501.927) * (-505.506) [-506.219] (-499.638) (-508.473) -- 0:00:30
692500 -- (-502.281) (-510.231) [-498.914] (-506.431) * (-505.823) (-500.092) [-501.632] (-507.610) -- 0:00:30
693000 -- (-501.599) (-513.684) [-496.883] (-501.797) * (-499.116) (-500.621) [-499.673] (-502.436) -- 0:00:30
693500 -- (-509.458) (-509.096) [-500.560] (-498.752) * (-497.319) (-499.663) (-501.264) [-503.621] -- 0:00:30
694000 -- (-506.721) (-502.699) [-501.732] (-498.117) * (-499.963) (-500.319) [-500.593] (-501.941) -- 0:00:30
694500 -- (-504.071) (-502.270) (-503.195) [-499.916] * [-500.565] (-500.354) (-504.498) (-502.215) -- 0:00:30
695000 -- (-509.046) [-500.948] (-504.065) (-497.026) * [-498.611] (-512.502) (-502.437) (-502.354) -- 0:00:30
Average standard deviation of split frequencies: 0.014449
695500 -- (-505.792) [-502.802] (-504.239) (-500.049) * (-500.269) (-502.448) [-503.475] (-502.249) -- 0:00:30
696000 -- (-502.173) (-501.817) [-500.547] (-504.819) * (-509.969) (-501.163) [-499.691] (-503.814) -- 0:00:30
696500 -- (-503.628) (-505.745) [-497.749] (-500.494) * (-502.892) [-505.139] (-508.434) (-504.081) -- 0:00:30
697000 -- (-511.178) (-498.330) (-509.124) [-501.595] * [-497.561] (-502.359) (-506.620) (-502.031) -- 0:00:29
697500 -- (-508.610) (-498.734) [-503.201] (-501.876) * (-500.409) (-504.471) [-504.195] (-508.233) -- 0:00:29
698000 -- (-509.993) (-499.345) (-507.455) [-497.997] * (-500.892) (-503.840) (-501.057) [-498.986] -- 0:00:29
698500 -- (-503.128) (-499.143) (-506.136) [-501.012] * (-503.890) (-502.131) (-501.793) [-498.563] -- 0:00:29
699000 -- (-505.762) (-501.300) (-505.300) [-498.405] * [-504.037] (-503.786) (-504.934) (-500.144) -- 0:00:29
699500 -- (-503.080) (-495.731) (-496.772) [-497.741] * (-497.177) (-505.893) (-501.687) [-496.463] -- 0:00:29
700000 -- [-501.045] (-502.784) (-498.564) (-505.015) * [-498.817] (-508.339) (-500.388) (-501.696) -- 0:00:29
Average standard deviation of split frequencies: 0.015699
700500 -- (-497.728) (-499.864) [-496.013] (-507.225) * (-506.761) [-498.382] (-502.120) (-499.484) -- 0:00:29
701000 -- (-499.819) (-496.442) [-501.363] (-497.375) * (-498.930) [-503.150] (-496.959) (-498.678) -- 0:00:29
701500 -- [-500.251] (-501.739) (-502.319) (-501.369) * (-496.506) (-501.601) [-500.053] (-503.317) -- 0:00:29
702000 -- (-497.093) (-502.794) (-500.699) [-508.374] * (-501.441) (-504.635) (-495.828) [-498.592] -- 0:00:29
702500 -- (-498.449) (-505.712) (-498.420) [-506.840] * (-499.043) [-506.689] (-499.263) (-505.070) -- 0:00:29
703000 -- (-503.531) [-499.009] (-503.291) (-504.336) * (-500.047) (-498.970) (-509.142) [-501.694] -- 0:00:29
703500 -- [-500.254] (-499.092) (-500.815) (-497.764) * (-503.098) [-497.423] (-501.010) (-499.631) -- 0:00:29
704000 -- (-498.694) (-501.198) (-497.553) [-498.036] * (-501.199) [-502.055] (-503.996) (-500.738) -- 0:00:29
704500 -- (-505.544) (-503.349) (-499.095) [-497.522] * (-507.246) (-504.868) (-498.756) [-499.662] -- 0:00:29
705000 -- (-504.816) (-499.182) [-497.461] (-503.846) * (-500.563) [-498.567] (-498.391) (-504.591) -- 0:00:29
Average standard deviation of split frequencies: 0.015357
705500 -- (-496.613) [-495.646] (-499.454) (-504.015) * (-499.262) [-498.667] (-511.453) (-503.986) -- 0:00:29
706000 -- (-502.548) [-499.773] (-496.083) (-494.683) * [-502.874] (-504.412) (-500.337) (-502.265) -- 0:00:29
706500 -- [-497.150] (-501.913) (-501.403) (-500.091) * (-504.102) (-499.462) (-502.160) [-506.003] -- 0:00:29
707000 -- [-498.332] (-496.945) (-501.083) (-500.965) * (-506.712) [-498.233] (-500.379) (-500.774) -- 0:00:29
707500 -- (-506.258) (-502.983) [-501.244] (-504.605) * (-506.565) [-498.879] (-503.642) (-499.753) -- 0:00:28
708000 -- (-499.358) (-498.131) [-499.663] (-503.066) * (-505.264) [-500.097] (-504.240) (-504.015) -- 0:00:28
708500 -- [-500.385] (-500.660) (-503.562) (-501.208) * (-496.588) (-508.592) [-503.899] (-499.206) -- 0:00:28
709000 -- [-498.887] (-501.432) (-504.827) (-503.252) * [-498.322] (-499.938) (-504.800) (-502.645) -- 0:00:28
709500 -- [-502.158] (-501.669) (-497.772) (-502.837) * (-506.689) (-506.374) [-502.605] (-503.401) -- 0:00:28
710000 -- (-503.032) [-501.202] (-501.219) (-500.181) * [-503.251] (-497.873) (-499.497) (-504.668) -- 0:00:28
Average standard deviation of split frequencies: 0.016804
710500 -- (-504.055) (-502.216) (-503.119) [-499.535] * (-501.011) [-501.744] (-500.808) (-501.275) -- 0:00:28
711000 -- (-500.031) (-502.728) (-500.012) [-501.641] * (-500.125) (-502.110) (-498.922) [-496.553] -- 0:00:28
711500 -- (-498.361) [-502.700] (-504.671) (-496.500) * (-501.531) (-500.353) (-502.257) [-503.587] -- 0:00:28
712000 -- (-499.533) [-498.896] (-508.198) (-501.718) * [-495.247] (-504.917) (-503.376) (-500.412) -- 0:00:28
712500 -- [-503.230] (-503.351) (-504.387) (-504.654) * (-501.187) (-501.891) [-497.441] (-502.426) -- 0:00:28
713000 -- (-501.563) (-501.567) [-501.022] (-499.138) * (-504.798) [-500.720] (-500.648) (-506.194) -- 0:00:28
713500 -- (-503.380) (-506.694) (-506.706) [-499.722] * (-498.045) (-500.799) [-500.214] (-508.910) -- 0:00:28
714000 -- (-502.670) [-501.575] (-500.598) (-498.877) * [-502.629] (-503.690) (-502.042) (-506.223) -- 0:00:28
714500 -- (-507.504) (-497.203) [-503.162] (-500.473) * [-498.726] (-499.068) (-508.064) (-503.020) -- 0:00:28
715000 -- (-502.018) (-502.161) (-498.092) [-503.124] * (-500.487) [-500.161] (-502.789) (-502.834) -- 0:00:28
Average standard deviation of split frequencies: 0.017338
715500 -- [-498.227] (-499.263) (-503.884) (-504.891) * (-502.209) [-499.562] (-499.609) (-500.491) -- 0:00:28
716000 -- (-499.308) (-503.913) (-507.129) [-499.149] * (-496.590) (-505.234) (-505.450) [-500.342] -- 0:00:28
716500 -- [-507.474] (-509.382) (-504.265) (-499.787) * (-498.484) (-501.952) (-497.102) [-502.534] -- 0:00:28
717000 -- (-507.367) (-500.473) (-499.067) [-507.541] * (-507.412) [-499.643] (-501.665) (-505.186) -- 0:00:28
717500 -- (-499.872) (-505.718) [-497.866] (-497.671) * (-502.749) (-498.094) (-498.982) [-501.060] -- 0:00:27
718000 -- (-503.661) (-504.115) (-499.823) [-499.889] * (-503.067) (-496.143) [-499.700] (-501.085) -- 0:00:27
718500 -- (-502.357) (-501.625) (-502.340) [-498.554] * (-501.502) (-497.305) (-499.973) [-495.930] -- 0:00:27
719000 -- (-505.855) (-498.924) (-505.415) [-498.914] * (-497.621) (-503.031) [-497.122] (-502.538) -- 0:00:27
719500 -- (-504.821) [-501.344] (-496.286) (-501.558) * [-499.047] (-499.968) (-506.076) (-502.346) -- 0:00:27
720000 -- (-508.502) [-496.877] (-496.417) (-505.886) * (-502.786) [-500.035] (-507.371) (-500.418) -- 0:00:27
Average standard deviation of split frequencies: 0.017007
720500 -- (-510.577) (-502.244) [-498.990] (-497.244) * (-495.395) (-503.471) (-506.855) [-501.108] -- 0:00:27
721000 -- (-509.907) (-502.315) (-495.586) [-498.162] * (-500.141) (-504.725) (-505.286) [-503.078] -- 0:00:27
721500 -- (-502.726) [-499.794] (-501.774) (-496.329) * (-499.471) (-502.410) [-499.059] (-504.890) -- 0:00:27
722000 -- (-500.262) (-500.683) (-502.232) [-499.726] * [-498.127] (-508.562) (-500.280) (-509.050) -- 0:00:27
722500 -- (-508.670) [-500.059] (-503.849) (-499.188) * (-503.795) (-503.559) (-500.399) [-501.231] -- 0:00:27
723000 -- (-506.744) (-500.588) (-502.107) [-500.812] * (-500.301) [-501.542] (-506.734) (-504.164) -- 0:00:27
723500 -- (-499.793) [-504.377] (-503.276) (-501.803) * (-500.143) (-502.347) [-497.850] (-509.615) -- 0:00:27
724000 -- (-502.960) (-501.112) [-499.406] (-501.540) * (-504.817) [-504.531] (-508.756) (-496.239) -- 0:00:27
724500 -- (-500.155) (-497.125) (-501.235) [-503.494] * [-504.835] (-511.609) (-505.481) (-497.455) -- 0:00:27
725000 -- [-500.140] (-500.086) (-506.828) (-503.048) * (-506.401) (-505.673) (-498.311) [-498.896] -- 0:00:27
Average standard deviation of split frequencies: 0.016882
725500 -- (-498.433) [-496.093] (-500.717) (-498.840) * (-502.790) (-503.038) (-500.796) [-499.664] -- 0:00:27
726000 -- (-501.170) (-504.589) (-497.652) [-501.133] * (-497.009) [-507.603] (-507.039) (-495.867) -- 0:00:27
726500 -- (-498.270) [-502.504] (-500.729) (-503.603) * (-503.260) (-510.678) (-504.417) [-496.525] -- 0:00:27
727000 -- (-501.770) (-507.142) [-500.518] (-500.354) * (-501.232) (-501.216) (-499.070) [-503.381] -- 0:00:27
727500 -- (-499.967) (-503.613) [-497.655] (-498.247) * (-500.652) [-504.345] (-499.481) (-501.013) -- 0:00:26
728000 -- (-498.867) (-501.469) [-495.652] (-501.150) * (-506.605) (-505.799) (-504.552) [-503.083] -- 0:00:26
728500 -- (-501.515) (-500.788) [-499.650] (-502.252) * (-502.109) (-499.339) (-500.588) [-495.678] -- 0:00:26
729000 -- (-499.430) (-507.472) [-500.888] (-507.569) * (-507.321) [-500.489] (-502.154) (-496.884) -- 0:00:26
729500 -- [-505.591] (-503.961) (-496.469) (-499.980) * (-502.452) [-499.694] (-503.958) (-504.360) -- 0:00:26
730000 -- (-502.155) (-503.421) [-498.478] (-499.486) * [-499.266] (-498.597) (-499.010) (-499.938) -- 0:00:26
Average standard deviation of split frequencies: 0.016989
730500 -- [-501.306] (-516.246) (-501.995) (-500.108) * (-507.145) [-498.988] (-503.961) (-502.308) -- 0:00:26
731000 -- [-500.601] (-506.753) (-500.240) (-497.916) * (-504.429) (-500.090) (-506.159) [-507.454] -- 0:00:26
731500 -- (-499.926) (-504.503) (-499.584) [-496.817] * [-500.485] (-501.218) (-500.149) (-507.658) -- 0:00:26
732000 -- (-514.612) (-496.918) (-497.618) [-500.939] * (-502.860) (-500.786) [-503.332] (-498.553) -- 0:00:26
732500 -- (-499.648) [-503.931] (-500.712) (-497.118) * [-499.143] (-498.437) (-505.699) (-501.455) -- 0:00:26
733000 -- (-500.268) (-502.011) [-499.936] (-501.818) * (-504.651) (-503.141) [-505.572] (-501.519) -- 0:00:26
733500 -- (-506.158) (-499.593) (-502.892) [-499.341] * [-503.831] (-506.353) (-509.863) (-504.809) -- 0:00:26
734000 -- (-504.831) (-513.876) [-508.125] (-502.612) * (-506.300) (-507.851) (-500.365) [-503.039] -- 0:00:26
734500 -- (-502.571) (-500.447) (-501.132) [-499.969] * (-503.527) [-500.393] (-502.761) (-494.104) -- 0:00:26
735000 -- [-506.871] (-505.351) (-504.768) (-498.064) * (-504.470) (-505.254) (-508.755) [-498.760] -- 0:00:26
Average standard deviation of split frequencies: 0.016226
735500 -- (-502.025) [-498.030] (-503.184) (-499.661) * [-503.609] (-498.827) (-508.253) (-499.253) -- 0:00:26
736000 -- (-504.355) [-501.088] (-506.819) (-499.552) * (-499.852) (-499.027) [-501.539] (-501.184) -- 0:00:26
736500 -- [-505.612] (-503.447) (-505.296) (-499.913) * (-504.928) (-502.744) [-502.751] (-501.781) -- 0:00:26
737000 -- (-500.149) [-501.013] (-501.041) (-501.567) * (-505.813) (-506.774) (-499.822) [-498.906] -- 0:00:26
737500 -- (-503.349) (-498.641) (-504.181) [-497.898] * [-500.508] (-503.896) (-500.501) (-505.519) -- 0:00:25
738000 -- (-502.055) (-501.457) [-498.581] (-497.979) * (-503.067) (-507.225) (-502.956) [-497.319] -- 0:00:25
738500 -- (-513.340) (-503.516) [-499.602] (-498.942) * [-499.877] (-507.213) (-504.707) (-502.155) -- 0:00:25
739000 -- (-502.933) (-502.155) [-500.458] (-502.473) * (-500.519) (-505.056) (-503.151) [-500.828] -- 0:00:25
739500 -- (-502.385) (-501.619) (-499.892) [-499.653] * (-497.434) [-501.802] (-503.394) (-503.046) -- 0:00:25
740000 -- (-497.681) (-508.484) (-501.249) [-496.520] * (-497.278) (-505.581) [-498.370] (-501.330) -- 0:00:25
Average standard deviation of split frequencies: 0.015275
740500 -- (-500.997) (-496.999) [-501.868] (-500.806) * (-501.907) (-502.319) [-499.175] (-502.243) -- 0:00:25
741000 -- (-504.242) (-497.961) (-498.968) [-496.750] * (-500.411) (-499.824) [-499.426] (-495.846) -- 0:00:25
741500 -- (-497.582) (-499.829) (-500.215) [-500.427] * (-497.927) (-501.254) [-502.297] (-502.890) -- 0:00:25
742000 -- (-504.393) [-499.252] (-500.828) (-496.153) * [-501.377] (-507.594) (-503.397) (-499.496) -- 0:00:25
742500 -- (-501.919) (-507.102) (-499.461) [-498.464] * (-504.006) [-501.891] (-500.706) (-498.719) -- 0:00:25
743000 -- (-502.900) (-499.597) (-500.455) [-497.052] * (-500.239) (-505.565) [-501.054] (-501.120) -- 0:00:25
743500 -- (-502.287) [-499.541] (-506.372) (-501.224) * (-498.793) (-510.696) (-502.873) [-498.879] -- 0:00:25
744000 -- (-503.425) (-503.417) (-505.497) [-504.080] * (-498.134) (-499.058) (-501.443) [-502.526] -- 0:00:25
744500 -- (-499.707) (-507.625) [-497.791] (-501.573) * (-506.425) (-499.670) [-501.042] (-505.315) -- 0:00:25
745000 -- (-501.437) (-501.017) (-500.912) [-501.364] * (-497.263) (-509.280) [-498.123] (-502.562) -- 0:00:25
Average standard deviation of split frequencies: 0.013691
745500 -- (-501.071) [-499.768] (-500.380) (-501.988) * (-501.014) (-500.232) (-504.657) [-505.577] -- 0:00:25
746000 -- [-496.080] (-504.956) (-498.490) (-499.961) * (-499.461) [-509.544] (-502.355) (-497.068) -- 0:00:25
746500 -- (-508.311) (-503.583) (-499.791) [-497.922] * (-499.431) (-503.655) [-506.831] (-505.671) -- 0:00:25
747000 -- (-499.705) (-501.890) [-500.526] (-500.322) * (-497.305) [-500.161] (-499.938) (-500.308) -- 0:00:25
747500 -- (-505.145) [-499.733] (-506.019) (-503.183) * [-498.439] (-503.371) (-501.154) (-503.449) -- 0:00:24
748000 -- (-508.288) [-496.878] (-501.687) (-499.192) * (-502.884) [-501.589] (-503.882) (-503.079) -- 0:00:24
748500 -- (-506.394) [-500.876] (-497.205) (-499.220) * [-499.579] (-501.000) (-499.141) (-503.228) -- 0:00:24
749000 -- [-500.519] (-505.907) (-497.313) (-501.628) * (-503.839) (-500.139) (-506.237) [-499.595] -- 0:00:24
749500 -- (-510.132) (-509.411) (-503.741) [-498.417] * (-504.219) (-504.141) (-500.389) [-500.169] -- 0:00:24
750000 -- [-498.847] (-505.143) (-498.907) (-496.319) * (-504.796) [-501.742] (-503.348) (-503.703) -- 0:00:24
Average standard deviation of split frequencies: 0.013606
750500 -- (-498.443) [-505.285] (-499.623) (-509.008) * (-505.479) (-501.309) (-497.677) [-496.043] -- 0:00:24
751000 -- [-499.962] (-517.172) (-500.799) (-506.354) * (-505.962) (-498.266) (-495.476) [-497.321] -- 0:00:24
751500 -- (-498.085) [-506.201] (-500.896) (-503.220) * (-500.640) [-505.056] (-505.021) (-501.277) -- 0:00:24
752000 -- (-504.465) (-511.282) (-505.784) [-503.230] * [-499.648] (-512.990) (-501.129) (-498.114) -- 0:00:24
752500 -- (-503.679) (-505.684) (-505.465) [-501.579] * [-499.831] (-498.265) (-502.260) (-498.671) -- 0:00:24
753000 -- [-501.288] (-506.397) (-505.923) (-502.316) * (-502.327) [-501.996] (-500.264) (-497.923) -- 0:00:24
753500 -- (-502.068) (-516.920) (-504.637) [-498.500] * (-496.707) (-507.978) (-498.110) [-495.781] -- 0:00:24
754000 -- [-502.971] (-513.541) (-503.576) (-502.477) * (-499.060) (-501.011) [-499.992] (-502.104) -- 0:00:24
754500 -- (-502.146) [-508.896] (-500.706) (-500.836) * (-502.854) [-496.097] (-508.232) (-502.144) -- 0:00:24
755000 -- (-499.901) (-507.432) (-498.384) [-499.464] * (-502.592) [-500.509] (-500.798) (-505.748) -- 0:00:24
Average standard deviation of split frequencies: 0.013302
755500 -- [-499.406] (-504.579) (-503.422) (-496.628) * (-502.809) [-499.351] (-502.528) (-502.252) -- 0:00:24
756000 -- (-499.934) [-501.119] (-502.020) (-496.541) * (-500.970) (-501.006) [-501.842] (-505.222) -- 0:00:24
756500 -- (-497.751) (-507.131) (-498.897) [-499.777] * (-501.093) [-498.291] (-509.078) (-498.324) -- 0:00:24
757000 -- (-497.393) (-505.545) (-506.637) [-495.436] * [-500.008] (-501.191) (-508.065) (-505.669) -- 0:00:24
757500 -- (-496.694) [-505.082] (-508.268) (-500.788) * [-502.531] (-500.067) (-511.183) (-508.581) -- 0:00:24
758000 -- (-498.013) (-500.906) (-503.670) [-496.793] * [-500.474] (-505.755) (-502.198) (-502.450) -- 0:00:23
758500 -- (-497.337) (-497.965) [-498.400] (-501.182) * (-509.042) [-504.110] (-502.330) (-500.049) -- 0:00:23
759000 -- [-503.598] (-501.216) (-499.740) (-501.927) * (-501.491) (-507.546) [-503.378] (-500.144) -- 0:00:23
759500 -- [-499.586] (-500.408) (-506.411) (-511.534) * (-498.643) [-494.561] (-505.187) (-500.447) -- 0:00:23
760000 -- (-499.819) [-505.372] (-504.069) (-500.556) * [-498.984] (-500.237) (-511.924) (-501.101) -- 0:00:23
Average standard deviation of split frequencies: 0.012808
760500 -- [-499.556] (-509.745) (-499.738) (-499.703) * (-503.365) (-502.973) (-506.009) [-496.880] -- 0:00:23
761000 -- (-508.447) (-501.774) [-506.736] (-497.994) * (-502.215) (-497.616) [-513.543] (-496.973) -- 0:00:23
761500 -- (-503.941) (-498.667) (-501.232) [-499.088] * [-502.753] (-504.899) (-505.931) (-504.815) -- 0:00:23
762000 -- (-501.447) (-497.648) (-503.313) [-500.384] * (-503.974) [-500.602] (-507.249) (-499.663) -- 0:00:23
762500 -- (-502.273) (-501.846) (-501.863) [-504.262] * (-504.865) (-496.686) (-510.564) [-499.437] -- 0:00:23
763000 -- (-502.989) (-500.454) [-500.853] (-505.036) * (-507.168) (-499.687) [-505.226] (-505.751) -- 0:00:23
763500 -- (-506.990) (-499.373) [-498.523] (-506.068) * (-500.880) (-500.342) [-505.633] (-503.565) -- 0:00:23
764000 -- (-498.932) (-500.769) (-502.656) [-499.884] * [-497.258] (-500.683) (-507.237) (-499.930) -- 0:00:23
764500 -- (-500.034) [-500.598] (-504.600) (-510.458) * (-500.352) [-498.552] (-503.534) (-502.233) -- 0:00:23
765000 -- [-501.124] (-507.102) (-502.643) (-507.837) * (-504.793) [-504.720] (-511.517) (-510.128) -- 0:00:23
Average standard deviation of split frequencies: 0.013334
765500 -- (-503.437) (-497.492) [-499.029] (-504.794) * [-502.218] (-498.737) (-499.474) (-505.046) -- 0:00:23
766000 -- (-505.389) (-500.334) (-498.948) [-506.699] * (-499.568) (-509.761) [-499.754] (-499.595) -- 0:00:23
766500 -- (-511.804) [-499.829] (-497.709) (-504.560) * (-501.159) (-503.881) (-499.163) [-499.048] -- 0:00:23
767000 -- [-504.857] (-503.967) (-504.570) (-503.653) * (-502.117) (-497.707) (-509.268) [-502.471] -- 0:00:23
767500 -- (-500.365) [-501.316] (-504.714) (-503.369) * [-501.351] (-501.939) (-507.382) (-509.436) -- 0:00:23
768000 -- (-505.630) (-500.928) [-497.577] (-502.930) * (-503.061) (-505.418) [-498.029] (-504.563) -- 0:00:22
768500 -- (-503.413) (-505.685) (-500.626) [-500.842] * (-498.892) (-507.966) [-500.759] (-506.171) -- 0:00:22
769000 -- (-498.384) (-498.343) (-498.602) [-498.218] * [-495.568] (-508.839) (-499.419) (-495.869) -- 0:00:22
769500 -- (-502.843) [-500.990] (-499.633) (-501.036) * (-497.955) (-503.339) [-503.699] (-501.509) -- 0:00:22
770000 -- (-499.838) [-499.993] (-500.110) (-499.956) * (-506.698) (-506.635) (-509.246) [-500.691] -- 0:00:22
Average standard deviation of split frequencies: 0.013049
770500 -- (-505.982) (-500.127) [-501.251] (-499.804) * (-498.418) (-504.293) [-498.574] (-503.413) -- 0:00:22
771000 -- (-503.591) (-496.810) (-504.846) [-501.663] * (-505.724) (-509.650) [-499.473] (-500.457) -- 0:00:22
771500 -- (-499.505) (-503.104) [-498.708] (-502.893) * [-499.242] (-501.249) (-496.754) (-497.297) -- 0:00:22
772000 -- [-500.272] (-500.103) (-504.249) (-495.628) * (-499.623) (-505.723) [-503.456] (-500.831) -- 0:00:22
772500 -- (-503.880) (-500.655) (-503.267) [-499.391] * (-501.900) (-504.303) [-503.579] (-501.839) -- 0:00:22
773000 -- [-501.592] (-505.147) (-501.164) (-504.937) * (-501.710) (-505.606) (-495.996) [-498.924] -- 0:00:22
773500 -- (-499.999) (-502.931) (-498.356) [-499.521] * (-504.208) (-500.489) [-499.494] (-502.011) -- 0:00:22
774000 -- (-505.359) (-505.790) [-496.551] (-510.378) * (-504.125) [-500.974] (-508.825) (-499.575) -- 0:00:22
774500 -- [-501.077] (-498.050) (-501.757) (-503.279) * (-499.722) (-506.187) [-498.004] (-501.277) -- 0:00:22
775000 -- (-499.128) [-503.373] (-500.876) (-505.566) * (-506.107) [-508.167] (-499.405) (-504.547) -- 0:00:22
Average standard deviation of split frequencies: 0.011745
775500 -- [-498.754] (-498.068) (-503.345) (-507.028) * [-502.483] (-503.243) (-501.801) (-506.471) -- 0:00:22
776000 -- (-497.204) [-499.733] (-514.823) (-505.769) * (-506.185) (-499.109) (-496.527) [-499.881] -- 0:00:22
776500 -- [-497.201] (-503.740) (-498.508) (-506.716) * (-502.982) [-499.921] (-498.659) (-501.035) -- 0:00:22
777000 -- (-501.563) (-500.382) [-500.865] (-500.958) * (-503.425) (-496.545) [-500.885] (-504.728) -- 0:00:22
777500 -- (-501.149) [-498.344] (-499.799) (-499.876) * (-507.630) (-506.108) [-502.924] (-503.359) -- 0:00:22
778000 -- [-501.809] (-500.769) (-499.038) (-498.480) * [-500.462] (-504.310) (-500.426) (-502.742) -- 0:00:21
778500 -- (-502.801) (-506.635) (-500.102) [-500.426] * (-502.647) (-497.356) (-500.879) [-500.171] -- 0:00:21
779000 -- (-498.049) (-499.839) (-503.119) [-503.344] * (-506.714) (-503.245) (-500.588) [-497.641] -- 0:00:21
779500 -- (-501.787) (-499.274) (-499.594) [-501.503] * (-509.291) (-506.316) [-499.492] (-496.441) -- 0:00:21
780000 -- (-501.699) (-497.762) [-499.964] (-497.050) * (-502.702) [-502.610] (-503.470) (-501.821) -- 0:00:21
Average standard deviation of split frequencies: 0.010265
780500 -- [-502.011] (-500.129) (-503.654) (-503.342) * (-503.073) (-502.288) [-501.699] (-501.191) -- 0:00:21
781000 -- (-504.014) (-507.935) [-499.050] (-498.701) * (-499.657) (-506.399) (-496.673) [-497.808] -- 0:00:21
781500 -- (-499.663) (-511.229) (-502.990) [-495.827] * [-501.139] (-500.737) (-503.248) (-498.205) -- 0:00:21
782000 -- (-500.647) (-504.929) [-503.890] (-497.641) * (-501.723) [-505.333] (-500.183) (-501.017) -- 0:00:21
782500 -- [-505.593] (-513.252) (-498.105) (-499.623) * (-499.399) [-501.695] (-499.867) (-499.251) -- 0:00:21
783000 -- (-504.450) (-504.180) (-504.039) [-500.497] * (-503.579) [-500.364] (-498.682) (-499.922) -- 0:00:21
783500 -- (-501.314) (-507.667) (-501.700) [-498.333] * (-505.482) (-509.324) (-499.499) [-510.271] -- 0:00:21
784000 -- (-503.219) (-500.129) [-502.742] (-504.439) * (-505.758) (-501.862) [-497.267] (-504.440) -- 0:00:21
784500 -- (-506.308) (-502.747) [-498.307] (-504.579) * (-495.245) (-502.874) [-502.950] (-498.930) -- 0:00:21
785000 -- (-502.292) (-506.469) [-500.878] (-504.526) * (-502.687) (-506.225) (-501.634) [-498.528] -- 0:00:21
Average standard deviation of split frequencies: 0.009196
785500 -- (-503.884) (-514.274) (-496.339) [-501.149] * (-502.808) [-499.442] (-505.642) (-506.107) -- 0:00:21
786000 -- (-501.498) (-504.726) [-501.075] (-505.308) * (-507.472) (-506.513) (-497.388) [-498.524] -- 0:00:21
786500 -- (-502.827) (-504.017) [-498.088] (-502.140) * (-503.912) (-500.679) [-502.781] (-500.472) -- 0:00:21
787000 -- (-504.273) (-507.999) [-497.329] (-499.676) * (-502.933) (-503.520) (-504.161) [-499.444] -- 0:00:21
787500 -- [-502.293] (-500.600) (-504.996) (-500.259) * [-500.761] (-503.260) (-497.624) (-496.656) -- 0:00:21
788000 -- [-497.431] (-505.757) (-502.410) (-504.173) * (-512.266) (-508.298) [-502.031] (-504.052) -- 0:00:20
788500 -- (-505.969) [-499.672] (-505.060) (-501.530) * (-500.045) (-502.806) [-504.431] (-498.207) -- 0:00:20
789000 -- (-500.517) (-500.697) (-505.224) [-500.321] * (-505.730) [-501.410] (-500.597) (-503.685) -- 0:00:20
789500 -- [-506.396] (-500.083) (-506.307) (-502.893) * (-505.684) [-495.102] (-498.160) (-505.238) -- 0:00:20
790000 -- (-505.588) (-503.760) (-503.646) [-502.577] * [-502.377] (-499.875) (-502.091) (-506.932) -- 0:00:20
Average standard deviation of split frequencies: 0.009539
790500 -- (-499.859) [-500.267] (-498.790) (-501.643) * (-499.504) (-509.510) [-503.217] (-503.162) -- 0:00:20
791000 -- [-502.278] (-505.115) (-500.947) (-498.990) * [-500.396] (-501.757) (-502.653) (-505.394) -- 0:00:20
791500 -- (-503.815) (-503.600) [-500.824] (-500.244) * (-499.760) (-500.713) (-499.650) [-502.400] -- 0:00:20
792000 -- (-501.215) (-504.946) [-504.215] (-498.579) * (-503.816) [-498.226] (-501.175) (-512.938) -- 0:00:20
792500 -- (-499.526) [-498.670] (-500.399) (-507.203) * [-503.958] (-503.200) (-510.320) (-508.711) -- 0:00:20
793000 -- (-508.563) (-498.931) [-497.123] (-502.722) * (-503.029) [-500.336] (-508.350) (-508.776) -- 0:00:20
793500 -- (-501.551) (-505.071) (-501.738) [-501.632] * (-503.065) [-506.324] (-511.209) (-498.821) -- 0:00:20
794000 -- (-505.645) (-498.069) [-502.935] (-498.943) * (-499.551) [-500.097] (-503.377) (-500.545) -- 0:00:20
794500 -- (-497.052) [-498.804] (-505.980) (-498.808) * (-502.103) [-500.258] (-508.782) (-502.151) -- 0:00:20
795000 -- (-498.627) (-503.132) (-506.459) [-497.663] * (-504.282) (-502.060) (-505.746) [-503.852] -- 0:00:20
Average standard deviation of split frequencies: 0.009081
795500 -- [-504.969] (-497.652) (-505.408) (-502.790) * (-499.992) [-497.388] (-505.318) (-500.010) -- 0:00:20
796000 -- (-506.094) [-500.363] (-498.756) (-502.531) * (-503.858) (-504.670) (-501.675) [-502.189] -- 0:00:20
796500 -- (-507.342) (-497.646) (-497.948) [-498.512] * (-498.223) [-509.727] (-504.795) (-501.581) -- 0:00:20
797000 -- (-501.700) [-498.047] (-505.595) (-506.217) * [-498.948] (-506.581) (-501.767) (-507.739) -- 0:00:20
797500 -- (-504.705) [-498.086] (-503.054) (-505.981) * [-498.511] (-499.995) (-513.000) (-500.006) -- 0:00:20
798000 -- (-502.113) [-498.101] (-502.424) (-501.275) * (-508.709) [-501.782] (-503.222) (-502.783) -- 0:00:19
798500 -- (-502.848) (-500.083) [-507.818] (-503.712) * [-502.758] (-497.531) (-505.159) (-500.701) -- 0:00:19
799000 -- [-499.915] (-499.750) (-497.468) (-504.426) * (-500.499) [-499.810] (-503.325) (-501.248) -- 0:00:19
799500 -- (-501.973) (-499.601) (-501.465) [-502.395] * (-507.886) [-499.693] (-499.471) (-505.343) -- 0:00:19
800000 -- [-497.936] (-500.180) (-502.389) (-500.668) * (-506.593) (-504.908) [-500.539] (-499.163) -- 0:00:19
Average standard deviation of split frequencies: 0.007654
800500 -- [-501.281] (-504.201) (-504.810) (-500.790) * (-511.868) [-503.424] (-499.154) (-500.813) -- 0:00:19
801000 -- (-502.614) (-505.134) [-502.862] (-505.382) * (-502.873) [-500.820] (-497.109) (-497.375) -- 0:00:19
801500 -- (-503.440) (-507.748) [-504.128] (-498.429) * (-506.105) (-505.969) [-498.712] (-502.277) -- 0:00:19
802000 -- (-503.573) [-498.625] (-501.120) (-506.237) * [-499.700] (-512.138) (-499.444) (-501.068) -- 0:00:19
802500 -- (-503.510) (-499.285) [-503.205] (-505.438) * (-500.573) (-504.591) [-503.583] (-504.840) -- 0:00:19
803000 -- (-501.204) (-502.279) (-506.090) [-504.819] * (-505.365) (-498.800) (-500.759) [-506.841] -- 0:00:19
803500 -- (-503.892) (-500.665) [-497.340] (-504.423) * [-498.923] (-498.502) (-498.218) (-503.841) -- 0:00:19
804000 -- (-506.057) [-502.107] (-499.798) (-500.457) * (-499.555) (-502.644) [-496.957] (-503.118) -- 0:00:19
804500 -- (-495.098) (-504.196) [-500.142] (-506.055) * (-508.832) (-501.216) (-502.086) [-503.402] -- 0:00:19
805000 -- (-500.282) [-499.097] (-498.610) (-504.938) * (-504.078) (-506.163) (-496.295) [-503.726] -- 0:00:19
Average standard deviation of split frequencies: 0.007213
805500 -- (-500.293) [-498.068] (-498.311) (-504.628) * (-502.931) [-501.468] (-502.214) (-509.648) -- 0:00:19
806000 -- (-501.101) (-505.798) [-497.735] (-508.384) * (-506.418) [-499.504] (-502.747) (-504.156) -- 0:00:19
806500 -- [-495.458] (-505.920) (-498.860) (-505.254) * (-503.308) [-500.466] (-498.726) (-508.661) -- 0:00:19
807000 -- [-501.651] (-500.715) (-500.329) (-504.665) * (-500.009) (-499.390) (-500.291) [-505.148] -- 0:00:19
807500 -- (-501.699) (-504.564) [-498.773] (-513.885) * (-502.266) [-500.734] (-497.918) (-508.058) -- 0:00:19
808000 -- (-502.610) (-502.866) [-497.339] (-511.004) * [-504.305] (-499.169) (-500.290) (-507.346) -- 0:00:19
808500 -- (-507.284) (-500.389) [-500.819] (-511.996) * (-501.724) (-504.774) [-495.497] (-504.808) -- 0:00:18
809000 -- (-503.354) [-498.883] (-505.910) (-514.837) * (-499.823) [-496.910] (-505.589) (-509.800) -- 0:00:18
809500 -- (-501.356) (-506.804) [-507.046] (-507.828) * (-497.867) (-498.960) (-502.012) [-504.345] -- 0:00:18
810000 -- [-497.301] (-503.857) (-508.659) (-510.191) * (-500.301) (-503.455) (-500.650) [-505.934] -- 0:00:18
Average standard deviation of split frequencies: 0.007560
810500 -- [-498.288] (-500.342) (-506.021) (-508.393) * [-495.417] (-502.915) (-509.714) (-504.851) -- 0:00:18
811000 -- [-499.845] (-501.873) (-504.771) (-515.218) * [-500.162] (-502.417) (-498.629) (-503.086) -- 0:00:18
811500 -- (-506.187) [-497.530] (-508.787) (-507.770) * (-503.046) (-504.112) (-495.993) [-499.252] -- 0:00:18
812000 -- (-504.907) (-500.499) [-500.993] (-504.506) * (-503.833) [-503.351] (-502.132) (-508.525) -- 0:00:18
812500 -- (-499.122) [-502.556] (-507.023) (-503.013) * (-507.063) (-504.159) (-502.645) [-504.975] -- 0:00:18
813000 -- (-504.732) [-499.414] (-504.081) (-505.051) * [-499.073] (-506.357) (-497.467) (-507.151) -- 0:00:18
813500 -- (-503.834) (-500.777) (-500.494) [-504.194] * (-495.436) (-503.339) [-497.804] (-499.776) -- 0:00:18
814000 -- (-496.472) [-503.156] (-503.986) (-505.348) * (-504.348) (-504.989) [-498.765] (-499.627) -- 0:00:18
814500 -- (-501.783) (-501.791) (-500.701) [-506.744] * (-499.708) [-502.145] (-499.493) (-500.303) -- 0:00:18
815000 -- [-497.822] (-499.005) (-504.128) (-499.622) * [-501.424] (-507.578) (-507.168) (-504.351) -- 0:00:18
Average standard deviation of split frequencies: 0.008280
815500 -- (-508.593) [-506.840] (-504.853) (-497.629) * (-501.192) (-504.353) (-504.994) [-499.779] -- 0:00:18
816000 -- (-502.660) (-511.436) (-507.249) [-497.813] * [-501.303] (-504.808) (-502.228) (-508.143) -- 0:00:18
816500 -- (-498.902) (-506.276) (-502.925) [-496.319] * (-497.015) [-498.760] (-499.370) (-506.734) -- 0:00:18
817000 -- (-501.587) (-500.018) [-502.562] (-504.499) * (-509.505) [-500.909] (-502.083) (-501.898) -- 0:00:18
817500 -- (-505.487) [-500.569] (-502.189) (-498.245) * [-503.715] (-499.209) (-502.059) (-501.048) -- 0:00:18
818000 -- (-501.951) [-502.058] (-505.244) (-503.652) * (-506.342) (-505.919) [-498.843] (-500.684) -- 0:00:18
818500 -- (-503.187) (-498.307) (-506.059) [-498.971] * (-506.883) [-504.997] (-500.918) (-503.272) -- 0:00:17
819000 -- (-506.709) (-500.034) [-500.885] (-502.409) * (-498.754) [-498.461] (-503.572) (-498.372) -- 0:00:17
819500 -- (-498.315) (-499.100) (-501.509) [-497.163] * [-502.555] (-495.747) (-497.250) (-504.522) -- 0:00:17
820000 -- (-499.237) [-505.679] (-498.668) (-499.959) * [-496.490] (-501.208) (-494.831) (-501.047) -- 0:00:17
Average standard deviation of split frequencies: 0.008233
820500 -- [-498.298] (-501.701) (-495.751) (-503.329) * (-500.391) (-503.866) [-497.346] (-499.455) -- 0:00:17
821000 -- (-504.907) (-502.777) [-495.767] (-504.651) * [-507.011] (-504.847) (-502.020) (-497.931) -- 0:00:17
821500 -- (-498.514) (-499.671) (-501.060) [-496.897] * [-497.335] (-500.088) (-504.194) (-504.319) -- 0:00:17
822000 -- (-506.388) (-500.512) [-500.373] (-501.078) * [-499.261] (-504.956) (-500.589) (-505.518) -- 0:00:17
822500 -- (-505.796) [-503.437] (-505.836) (-500.010) * (-499.681) [-501.704] (-501.804) (-499.353) -- 0:00:17
823000 -- (-499.775) [-499.872] (-498.450) (-506.938) * (-505.058) (-505.502) [-501.211] (-504.726) -- 0:00:17
823500 -- (-501.054) (-499.861) (-502.291) [-501.266] * (-507.926) (-498.443) [-499.257] (-502.185) -- 0:00:17
824000 -- (-502.658) [-506.775] (-502.585) (-501.450) * (-505.357) (-505.085) (-501.322) [-504.488] -- 0:00:17
824500 -- (-500.601) [-499.877] (-499.482) (-505.138) * (-502.980) (-504.642) [-500.247] (-502.627) -- 0:00:17
825000 -- [-499.758] (-500.343) (-497.051) (-505.970) * (-506.913) (-504.936) [-497.854] (-504.807) -- 0:00:17
Average standard deviation of split frequencies: 0.007800
825500 -- (-496.124) (-497.894) [-495.767] (-509.249) * (-501.837) (-503.962) (-502.061) [-504.258] -- 0:00:17
826000 -- (-504.229) [-498.740] (-499.391) (-505.455) * [-502.084] (-504.838) (-500.999) (-503.282) -- 0:00:17
826500 -- (-508.290) (-500.797) (-501.150) [-508.620] * (-505.399) [-501.218] (-499.159) (-506.529) -- 0:00:17
827000 -- (-506.379) (-498.194) [-501.283] (-500.100) * [-502.093] (-508.320) (-500.348) (-501.401) -- 0:00:17
827500 -- (-502.882) [-508.421] (-503.206) (-505.690) * (-504.649) (-501.624) [-497.430] (-500.217) -- 0:00:17
828000 -- (-510.117) (-502.393) [-497.453] (-503.777) * (-504.845) (-499.098) [-497.882] (-505.116) -- 0:00:17
828500 -- [-504.005] (-499.627) (-501.599) (-505.489) * (-501.748) [-504.205] (-499.573) (-503.663) -- 0:00:16
829000 -- (-512.224) [-499.542] (-498.335) (-502.522) * (-499.796) (-501.676) [-500.383] (-502.399) -- 0:00:16
829500 -- (-509.370) (-505.074) (-507.904) [-506.743] * [-498.393] (-503.311) (-499.588) (-512.351) -- 0:00:16
830000 -- (-504.992) (-502.811) (-497.095) [-497.406] * [-496.487] (-512.250) (-498.032) (-521.754) -- 0:00:16
Average standard deviation of split frequencies: 0.007756
830500 -- (-509.063) [-500.282] (-505.288) (-499.541) * (-498.777) (-508.863) [-500.764] (-507.854) -- 0:00:16
831000 -- (-510.720) (-498.284) (-504.134) [-496.255] * (-500.668) (-504.221) [-501.935] (-506.121) -- 0:00:16
831500 -- (-501.013) [-499.267] (-502.207) (-502.577) * [-500.129] (-502.378) (-497.680) (-505.554) -- 0:00:16
832000 -- (-499.449) [-501.881] (-503.075) (-497.039) * [-497.207] (-503.943) (-496.602) (-511.343) -- 0:00:16
832500 -- (-500.724) (-500.504) (-512.217) [-501.573] * (-498.782) (-505.750) [-497.257] (-500.215) -- 0:00:16
833000 -- (-504.291) [-499.529] (-505.650) (-497.277) * (-499.729) (-502.622) [-499.946] (-499.423) -- 0:00:16
833500 -- (-505.355) (-501.428) (-501.266) [-497.617] * (-498.630) (-505.312) [-499.308] (-512.015) -- 0:00:16
834000 -- (-504.643) (-501.300) [-500.400] (-504.870) * (-506.338) (-507.258) [-496.747] (-509.154) -- 0:00:16
834500 -- (-505.020) [-503.440] (-501.429) (-503.082) * (-509.143) (-505.010) (-499.870) [-502.031] -- 0:00:16
835000 -- (-510.641) (-501.029) [-499.176] (-506.263) * (-502.547) (-501.636) [-503.471] (-499.542) -- 0:00:16
Average standard deviation of split frequencies: 0.006767
835500 -- [-502.388] (-499.148) (-498.548) (-503.588) * (-499.971) [-501.287] (-504.255) (-502.382) -- 0:00:16
836000 -- (-508.334) [-498.085] (-503.280) (-512.601) * (-502.535) (-506.620) (-499.958) [-500.078] -- 0:00:16
836500 -- (-507.721) [-499.016] (-500.456) (-498.890) * (-499.057) (-497.999) (-502.355) [-498.499] -- 0:00:16
837000 -- (-501.321) (-496.652) [-498.143] (-499.194) * (-502.025) [-498.981] (-502.346) (-497.557) -- 0:00:16
837500 -- (-507.372) (-499.347) (-505.731) [-499.551] * (-503.763) (-500.248) [-496.496] (-499.863) -- 0:00:16
838000 -- (-508.773) (-504.114) [-503.919] (-504.265) * (-504.160) (-500.450) [-501.030] (-497.105) -- 0:00:16
838500 -- (-507.373) [-503.072] (-507.836) (-498.565) * (-498.614) (-501.988) (-500.897) [-495.416] -- 0:00:15
839000 -- (-510.440) (-498.355) (-503.252) [-502.059] * (-507.091) [-496.490] (-506.707) (-499.893) -- 0:00:15
839500 -- (-505.694) (-498.074) [-501.027] (-504.661) * [-497.622] (-507.616) (-500.199) (-501.718) -- 0:00:15
840000 -- (-508.980) (-500.086) (-503.254) [-498.778] * (-503.244) (-497.354) [-497.636] (-503.922) -- 0:00:15
Average standard deviation of split frequencies: 0.007851
840500 -- (-514.451) (-499.582) (-502.368) [-506.744] * [-495.862] (-497.762) (-496.867) (-508.199) -- 0:00:15
841000 -- (-500.562) (-504.102) (-500.533) [-495.578] * [-498.548] (-498.702) (-499.973) (-513.648) -- 0:00:15
841500 -- [-498.135] (-499.775) (-500.932) (-501.661) * (-497.644) (-498.861) [-495.490] (-507.764) -- 0:00:15
842000 -- (-504.265) [-499.805] (-510.312) (-505.008) * (-502.176) (-498.909) [-498.035] (-506.242) -- 0:00:15
842500 -- (-498.824) (-508.297) [-500.470] (-502.682) * (-499.022) (-501.165) (-505.186) [-503.351] -- 0:00:15
843000 -- (-501.680) [-499.799] (-502.695) (-496.621) * [-500.757] (-503.177) (-502.958) (-502.992) -- 0:00:15
843500 -- [-497.393] (-499.731) (-502.901) (-498.401) * (-499.822) [-502.601] (-499.382) (-507.140) -- 0:00:15
844000 -- (-500.417) (-497.327) (-501.170) [-501.685] * [-497.715] (-503.976) (-503.194) (-510.367) -- 0:00:15
844500 -- [-497.929] (-502.224) (-498.520) (-502.245) * (-497.082) [-506.483] (-504.170) (-508.580) -- 0:00:15
845000 -- (-503.455) (-502.512) (-506.651) [-500.766] * (-495.154) [-499.096] (-504.370) (-500.911) -- 0:00:15
Average standard deviation of split frequencies: 0.007987
845500 -- (-505.994) (-506.201) (-507.194) [-497.892] * (-498.388) [-500.712] (-504.964) (-511.428) -- 0:00:15
846000 -- [-501.094] (-504.702) (-508.926) (-502.379) * [-501.642] (-502.074) (-497.878) (-505.447) -- 0:00:15
846500 -- (-500.246) [-505.597] (-500.840) (-497.285) * (-504.601) [-502.981] (-500.439) (-498.442) -- 0:00:15
847000 -- (-498.804) (-502.636) (-505.521) [-499.052] * [-500.194] (-502.655) (-504.032) (-522.389) -- 0:00:15
847500 -- (-499.369) (-503.962) (-502.412) [-497.459] * (-500.785) (-510.703) [-508.977] (-497.278) -- 0:00:15
848000 -- [-497.788] (-505.444) (-499.719) (-500.410) * (-502.001) [-503.097] (-499.648) (-499.166) -- 0:00:15
848500 -- (-502.163) (-505.449) [-500.534] (-502.165) * [-502.908] (-503.452) (-507.344) (-505.522) -- 0:00:14
849000 -- (-498.803) [-501.060] (-502.233) (-508.211) * (-498.863) [-505.051] (-499.961) (-504.806) -- 0:00:14
849500 -- (-499.232) (-503.749) [-500.107] (-503.050) * [-498.353] (-503.788) (-507.320) (-502.226) -- 0:00:14
850000 -- (-502.860) (-510.875) (-500.002) [-501.753] * [-503.021] (-501.457) (-501.371) (-502.662) -- 0:00:14
Average standard deviation of split frequencies: 0.007204
850500 -- (-502.075) (-502.824) (-507.784) [-502.230] * (-501.781) (-503.933) [-503.833] (-504.197) -- 0:00:14
851000 -- (-503.916) (-507.313) [-500.413] (-501.280) * [-499.736] (-506.568) (-509.673) (-504.211) -- 0:00:14
851500 -- (-504.021) [-499.914] (-502.101) (-496.856) * (-501.329) [-503.068] (-500.921) (-503.107) -- 0:00:14
852000 -- (-502.261) [-506.418] (-502.018) (-497.657) * [-498.664] (-502.755) (-510.532) (-506.194) -- 0:00:14
852500 -- (-497.787) [-495.559] (-500.499) (-501.050) * (-501.855) (-502.012) (-507.785) [-502.094] -- 0:00:14
853000 -- (-501.416) [-499.992] (-505.141) (-510.719) * (-499.122) [-506.320] (-502.361) (-502.739) -- 0:00:14
853500 -- (-503.624) (-499.077) [-500.342] (-507.106) * [-505.421] (-511.190) (-500.194) (-505.545) -- 0:00:14
854000 -- (-509.647) [-497.977] (-502.632) (-502.855) * (-502.893) (-500.961) [-503.336] (-505.041) -- 0:00:14
854500 -- (-506.981) [-498.596] (-502.918) (-502.049) * (-500.029) (-499.696) (-503.925) [-503.444] -- 0:00:14
855000 -- (-505.029) [-496.725] (-504.650) (-504.901) * (-502.513) (-508.459) [-496.993] (-500.891) -- 0:00:14
Average standard deviation of split frequencies: 0.008077
855500 -- [-500.612] (-503.164) (-508.503) (-510.481) * (-506.595) (-499.435) [-495.987] (-502.020) -- 0:00:14
856000 -- (-502.170) (-499.007) (-508.546) [-505.011] * (-502.628) [-499.958] (-499.838) (-501.200) -- 0:00:14
856500 -- (-503.515) [-497.932] (-509.215) (-508.591) * (-510.266) (-503.071) (-502.416) [-497.424] -- 0:00:14
857000 -- [-501.102] (-511.589) (-508.385) (-512.809) * [-500.251] (-501.643) (-500.210) (-500.598) -- 0:00:14
857500 -- [-498.734] (-503.104) (-509.732) (-512.670) * (-503.094) (-501.681) [-499.919] (-506.203) -- 0:00:14
858000 -- (-500.858) (-502.241) (-508.640) [-510.248] * [-499.268] (-500.511) (-499.580) (-502.169) -- 0:00:14
858500 -- (-501.925) (-512.034) [-504.701] (-509.719) * (-498.494) (-513.064) [-497.794] (-504.841) -- 0:00:14
859000 -- [-499.445] (-509.650) (-509.306) (-510.879) * [-496.992] (-507.818) (-500.992) (-500.325) -- 0:00:13
859500 -- [-502.912] (-498.414) (-501.752) (-515.979) * (-502.630) (-504.619) [-497.662] (-507.949) -- 0:00:13
860000 -- [-500.964] (-504.241) (-498.883) (-504.771) * (-504.084) [-499.359] (-502.184) (-500.223) -- 0:00:13
Average standard deviation of split frequencies: 0.008764
860500 -- (-496.981) (-511.266) [-499.403] (-501.769) * (-495.561) [-499.056] (-504.926) (-500.597) -- 0:00:13
861000 -- [-497.367] (-510.642) (-505.535) (-507.152) * (-498.994) [-504.210] (-500.414) (-504.861) -- 0:00:13
861500 -- (-499.507) [-499.100] (-501.068) (-503.673) * [-504.376] (-498.823) (-506.515) (-504.975) -- 0:00:13
862000 -- [-495.934] (-500.858) (-500.966) (-507.788) * (-506.864) [-497.065] (-510.390) (-502.105) -- 0:00:13
862500 -- (-500.608) (-507.120) (-506.156) [-502.115] * (-500.857) (-499.693) (-504.632) [-501.211] -- 0:00:13
863000 -- (-497.459) [-501.508] (-501.433) (-505.388) * [-504.932] (-498.986) (-505.126) (-500.894) -- 0:00:13
863500 -- [-502.905] (-501.687) (-510.113) (-506.534) * (-500.637) (-507.093) (-508.320) [-503.403] -- 0:00:13
864000 -- (-506.164) [-501.758] (-501.728) (-499.463) * [-494.661] (-499.925) (-506.216) (-501.748) -- 0:00:13
864500 -- (-505.196) (-498.311) [-500.269] (-503.126) * (-502.218) [-499.947] (-506.551) (-506.509) -- 0:00:13
865000 -- (-501.122) (-499.419) (-502.055) [-502.739] * (-497.886) [-500.232] (-502.073) (-504.247) -- 0:00:13
Average standard deviation of split frequencies: 0.007984
865500 -- (-506.003) (-503.503) (-496.600) [-496.380] * (-503.128) [-501.911] (-504.467) (-500.085) -- 0:00:13
866000 -- (-509.943) (-500.230) [-496.738] (-504.613) * [-502.892] (-497.643) (-504.166) (-502.093) -- 0:00:13
866500 -- [-501.337] (-504.400) (-496.786) (-500.294) * (-498.110) (-498.647) (-504.544) [-502.936] -- 0:00:13
867000 -- (-504.838) (-500.686) (-498.864) [-499.142] * (-498.614) (-498.978) [-501.290] (-500.133) -- 0:00:13
867500 -- (-507.085) [-500.335] (-496.989) (-495.802) * (-501.504) (-498.104) (-499.332) [-501.008] -- 0:00:13
868000 -- (-503.942) [-498.145] (-497.443) (-499.652) * (-503.819) (-501.639) (-499.226) [-503.625] -- 0:00:13
868500 -- (-502.565) (-503.705) [-497.477] (-501.177) * (-501.941) (-507.161) (-497.948) [-499.138] -- 0:00:13
869000 -- (-501.592) (-501.041) (-500.763) [-503.734] * (-500.790) [-500.052] (-501.540) (-503.456) -- 0:00:12
869500 -- (-503.524) (-504.219) (-499.824) [-502.076] * (-500.667) (-508.413) (-500.071) [-499.434] -- 0:00:12
870000 -- (-502.636) (-504.684) [-498.873] (-502.808) * (-499.891) [-501.462] (-503.650) (-500.539) -- 0:00:12
Average standard deviation of split frequencies: 0.006497
870500 -- (-503.851) (-500.167) (-502.592) [-496.413] * [-500.146] (-500.938) (-502.087) (-500.991) -- 0:00:12
871000 -- (-502.178) (-502.017) (-498.960) [-503.707] * (-498.073) (-505.069) (-501.528) [-501.996] -- 0:00:12
871500 -- (-503.431) (-503.990) (-502.498) [-499.334] * (-497.933) [-495.778] (-503.643) (-503.200) -- 0:00:12
872000 -- (-499.546) (-505.061) [-500.420] (-499.773) * (-502.000) (-502.798) (-501.766) [-498.612] -- 0:00:12
872500 -- (-499.427) (-497.681) [-501.150] (-500.535) * (-500.592) (-500.865) (-499.469) [-499.544] -- 0:00:12
873000 -- (-506.658) (-498.693) (-498.960) [-502.026] * (-505.598) (-504.568) [-497.515] (-501.663) -- 0:00:12
873500 -- (-502.987) (-497.082) (-507.529) [-496.735] * (-498.311) (-501.870) [-498.365] (-505.042) -- 0:00:12
874000 -- (-502.415) (-502.720) (-500.726) [-497.328] * [-496.242] (-500.080) (-500.213) (-499.240) -- 0:00:12
874500 -- (-504.080) [-504.715] (-497.488) (-501.519) * (-499.415) (-505.443) (-506.857) [-502.339] -- 0:00:12
875000 -- [-503.145] (-501.609) (-500.555) (-501.771) * (-501.788) (-502.771) [-501.044] (-498.401) -- 0:00:12
Average standard deviation of split frequencies: 0.006996
875500 -- (-502.574) [-500.171] (-502.885) (-510.568) * (-506.065) [-499.221] (-500.268) (-500.151) -- 0:00:12
876000 -- (-508.420) (-508.028) [-500.920] (-504.405) * (-506.124) (-501.076) (-496.455) [-498.759] -- 0:00:12
876500 -- (-503.604) [-498.685] (-505.491) (-500.363) * (-504.264) (-502.982) (-496.196) [-502.560] -- 0:00:12
877000 -- (-503.616) (-506.914) [-504.060] (-507.388) * (-510.385) [-497.868] (-507.247) (-501.764) -- 0:00:12
877500 -- [-500.175] (-498.316) (-514.268) (-502.762) * (-501.269) (-505.408) (-504.376) [-503.277] -- 0:00:12
878000 -- (-497.611) [-497.996] (-505.990) (-506.154) * (-506.344) [-496.600] (-498.458) (-508.943) -- 0:00:12
878500 -- (-501.917) [-498.283] (-519.788) (-500.796) * (-504.019) (-502.981) [-499.569] (-500.224) -- 0:00:12
879000 -- [-499.870] (-501.005) (-503.708) (-498.315) * (-502.517) (-506.283) (-500.329) [-502.358] -- 0:00:11
879500 -- [-498.671] (-509.384) (-506.828) (-504.471) * (-496.532) (-502.748) (-503.244) [-499.580] -- 0:00:11
880000 -- (-503.218) (-507.260) (-498.262) [-500.863] * [-499.110] (-503.088) (-501.760) (-501.870) -- 0:00:11
Average standard deviation of split frequencies: 0.004639
880500 -- (-500.735) [-499.117] (-500.835) (-498.757) * (-501.736) [-502.969] (-504.191) (-504.805) -- 0:00:11
881000 -- (-500.725) (-504.530) [-503.145] (-498.421) * (-501.769) (-512.195) (-503.777) [-499.220] -- 0:00:11
881500 -- [-495.654] (-506.842) (-500.355) (-502.333) * (-509.922) (-503.209) [-498.077] (-502.285) -- 0:00:11
882000 -- (-501.829) (-497.087) [-496.878] (-502.722) * (-503.911) (-496.768) [-499.918] (-499.771) -- 0:00:11
882500 -- (-498.943) (-498.586) [-498.688] (-498.533) * (-507.965) (-496.043) (-503.355) [-500.679] -- 0:00:11
883000 -- (-509.751) (-505.989) (-503.597) [-497.645] * (-498.369) [-503.740] (-504.600) (-502.407) -- 0:00:11
883500 -- [-504.348] (-505.684) (-506.548) (-502.396) * (-499.710) (-497.424) (-501.749) [-497.814] -- 0:00:11
884000 -- [-505.311] (-502.244) (-506.739) (-504.460) * (-506.976) [-500.870] (-496.588) (-498.754) -- 0:00:11
884500 -- (-503.127) (-503.734) (-502.001) [-503.618] * (-509.705) [-504.755] (-498.185) (-502.090) -- 0:00:11
885000 -- (-509.341) (-499.103) [-501.301] (-497.069) * (-505.972) (-507.047) [-496.876] (-500.577) -- 0:00:11
Average standard deviation of split frequencies: 0.004434
885500 -- (-505.380) [-499.884] (-506.347) (-506.558) * (-505.263) (-500.071) (-500.233) [-501.828] -- 0:00:11
886000 -- (-503.984) (-504.047) [-499.629] (-502.172) * (-500.984) (-500.935) (-502.949) [-499.549] -- 0:00:11
886500 -- (-507.270) [-500.852] (-499.541) (-500.296) * [-500.354] (-500.046) (-500.229) (-502.386) -- 0:00:11
887000 -- (-505.314) (-500.294) [-500.769] (-507.332) * (-499.137) (-499.293) [-507.028] (-501.467) -- 0:00:11
887500 -- [-502.018] (-498.298) (-503.793) (-503.463) * [-497.338] (-497.075) (-501.013) (-510.243) -- 0:00:11
888000 -- [-503.069] (-499.471) (-503.442) (-507.315) * (-502.296) (-497.969) (-503.293) [-499.551] -- 0:00:11
888500 -- [-500.104] (-497.192) (-508.294) (-503.645) * (-505.555) (-498.574) (-501.963) [-502.062] -- 0:00:11
889000 -- (-504.576) (-500.532) [-499.597] (-504.111) * (-496.721) [-500.798] (-499.794) (-499.067) -- 0:00:10
889500 -- (-503.053) (-498.804) (-494.472) [-497.912] * [-504.630] (-496.472) (-503.103) (-508.107) -- 0:00:10
890000 -- [-509.048] (-502.645) (-507.239) (-499.372) * (-501.608) (-497.717) (-496.558) [-500.618] -- 0:00:10
Average standard deviation of split frequencies: 0.004587
890500 -- [-505.583] (-506.338) (-506.448) (-498.943) * (-500.505) (-501.344) (-500.071) [-506.335] -- 0:00:10
891000 -- (-506.639) (-499.986) (-500.882) [-500.478] * (-501.775) (-506.517) (-501.891) [-499.952] -- 0:00:10
891500 -- (-505.746) [-500.433] (-502.451) (-500.230) * (-510.391) (-499.303) (-503.465) [-498.683] -- 0:00:10
892000 -- [-499.915] (-497.600) (-506.886) (-502.495) * [-499.012] (-497.925) (-503.420) (-498.631) -- 0:00:10
892500 -- [-502.083] (-501.139) (-502.060) (-505.443) * [-499.329] (-500.079) (-509.502) (-499.216) -- 0:00:10
893000 -- [-503.382] (-504.046) (-497.069) (-506.558) * [-501.419] (-505.044) (-498.892) (-501.052) -- 0:00:10
893500 -- (-503.151) (-499.958) [-501.685] (-499.304) * (-502.475) [-505.495] (-496.988) (-500.334) -- 0:00:10
894000 -- (-506.556) [-498.180] (-496.357) (-504.178) * (-502.230) [-500.297] (-498.231) (-499.554) -- 0:00:10
894500 -- (-503.976) (-501.252) (-502.448) [-503.566] * (-496.138) (-509.616) [-498.340] (-502.132) -- 0:00:10
895000 -- (-504.247) (-510.498) (-497.964) [-508.876] * (-503.265) [-502.466] (-500.286) (-505.258) -- 0:00:10
Average standard deviation of split frequencies: 0.004735
895500 -- (-500.111) [-497.166] (-502.516) (-510.657) * (-500.914) [-495.562] (-504.686) (-495.171) -- 0:00:10
896000 -- (-500.517) [-502.190] (-501.098) (-509.287) * (-505.649) (-501.954) [-500.636] (-500.421) -- 0:00:10
896500 -- [-498.845] (-497.716) (-500.216) (-505.960) * (-504.211) (-497.104) (-506.263) [-500.431] -- 0:00:10
897000 -- [-501.305] (-499.659) (-501.079) (-510.211) * (-505.632) [-496.415] (-500.516) (-500.868) -- 0:00:10
897500 -- (-503.833) (-501.053) [-502.801] (-507.435) * (-500.119) (-499.810) (-502.546) [-502.259] -- 0:00:10
898000 -- (-502.591) (-507.195) [-500.608] (-510.579) * [-501.859] (-495.546) (-501.054) (-504.511) -- 0:00:10
898500 -- (-500.575) [-497.140] (-508.133) (-509.068) * (-501.366) (-502.844) (-505.971) [-502.854] -- 0:00:10
899000 -- [-504.559] (-499.178) (-507.647) (-503.141) * (-500.717) (-500.439) [-501.497] (-499.956) -- 0:00:09
899500 -- (-503.752) (-496.397) (-501.368) [-504.189] * (-511.694) [-497.464] (-511.215) (-500.937) -- 0:00:09
900000 -- (-499.388) [-504.865] (-498.879) (-505.570) * [-505.318] (-501.078) (-501.726) (-503.840) -- 0:00:09
Average standard deviation of split frequencies: 0.004362
900500 -- (-503.828) (-500.199) (-500.083) [-500.732] * (-503.726) (-505.062) (-504.517) [-497.621] -- 0:00:09
901000 -- [-502.972] (-505.224) (-498.231) (-505.843) * (-501.338) [-496.632] (-501.913) (-501.113) -- 0:00:09
901500 -- (-499.691) (-497.361) [-496.895] (-507.241) * (-502.932) (-499.353) [-501.720] (-501.220) -- 0:00:09
902000 -- (-504.101) (-507.543) [-502.586] (-499.100) * (-500.634) (-499.201) (-500.399) [-503.294] -- 0:00:09
902500 -- (-502.651) (-503.310) (-513.127) [-499.680] * (-499.266) (-501.494) (-497.925) [-503.758] -- 0:00:09
903000 -- (-502.969) (-499.117) [-503.292] (-506.550) * (-503.705) (-500.415) [-496.990] (-506.551) -- 0:00:09
903500 -- (-499.938) (-499.025) (-500.213) [-502.747] * (-508.848) [-498.818] (-499.804) (-501.281) -- 0:00:09
904000 -- [-500.873] (-504.209) (-502.232) (-502.092) * (-506.117) (-498.452) [-500.900] (-502.912) -- 0:00:09
904500 -- (-499.358) [-503.767] (-504.010) (-501.757) * (-497.450) [-496.615] (-499.231) (-502.488) -- 0:00:09
905000 -- (-498.170) [-504.438] (-502.597) (-505.897) * (-503.044) [-504.545] (-499.886) (-503.472) -- 0:00:09
Average standard deviation of split frequencies: 0.003295
905500 -- (-510.164) (-499.806) (-502.224) [-499.706] * (-504.210) (-497.979) (-504.810) [-499.843] -- 0:00:09
906000 -- (-501.000) [-502.019] (-512.067) (-507.445) * (-499.138) (-504.067) (-508.502) [-500.693] -- 0:00:09
906500 -- (-504.908) (-512.806) [-501.031] (-499.598) * (-504.868) (-506.986) (-502.279) [-498.204] -- 0:00:09
907000 -- (-503.495) (-497.143) [-507.859] (-502.899) * (-498.591) (-500.136) [-499.675] (-499.587) -- 0:00:09
907500 -- (-507.602) [-500.836] (-505.903) (-504.345) * (-499.139) (-505.793) [-498.665] (-499.894) -- 0:00:09
908000 -- [-502.069] (-503.797) (-503.722) (-512.304) * [-498.257] (-499.902) (-502.599) (-502.247) -- 0:00:09
908500 -- [-503.469] (-501.557) (-504.001) (-501.101) * (-507.508) (-505.351) (-505.142) [-499.579] -- 0:00:09
909000 -- (-501.531) (-504.892) (-499.166) [-501.049] * (-498.428) (-498.160) [-500.705] (-498.543) -- 0:00:09
909500 -- [-506.034] (-504.144) (-499.622) (-499.537) * (-506.570) (-498.879) (-502.635) [-502.789] -- 0:00:08
910000 -- (-502.061) (-506.928) [-499.501] (-507.522) * (-499.256) (-503.977) [-502.712] (-502.604) -- 0:00:08
Average standard deviation of split frequencies: 0.003278
910500 -- (-500.081) (-495.867) (-513.284) [-504.841] * (-500.538) (-500.497) [-499.899] (-504.617) -- 0:00:08
911000 -- (-503.686) [-498.967] (-498.621) (-507.765) * (-503.945) [-498.837] (-501.229) (-502.993) -- 0:00:08
911500 -- [-500.561] (-502.724) (-499.724) (-506.981) * (-501.888) (-499.244) (-502.784) [-499.847] -- 0:00:08
912000 -- (-498.722) (-501.452) (-502.097) [-506.480] * [-505.016] (-498.983) (-505.211) (-497.057) -- 0:00:08
912500 -- [-500.682] (-500.677) (-504.701) (-504.750) * [-507.016] (-498.044) (-506.499) (-504.594) -- 0:00:08
913000 -- (-500.606) [-499.717] (-506.977) (-499.888) * [-502.850] (-501.472) (-504.172) (-507.071) -- 0:00:08
913500 -- (-499.093) [-501.471] (-499.130) (-505.437) * (-500.208) (-497.647) (-501.570) [-500.256] -- 0:00:08
914000 -- [-501.286] (-503.999) (-499.340) (-502.668) * (-496.590) [-503.207] (-502.175) (-502.219) -- 0:00:08
914500 -- (-503.540) (-502.095) [-500.511] (-500.495) * [-498.398] (-500.956) (-505.133) (-503.065) -- 0:00:08
915000 -- (-502.439) [-501.486] (-500.925) (-500.284) * [-495.309] (-502.988) (-504.883) (-505.416) -- 0:00:08
Average standard deviation of split frequencies: 0.003774
915500 -- [-502.141] (-503.954) (-501.412) (-501.741) * (-510.681) [-498.314] (-499.957) (-503.599) -- 0:00:08
916000 -- (-501.408) (-502.883) [-500.176] (-496.788) * [-498.570] (-507.481) (-503.293) (-500.644) -- 0:00:08
916500 -- (-504.155) (-502.467) [-500.960] (-496.361) * (-502.001) [-503.479] (-499.566) (-503.604) -- 0:00:08
917000 -- (-497.996) [-499.355] (-498.131) (-506.006) * (-499.129) (-507.222) (-505.887) [-503.529] -- 0:00:08
917500 -- (-500.969) (-505.112) [-502.092] (-502.363) * (-498.162) (-498.598) (-506.381) [-499.680] -- 0:00:08
918000 -- (-496.892) (-503.733) (-502.850) [-501.190] * (-502.971) (-500.463) [-497.810] (-500.590) -- 0:00:08
918500 -- [-503.241] (-502.398) (-500.455) (-504.728) * (-496.787) (-502.578) (-502.467) [-499.304] -- 0:00:08
919000 -- (-501.497) (-504.319) (-500.963) [-500.047] * (-502.355) [-502.016] (-502.845) (-501.729) -- 0:00:08
919500 -- (-499.745) (-500.613) (-505.370) [-501.627] * (-499.996) (-501.508) (-501.850) [-499.361] -- 0:00:07
920000 -- (-504.692) (-503.796) [-501.256] (-500.259) * (-499.549) [-503.061] (-502.134) (-498.039) -- 0:00:07
Average standard deviation of split frequencies: 0.003414
920500 -- (-500.002) (-504.758) [-498.180] (-500.307) * (-503.954) [-500.130] (-505.499) (-504.226) -- 0:00:07
921000 -- (-504.728) (-502.633) [-500.520] (-497.709) * (-497.120) (-503.304) [-499.377] (-504.944) -- 0:00:07
921500 -- (-504.890) (-511.288) (-501.987) [-496.066] * (-499.737) [-506.534] (-500.068) (-500.795) -- 0:00:07
922000 -- (-504.259) (-506.898) (-502.831) [-502.478] * (-507.101) [-508.038] (-502.141) (-497.176) -- 0:00:07
922500 -- [-497.688] (-498.886) (-501.037) (-505.693) * (-504.027) (-516.724) [-498.657] (-500.401) -- 0:00:07
923000 -- (-502.268) (-504.413) [-501.754] (-499.828) * (-505.143) (-507.288) (-500.604) [-503.662] -- 0:00:07
923500 -- (-499.285) (-502.180) (-498.594) [-506.396] * (-508.240) (-508.361) [-500.088] (-502.846) -- 0:00:07
924000 -- (-500.030) (-497.548) [-499.741] (-503.205) * (-510.741) (-508.770) [-500.500] (-504.392) -- 0:00:07
924500 -- [-499.893] (-499.760) (-500.935) (-502.051) * (-510.800) (-504.422) (-499.724) [-503.834] -- 0:00:07
925000 -- (-504.653) [-499.329] (-512.029) (-498.832) * (-506.813) [-512.125] (-505.989) (-515.693) -- 0:00:07
Average standard deviation of split frequencies: 0.004073
925500 -- (-504.594) [-499.725] (-502.535) (-503.471) * (-506.657) (-505.910) [-506.130] (-499.461) -- 0:00:07
926000 -- [-500.317] (-500.542) (-501.945) (-501.591) * (-512.232) (-507.053) [-503.943] (-506.595) -- 0:00:07
926500 -- [-497.561] (-501.462) (-502.107) (-496.851) * (-504.684) (-507.840) [-506.879] (-507.988) -- 0:00:07
927000 -- (-501.181) (-497.868) [-498.691] (-502.285) * [-500.251] (-504.559) (-507.881) (-499.077) -- 0:00:07
927500 -- (-497.883) (-507.185) (-498.505) [-502.832] * (-501.408) (-507.470) [-500.707] (-499.290) -- 0:00:07
928000 -- [-499.816] (-509.068) (-497.502) (-507.738) * (-507.291) (-504.032) (-506.088) [-505.745] -- 0:00:07
928500 -- (-500.617) (-504.573) [-500.640] (-502.583) * (-505.659) (-499.878) (-511.548) [-502.916] -- 0:00:07
929000 -- (-506.830) (-507.361) [-497.994] (-502.691) * (-499.577) (-501.692) (-503.790) [-503.139] -- 0:00:07
929500 -- (-505.875) (-505.230) (-499.890) [-502.996] * [-499.670] (-506.661) (-506.156) (-508.261) -- 0:00:06
930000 -- (-501.701) (-505.543) [-499.375] (-504.911) * (-499.110) (-508.270) [-501.538] (-501.357) -- 0:00:06
Average standard deviation of split frequencies: 0.004390
930500 -- (-496.584) [-512.428] (-504.689) (-501.374) * (-500.888) (-502.877) (-504.984) [-504.884] -- 0:00:06
931000 -- [-501.305] (-501.267) (-503.834) (-500.353) * (-502.860) (-499.535) [-505.043] (-500.464) -- 0:00:06
931500 -- (-503.515) (-504.769) [-500.612] (-498.798) * [-502.854] (-499.674) (-507.665) (-503.947) -- 0:00:06
932000 -- (-501.427) [-505.177] (-499.391) (-499.759) * [-498.407] (-499.245) (-509.301) (-502.775) -- 0:00:06
932500 -- (-501.741) (-506.773) [-500.847] (-499.292) * [-504.768] (-502.143) (-508.226) (-497.375) -- 0:00:06
933000 -- (-502.160) (-513.353) (-505.935) [-498.312] * (-505.982) (-497.321) (-503.607) [-500.573] -- 0:00:06
933500 -- [-499.422] (-499.448) (-503.720) (-500.451) * (-503.700) [-499.855] (-500.189) (-502.709) -- 0:00:06
934000 -- (-499.707) (-501.042) [-499.210] (-500.509) * (-500.238) [-497.305] (-505.167) (-499.958) -- 0:00:06
934500 -- (-498.504) (-501.186) [-503.928] (-497.437) * (-498.362) [-499.650] (-502.598) (-498.298) -- 0:00:06
935000 -- (-499.814) (-509.146) (-499.765) [-498.241] * (-513.012) (-500.312) [-503.055] (-509.314) -- 0:00:06
Average standard deviation of split frequencies: 0.005372
935500 -- (-501.718) (-501.400) (-504.353) [-501.178] * [-505.853] (-503.966) (-500.386) (-503.963) -- 0:00:06
936000 -- [-497.639] (-500.141) (-506.736) (-499.465) * (-502.532) [-502.997] (-498.052) (-502.521) -- 0:00:06
936500 -- [-501.202] (-500.782) (-505.388) (-505.794) * (-507.948) [-500.365] (-501.926) (-503.254) -- 0:00:06
937000 -- (-507.666) [-500.940] (-507.105) (-498.110) * (-504.391) (-507.810) [-502.899] (-503.088) -- 0:00:06
937500 -- (-504.060) (-501.405) (-499.017) [-495.914] * [-499.042] (-503.628) (-500.204) (-500.437) -- 0:00:06
938000 -- (-503.813) [-494.196] (-495.478) (-497.636) * (-504.445) (-505.903) [-501.844] (-506.904) -- 0:00:06
938500 -- [-505.537] (-502.944) (-499.244) (-501.452) * [-503.857] (-501.459) (-501.891) (-503.213) -- 0:00:06
939000 -- (-503.255) (-502.765) [-504.387] (-499.648) * [-506.282] (-498.261) (-500.142) (-508.532) -- 0:00:06
939500 -- (-501.983) (-508.314) [-500.012] (-500.596) * (-505.513) (-498.483) (-502.155) [-501.839] -- 0:00:05
940000 -- [-498.890] (-501.520) (-500.999) (-499.707) * (-511.388) (-499.744) (-499.759) [-500.285] -- 0:00:05
Average standard deviation of split frequencies: 0.005011
940500 -- (-503.446) [-500.013] (-502.477) (-501.321) * (-519.424) [-502.606] (-504.649) (-500.153) -- 0:00:05
941000 -- (-505.520) [-500.716] (-498.331) (-500.484) * (-513.698) [-501.949] (-508.907) (-503.025) -- 0:00:05
941500 -- (-512.222) [-498.208] (-499.408) (-499.006) * [-504.373] (-502.197) (-499.303) (-505.889) -- 0:00:05
942000 -- (-498.576) (-501.215) [-497.269] (-504.688) * (-505.809) (-506.413) (-501.872) [-500.686] -- 0:00:05
942500 -- (-501.132) (-500.851) [-497.234] (-505.748) * (-507.244) (-505.462) [-499.883] (-500.981) -- 0:00:05
943000 -- (-506.549) (-501.465) [-500.341] (-496.623) * (-510.239) [-500.657] (-509.824) (-500.650) -- 0:00:05
943500 -- (-503.696) (-497.794) (-502.464) [-501.704] * (-506.036) (-502.818) (-505.339) [-504.770] -- 0:00:05
944000 -- (-505.840) [-496.575] (-503.574) (-504.822) * [-502.178] (-505.162) (-505.273) (-504.007) -- 0:00:05
944500 -- (-501.306) (-500.594) [-498.994] (-502.554) * (-500.227) (-499.549) (-504.317) [-496.876] -- 0:00:05
945000 -- [-503.452] (-497.311) (-501.795) (-500.712) * [-500.229] (-502.934) (-505.100) (-504.103) -- 0:00:05
Average standard deviation of split frequencies: 0.005648
945500 -- (-499.715) (-498.628) [-502.889] (-509.953) * (-502.523) (-501.521) (-507.358) [-503.726] -- 0:00:05
946000 -- (-501.870) (-500.883) [-500.528] (-503.032) * (-505.592) (-499.138) [-504.656] (-499.688) -- 0:00:05
946500 -- (-501.894) [-501.033] (-506.124) (-503.805) * (-505.408) (-498.897) [-500.685] (-504.614) -- 0:00:05
947000 -- [-497.200] (-504.532) (-501.338) (-500.245) * (-503.169) [-500.238] (-499.241) (-495.515) -- 0:00:05
947500 -- (-502.396) [-501.250] (-498.006) (-505.331) * (-499.982) [-498.674] (-499.362) (-500.113) -- 0:00:05
948000 -- [-505.624] (-506.408) (-500.018) (-504.712) * (-507.076) (-504.975) [-496.982] (-502.063) -- 0:00:05
948500 -- (-504.658) [-498.117] (-506.275) (-503.954) * [-503.833] (-501.468) (-502.648) (-499.691) -- 0:00:05
949000 -- (-509.832) (-508.540) [-503.054] (-504.851) * [-499.868] (-504.487) (-499.426) (-504.578) -- 0:00:05
949500 -- (-502.578) (-503.633) (-498.961) [-512.120] * (-499.809) [-502.889] (-509.215) (-499.863) -- 0:00:04
950000 -- (-499.939) (-503.646) (-508.445) [-498.622] * (-499.497) [-507.831] (-513.115) (-511.160) -- 0:00:04
Average standard deviation of split frequencies: 0.007107
950500 -- (-497.125) [-498.772] (-505.811) (-499.917) * [-502.271] (-508.969) (-510.000) (-505.195) -- 0:00:04
951000 -- (-499.433) (-499.062) (-497.886) [-499.337] * (-499.002) [-506.152] (-511.703) (-510.794) -- 0:00:04
951500 -- (-498.964) (-503.490) [-496.710] (-498.416) * [-498.953] (-501.251) (-510.504) (-504.070) -- 0:00:04
952000 -- (-511.809) [-497.701] (-500.188) (-503.256) * (-500.068) [-502.815] (-511.650) (-502.059) -- 0:00:04
952500 -- (-508.345) [-499.002] (-501.933) (-497.622) * (-502.655) (-509.843) (-504.745) [-503.008] -- 0:00:04
953000 -- (-506.369) (-512.237) (-503.210) [-503.890] * (-500.272) (-501.349) [-508.213] (-501.155) -- 0:00:04
953500 -- [-503.133] (-503.251) (-504.030) (-507.499) * [-498.267] (-502.844) (-497.659) (-501.136) -- 0:00:04
954000 -- [-503.470] (-503.540) (-504.665) (-504.027) * [-498.740] (-502.747) (-503.875) (-503.818) -- 0:00:04
954500 -- (-503.239) (-503.647) [-499.047] (-499.834) * (-502.026) (-498.770) [-498.413] (-504.934) -- 0:00:04
955000 -- (-509.209) (-500.939) [-498.533] (-500.599) * [-503.256] (-508.315) (-502.745) (-501.453) -- 0:00:04
Average standard deviation of split frequencies: 0.006575
955500 -- [-503.432] (-503.045) (-503.305) (-502.652) * (-504.407) [-500.571] (-498.777) (-497.082) -- 0:00:04
956000 -- (-508.817) (-507.407) [-500.215] (-501.847) * (-503.540) [-499.601] (-503.642) (-500.772) -- 0:00:04
956500 -- (-505.918) (-499.556) [-506.780] (-498.566) * (-501.895) (-505.561) [-500.932] (-498.223) -- 0:00:04
957000 -- (-502.139) (-505.396) [-501.791] (-496.495) * (-500.936) (-503.519) [-501.308] (-502.352) -- 0:00:04
957500 -- (-499.869) (-498.645) (-506.402) [-501.649] * (-501.308) (-498.690) [-499.757] (-496.343) -- 0:00:04
958000 -- (-504.410) (-503.060) [-504.094] (-502.228) * (-502.413) [-502.255] (-499.056) (-502.758) -- 0:00:04
958500 -- (-498.981) [-498.728] (-500.826) (-496.475) * [-503.621] (-502.480) (-500.585) (-499.712) -- 0:00:04
959000 -- (-501.759) (-501.303) (-501.864) [-500.465] * (-499.039) [-499.577] (-502.999) (-500.924) -- 0:00:04
959500 -- [-497.212] (-498.793) (-502.910) (-501.474) * [-497.937] (-501.361) (-506.145) (-501.160) -- 0:00:04
960000 -- (-501.734) (-498.565) (-502.039) [-501.156] * (-506.377) [-503.385] (-500.259) (-500.126) -- 0:00:03
Average standard deviation of split frequencies: 0.006379
960500 -- (-498.185) (-502.515) [-498.727] (-502.458) * (-503.025) (-507.400) [-502.376] (-500.007) -- 0:00:03
961000 -- (-499.978) (-499.322) [-497.986] (-500.571) * (-498.355) (-510.605) (-499.289) [-499.037] -- 0:00:03
961500 -- (-498.523) (-500.063) [-504.130] (-499.066) * (-501.656) (-511.951) [-500.179] (-498.581) -- 0:00:03
962000 -- (-495.943) (-504.364) (-499.205) [-501.325] * (-500.877) (-504.718) [-500.401] (-504.720) -- 0:00:03
962500 -- (-501.041) (-504.555) (-513.802) [-498.306] * (-501.951) (-505.600) [-497.056] (-506.042) -- 0:00:03
963000 -- (-506.565) (-500.764) (-509.085) [-503.129] * (-507.579) [-504.578] (-502.073) (-499.991) -- 0:00:03
963500 -- (-507.878) [-499.798] (-504.997) (-502.605) * (-499.980) (-504.230) [-501.466] (-504.314) -- 0:00:03
964000 -- (-496.867) (-500.898) (-512.102) [-503.930] * (-511.954) [-504.331] (-500.422) (-501.339) -- 0:00:03
964500 -- (-500.054) [-498.536] (-509.240) (-501.599) * (-499.156) (-505.686) [-496.866] (-506.999) -- 0:00:03
965000 -- (-500.138) [-501.234] (-513.247) (-502.607) * (-498.028) [-505.323] (-499.338) (-505.861) -- 0:00:03
Average standard deviation of split frequencies: 0.005693
965500 -- (-497.470) (-499.014) (-499.378) [-497.283] * [-498.441] (-504.364) (-503.331) (-505.505) -- 0:00:03
966000 -- (-500.283) (-502.799) (-499.933) [-500.859] * (-498.453) [-504.474] (-503.852) (-504.638) -- 0:00:03
966500 -- (-500.715) (-506.564) [-499.712] (-499.648) * (-499.018) [-501.139] (-498.471) (-505.981) -- 0:00:03
967000 -- (-502.152) (-502.315) (-501.326) [-507.043] * [-502.358] (-504.802) (-505.758) (-503.663) -- 0:00:03
967500 -- (-502.260) (-505.448) [-499.033] (-506.009) * (-497.485) (-499.709) (-503.480) [-498.553] -- 0:00:03
968000 -- (-499.076) (-500.998) (-503.802) [-499.797] * (-501.905) (-500.466) [-501.102] (-499.545) -- 0:00:03
968500 -- (-501.959) (-501.538) (-501.403) [-496.053] * [-502.478] (-501.146) (-504.857) (-508.056) -- 0:00:03
969000 -- [-499.332] (-498.570) (-497.593) (-501.042) * (-498.071) (-500.717) [-504.902] (-501.395) -- 0:00:03
969500 -- (-499.770) [-499.514] (-499.205) (-504.806) * (-502.727) [-503.908] (-508.578) (-502.963) -- 0:00:03
970000 -- (-497.807) (-497.708) [-502.887] (-500.791) * (-504.513) [-502.108] (-503.032) (-505.583) -- 0:00:02
Average standard deviation of split frequencies: 0.006313
970500 -- (-496.358) (-500.223) [-505.944] (-506.133) * [-501.479] (-501.380) (-501.797) (-502.118) -- 0:00:02
971000 -- (-500.964) (-507.362) [-501.925] (-507.143) * (-501.348) (-503.066) [-495.798] (-502.549) -- 0:00:02
971500 -- (-502.965) [-505.032] (-502.465) (-501.241) * (-504.160) [-496.844] (-506.786) (-502.030) -- 0:00:02
972000 -- [-509.645] (-507.847) (-503.966) (-503.640) * (-499.668) (-505.265) [-503.791] (-500.847) -- 0:00:02
972500 -- (-508.339) (-503.584) [-495.789] (-506.421) * (-508.477) (-501.486) (-502.958) [-498.934] -- 0:00:02
973000 -- (-501.039) [-498.002] (-500.744) (-499.209) * [-502.841] (-496.685) (-501.174) (-501.008) -- 0:00:02
973500 -- (-504.316) (-502.801) (-501.639) [-499.683] * [-499.805] (-498.623) (-507.578) (-500.189) -- 0:00:02
974000 -- (-501.120) [-499.303] (-507.889) (-500.578) * (-500.777) [-499.467] (-498.493) (-496.506) -- 0:00:02
974500 -- (-498.906) [-499.553] (-505.306) (-500.745) * (-497.192) (-503.305) [-503.309] (-495.927) -- 0:00:02
975000 -- (-503.950) (-504.624) [-500.201] (-503.338) * (-508.094) (-500.685) [-498.598] (-504.948) -- 0:00:02
Average standard deviation of split frequencies: 0.006279
975500 -- (-499.395) (-497.806) [-498.346] (-509.010) * (-499.611) [-500.785] (-506.100) (-504.547) -- 0:00:02
976000 -- [-501.419] (-501.734) (-499.118) (-501.231) * (-497.431) (-498.133) (-496.411) [-501.624] -- 0:00:02
976500 -- (-504.397) [-498.612] (-498.172) (-507.900) * (-501.116) (-502.303) (-499.706) [-508.137] -- 0:00:02
977000 -- (-499.303) [-498.223] (-502.175) (-500.378) * (-501.942) (-505.585) [-500.242] (-504.533) -- 0:00:02
977500 -- [-499.112] (-501.769) (-501.017) (-496.217) * [-501.877] (-505.086) (-501.266) (-503.380) -- 0:00:02
978000 -- (-499.825) (-500.111) [-507.348] (-499.761) * [-495.947] (-501.882) (-500.405) (-502.071) -- 0:00:02
978500 -- (-501.875) [-500.435] (-500.319) (-496.292) * [-503.092] (-505.631) (-500.824) (-502.678) -- 0:00:02
979000 -- (-502.088) (-502.494) (-500.671) [-496.921] * (-501.983) [-509.417] (-508.206) (-504.352) -- 0:00:02
979500 -- [-503.257] (-499.627) (-504.754) (-497.828) * (-502.560) (-499.826) [-499.800] (-500.245) -- 0:00:02
980000 -- (-501.345) (-503.183) (-509.327) [-498.908] * (-505.132) (-499.985) [-497.739] (-498.906) -- 0:00:01
Average standard deviation of split frequencies: 0.005929
980500 -- [-499.954] (-505.106) (-503.653) (-501.138) * (-497.133) [-496.664] (-498.555) (-500.633) -- 0:00:01
981000 -- (-498.149) (-502.174) (-506.816) [-496.859] * (-501.426) (-501.525) (-501.145) [-498.278] -- 0:00:01
981500 -- (-501.449) [-499.241] (-504.379) (-499.210) * (-505.534) (-502.604) [-501.169] (-499.802) -- 0:00:01
982000 -- (-499.244) [-501.168] (-501.601) (-498.253) * (-508.757) (-498.421) (-503.640) [-498.411] -- 0:00:01
982500 -- (-497.242) (-508.443) (-497.261) [-497.429] * (-501.965) (-505.060) (-498.505) [-502.716] -- 0:00:01
983000 -- [-499.012] (-505.561) (-502.764) (-498.904) * (-503.320) (-502.157) (-509.255) [-501.240] -- 0:00:01
983500 -- (-501.255) [-503.131] (-500.147) (-499.257) * [-501.012] (-505.080) (-503.256) (-501.376) -- 0:00:01
984000 -- (-507.436) (-503.195) (-506.771) [-495.011] * (-507.619) [-499.858] (-510.794) (-506.324) -- 0:00:01
984500 -- (-501.602) (-505.141) (-501.134) [-498.552] * (-498.317) (-500.986) [-500.790] (-500.010) -- 0:00:01
985000 -- [-499.535] (-505.827) (-501.481) (-501.327) * (-501.362) (-504.161) (-497.265) [-503.906] -- 0:00:01
Average standard deviation of split frequencies: 0.006534
985500 -- (-499.521) [-496.569] (-511.278) (-498.035) * (-501.997) (-502.319) [-501.615] (-505.774) -- 0:00:01
986000 -- (-500.446) (-504.902) [-501.420] (-498.065) * (-509.802) (-500.677) (-503.540) [-499.397] -- 0:00:01
986500 -- [-500.239] (-505.165) (-499.742) (-495.428) * (-504.233) (-498.323) [-502.482] (-502.964) -- 0:00:01
987000 -- [-501.575] (-501.489) (-499.383) (-500.507) * (-498.282) [-501.620] (-506.615) (-509.034) -- 0:00:01
987500 -- (-504.692) (-499.930) [-499.903] (-496.898) * (-500.298) (-506.867) [-499.177] (-501.078) -- 0:00:01
988000 -- (-504.818) [-497.081] (-506.539) (-499.484) * (-499.587) (-499.581) (-503.538) [-506.049] -- 0:00:01
988500 -- (-505.055) [-498.827] (-502.133) (-507.870) * (-499.498) [-497.584] (-503.514) (-501.790) -- 0:00:01
989000 -- (-503.301) (-498.413) (-500.874) [-504.376] * [-497.808] (-501.016) (-499.152) (-503.091) -- 0:00:01
989500 -- (-502.035) (-499.232) [-496.956] (-504.277) * (-501.477) (-502.424) (-505.409) [-502.960] -- 0:00:01
990000 -- (-502.700) (-503.983) [-499.596] (-510.491) * [-497.251] (-505.581) (-499.206) (-503.366) -- 0:00:00
Average standard deviation of split frequencies: 0.007931
990500 -- [-506.679] (-504.156) (-501.443) (-502.602) * (-504.633) [-504.474] (-502.995) (-506.187) -- 0:00:00
991000 -- (-502.617) [-499.446] (-503.237) (-501.074) * (-501.818) (-502.798) (-504.789) [-498.534] -- 0:00:00
991500 -- (-502.029) (-496.619) [-503.448] (-498.580) * (-505.611) (-504.093) [-502.878] (-508.099) -- 0:00:00
992000 -- (-496.619) (-499.605) (-502.249) [-506.062] * (-507.357) [-497.679] (-499.424) (-503.812) -- 0:00:00
992500 -- (-496.894) (-501.001) [-501.106] (-499.408) * (-500.783) [-500.228] (-498.785) (-500.393) -- 0:00:00
993000 -- (-502.190) (-499.755) (-505.593) [-504.236] * (-507.846) [-499.236] (-498.338) (-499.989) -- 0:00:00
993500 -- (-500.830) (-500.012) [-504.632] (-503.370) * (-511.056) [-498.815] (-496.425) (-503.842) -- 0:00:00
994000 -- (-496.744) (-504.826) [-505.761] (-505.255) * (-505.993) (-506.814) [-505.852] (-506.121) -- 0:00:00
994500 -- [-500.762] (-498.446) (-502.671) (-499.443) * (-502.305) [-502.984] (-509.201) (-505.323) -- 0:00:00
995000 -- (-498.952) (-502.847) [-503.626] (-500.794) * (-499.079) (-498.980) (-503.541) [-505.222] -- 0:00:00
Average standard deviation of split frequencies: 0.007731
995500 -- (-502.800) (-507.697) [-502.206] (-506.167) * [-503.516] (-502.765) (-507.770) (-506.615) -- 0:00:00
996000 -- (-502.365) [-500.537] (-498.614) (-502.020) * [-504.421] (-503.211) (-498.681) (-512.238) -- 0:00:00
996500 -- (-499.454) (-503.865) [-496.573] (-500.615) * (-499.964) (-501.793) (-499.426) [-502.518] -- 0:00:00
997000 -- (-498.432) (-506.128) (-501.405) [-498.958] * (-502.265) (-503.651) [-496.138] (-502.510) -- 0:00:00
997500 -- [-503.858] (-504.188) (-498.585) (-497.438) * (-500.459) (-502.390) (-496.301) [-498.358] -- 0:00:00
998000 -- [-498.624] (-497.283) (-500.651) (-504.112) * (-508.727) (-504.062) (-500.589) [-494.396] -- 0:00:00
998500 -- (-498.537) [-495.712] (-501.903) (-496.911) * (-503.922) (-504.236) (-497.006) [-498.896] -- 0:00:00
999000 -- (-499.895) [-503.482] (-505.928) (-497.881) * (-502.143) (-498.033) [-503.739] (-501.674) -- 0:00:00
999500 -- [-500.461] (-499.178) (-498.602) (-501.440) * (-497.974) [-502.103] (-498.286) (-501.418) -- 0:00:00
1000000 -- (-497.428) (-495.655) [-505.393] (-507.977) * [-502.396] (-505.405) (-501.979) (-503.961) -- 0:00:00
Average standard deviation of split frequencies: 0.007223
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -497.428444 -- 11.897797
Chain 1 -- -497.428446 -- 11.897797
Chain 2 -- -495.654611 -- 12.950318
Chain 2 -- -495.654612 -- 12.950318
Chain 3 -- -505.393393 -- 14.042929
Chain 3 -- -505.393392 -- 14.042929
Chain 4 -- -507.977126 -- 9.153597
Chain 4 -- -507.977126 -- 9.153597
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -502.396419 -- 16.969264
Chain 1 -- -502.396419 -- 16.969264
Chain 2 -- -505.404884 -- 14.871771
Chain 2 -- -505.404884 -- 14.871771
Chain 3 -- -501.979399 -- 14.345643
Chain 3 -- -501.979399 -- 14.345643
Chain 4 -- -503.961340 -- 12.756914
Chain 4 -- -503.961339 -- 12.756914
Analysis completed in 1 mins 39 seconds
Analysis used 98.43 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -492.79
Likelihood of best state for "cold" chain of run 2 was -492.79
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
67.2 % ( 54 %) Dirichlet(Revmat{all})
86.1 % ( 78 %) Slider(Revmat{all})
39.3 % ( 25 %) Dirichlet(Pi{all})
39.2 % ( 26 %) Slider(Pi{all})
65.6 % ( 44 %) Multiplier(Alpha{1,2})
56.2 % ( 24 %) Multiplier(Alpha{3})
57.2 % ( 17 %) Slider(Pinvar{all})
13.0 % ( 15 %) ExtSPR(Tau{all},V{all})
13.0 % ( 11 %) ExtTBR(Tau{all},V{all})
12.9 % ( 12 %) NNI(Tau{all},V{all})
14.5 % ( 10 %) ParsSPR(Tau{all},V{all})
27.3 % ( 33 %) Multiplier(V{all})
46.3 % ( 43 %) Nodeslider(V{all})
28.6 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
67.6 % ( 52 %) Dirichlet(Revmat{all})
86.7 % ( 79 %) Slider(Revmat{all})
40.7 % ( 26 %) Dirichlet(Pi{all})
38.3 % ( 29 %) Slider(Pi{all})
64.9 % ( 38 %) Multiplier(Alpha{1,2})
55.6 % ( 24 %) Multiplier(Alpha{3})
56.5 % ( 31 %) Slider(Pinvar{all})
13.2 % ( 21 %) ExtSPR(Tau{all},V{all})
13.1 % ( 15 %) ExtTBR(Tau{all},V{all})
13.2 % ( 7 %) NNI(Tau{all},V{all})
14.8 % ( 12 %) ParsSPR(Tau{all},V{all})
27.2 % ( 25 %) Multiplier(V{all})
46.3 % ( 42 %) Nodeslider(V{all})
28.6 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.82 0.66 0.52
2 | 167051 0.83 0.68
3 | 167194 166358 0.84
4 | 166423 166545 166429
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.82 0.65 0.52
2 | 165143 0.83 0.68
3 | 166936 166978 0.84
4 | 167146 166958 166839
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -499.14
| 2 2 1 |
| 2 |
| 2 1 2 1 1 |
| 2 1 1 2 2 1 1 2 |
| 1 2 22 1 2 1 * *1 |
| *2121 22 11 2 2* 1 * 222 11 |
|1 1 * 1 11 2 1 * 2 * 11 1 2 11 1 2|
| 2 1 21 1 21 1 1 2 12 2 2 21 2 |
| 1 2 2 2 2 2 2 1 22 2 2 1|
|2 12 1 1 22 |
| 1 1 1 |
| 2 1 |
| 2 1 1 |
| |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -503.03
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -498.22 -509.43
2 -497.96 -507.14
--------------------------------------
TOTAL -498.08 -508.83
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.490172 0.028990 0.216450 0.834828 0.464532 894.60 1046.77 1.000
r(A<->C){all} 0.138992 0.006903 0.000370 0.296134 0.126904 228.56 254.94 1.000
r(A<->G){all} 0.417974 0.017217 0.176580 0.677018 0.416337 263.62 323.31 1.003
r(A<->T){all} 0.054292 0.003038 0.000009 0.162620 0.036712 468.46 479.04 1.001
r(C<->G){all} 0.081767 0.003128 0.000311 0.184175 0.070334 523.53 640.02 1.002
r(C<->T){all} 0.259696 0.012545 0.054789 0.474981 0.248233 285.50 303.97 1.003
r(G<->T){all} 0.047278 0.001917 0.000003 0.133044 0.034882 427.70 547.92 1.001
pi(A){all} 0.266089 0.000680 0.214965 0.315388 0.265517 1206.09 1267.93 1.000
pi(C){all} 0.243173 0.000682 0.191715 0.292195 0.242894 1222.02 1361.51 1.000
pi(G){all} 0.338345 0.000805 0.287186 0.396404 0.337185 1178.53 1313.30 1.000
pi(T){all} 0.152392 0.000442 0.113976 0.195240 0.151354 1049.40 1275.20 1.000
alpha{1,2} 0.072436 0.003629 0.000129 0.172846 0.061860 1221.82 1254.52 1.000
alpha{3} 1.233273 0.398202 0.276553 2.455511 1.101590 1051.36 1224.61 1.000
pinvar{all} 0.697953 0.006217 0.535812 0.828561 0.708311 1149.13 1161.50 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
8 -- .*.**
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3001 0.999667 0.000471 0.999334 1.000000 2
7 2332 0.776815 0.012248 0.768155 0.785476 2
8 491 0.163558 0.008951 0.157229 0.169887 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.073628 0.002416 0.000053 0.167630 0.063966 1.000 2
length{all}[2] 0.016036 0.000201 0.000002 0.044007 0.012229 1.000 2
length{all}[3] 0.014074 0.000181 0.000007 0.039811 0.010250 1.000 2
length{all}[4] 0.090141 0.003288 0.003490 0.193051 0.079005 1.000 2
length{all}[5] 0.037929 0.001370 0.000004 0.106421 0.027190 1.000 2
length{all}[6] 0.212866 0.011359 0.048130 0.419474 0.192464 1.000 2
length{all}[7] 0.054246 0.001831 0.000045 0.133960 0.044049 1.001 2
length{all}[8] 0.016748 0.000253 0.000037 0.042056 0.012045 0.998 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007223
Maximum standard deviation of split frequencies = 0.012248
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C4 (4)
|----------------100----------------+
+ \------------------------------------ C5 (5)
|
| /------------------------------------ C2 (2)
\-----------------78----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/----------------- C1 (1)
|
| /--------------------- C4 (4)
|--------------------------------------------------+
+ \------- C5 (5)
|
| /--- C2 (2)
\-----------+
\-- C3 (3)
|------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (4 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 255
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sequences read..
Counting site patterns.. 0:00
53 patterns at 85 / 85 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
51728 bytes for conP
7208 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, 5), (2, 3)); MP score: 27
77592 bytes for conP, adjusted
0.058496 0.120717 0.071916 0.043760 0.035167 0.012238 0.011466 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -520.841129
Iterating by ming2
Initial: fx= 520.841129
x= 0.05850 0.12072 0.07192 0.04376 0.03517 0.01224 0.01147 0.30000 1.30000
1 h-m-p 0.0000 0.0145 45.7478 ++++YCCCC 517.190270 4 0.0043 25 | 0/9
2 h-m-p 0.0001 0.0007 138.9311 +YYYYYC 514.976515 5 0.0006 43 | 0/9
3 h-m-p 0.0002 0.0010 276.5338 +YYCYCCC 510.889683 6 0.0007 65 | 0/9
4 h-m-p 0.0001 0.0007 437.2865 +YYCCCC 506.685890 5 0.0005 86 | 0/9
5 h-m-p 0.0007 0.0036 70.7367 CYCC 505.907621 3 0.0009 103 | 0/9
6 h-m-p 0.0002 0.0011 79.7904 YCYCCC 505.263323 5 0.0006 123 | 0/9
7 h-m-p 0.0003 0.0034 187.1465 YYCCC 504.539676 4 0.0004 141 | 0/9
8 h-m-p 0.0011 0.0099 77.4775 ++ 490.770047 m 0.0099 153 | 0/9
9 h-m-p -0.0000 -0.0000 3307.9565
h-m-p: -1.19425739e-20 -5.97128696e-20 3.30795651e+03 490.770047
.. | 0/9
10 h-m-p 0.0000 0.0007 776.6625 ++YCYCCC 483.242942 5 0.0001 184 | 0/9
11 h-m-p 0.0002 0.0011 67.8168 +YYYCCC 480.749992 5 0.0008 204 | 0/9
12 h-m-p 0.0000 0.0002 674.5220 +YCYCCC 477.817151 5 0.0001 225 | 0/9
13 h-m-p 0.0000 0.0002 176.0788 YCCC 477.572532 3 0.0001 242 | 0/9
14 h-m-p 0.0002 0.0050 41.5686 +YCYCCC 476.182719 5 0.0020 263 | 0/9
15 h-m-p 0.0026 0.0128 6.0476 CC 476.166961 1 0.0009 277 | 0/9
16 h-m-p 0.0014 0.0817 3.7214 ++YCCC 476.072091 3 0.0164 296 | 0/9
17 h-m-p 0.0009 0.1712 65.7519 +CYCC 475.667427 3 0.0046 314 | 0/9
18 h-m-p 0.0014 0.0068 101.7895 CCCCC 475.413857 4 0.0016 334 | 0/9
19 h-m-p 1.6000 8.0000 0.0671 CCCC 475.304393 3 1.1968 352 | 0/9
20 h-m-p 1.6000 8.0000 0.0257 YCC 475.292266 2 0.9983 376 | 0/9
21 h-m-p 0.9507 8.0000 0.0270 YC 475.284168 1 1.6775 398 | 0/9
22 h-m-p 1.6000 8.0000 0.0097 CC 475.282712 1 1.8198 421 | 0/9
23 h-m-p 1.6000 8.0000 0.0070 C 475.282281 0 1.7657 442 | 0/9
24 h-m-p 1.6000 8.0000 0.0003 YC 475.282075 1 3.5595 464 | 0/9
25 h-m-p 0.7519 8.0000 0.0013 +C 475.281886 0 2.9514 486 | 0/9
26 h-m-p 1.6000 8.0000 0.0002 Y 475.281862 0 1.1601 507 | 0/9
27 h-m-p 0.6959 8.0000 0.0003 C 475.281862 0 1.0350 528 | 0/9
28 h-m-p 1.6000 8.0000 0.0000 Y 475.281862 0 1.0705 549 | 0/9
29 h-m-p 1.6000 8.0000 0.0000 Y 475.281862 0 2.6803 570 | 0/9
30 h-m-p 1.6000 8.0000 0.0000 -Y 475.281862 0 0.1000 592
Out..
lnL = -475.281862
593 lfun, 593 eigenQcodon, 4151 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, (4, 5), (2, 3)); MP score: 27
0.058496 0.120717 0.071916 0.043760 0.035167 0.012238 0.011466 1.734490 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.992356
np = 10
lnL0 = -495.428126
Iterating by ming2
Initial: fx= 495.428126
x= 0.05850 0.12072 0.07192 0.04376 0.03517 0.01224 0.01147 1.73449 0.57321 0.49224
1 h-m-p 0.0000 0.0172 21.6845 ++++CCCC 494.880951 3 0.0026 25 | 0/10
2 h-m-p 0.0002 0.0012 121.8995 +YYCCCC 493.749243 5 0.0008 47 | 0/10
3 h-m-p 0.0001 0.0004 394.8445 +YYYCCC 492.280671 5 0.0003 68 | 0/10
4 h-m-p 0.0000 0.0001 3568.5378 +CYYCCC 489.130339 5 0.0001 90 | 0/10
5 h-m-p 0.0001 0.0003 730.9683 YCYCCCC 487.985603 6 0.0001 113 | 0/10
6 h-m-p 0.0005 0.0027 46.7199 YCC 487.863505 2 0.0003 129 | 0/10
7 h-m-p 0.0007 0.0035 20.6224 CCCC 487.729720 3 0.0010 148 | 0/10
8 h-m-p 0.0036 0.0182 4.3946 +YCCC 487.317602 3 0.0111 167 | 0/10
9 h-m-p 0.0013 0.0064 10.8509 +CYC 486.940970 2 0.0048 184 | 0/10
10 h-m-p 0.0039 0.0197 10.8163 YCYCCC 486.077008 5 0.0099 205 | 0/10
11 h-m-p 0.0008 0.0041 7.6453 ++ 485.931142 m 0.0041 218 | 0/10
12 h-m-p 0.0000 0.0000 2.2087
h-m-p: 0.00000000e+00 0.00000000e+00 2.20870237e+00 485.931142
.. | 0/10
13 h-m-p 0.0000 0.0036 10751.0641 YYCCCYC 481.958122 6 0.0000 251 | 0/10
14 h-m-p 0.0000 0.0000 177.2734 ++ 481.943058 m 0.0000 264 | 1/10
15 h-m-p 0.0000 0.0008 75.6984 ++YCCCC 481.026891 4 0.0004 286 | 1/10
16 h-m-p 0.0005 0.0027 49.5538 CYCCCC 480.198261 5 0.0008 308 | 1/10
17 h-m-p 0.0013 0.0067 17.8854 CCC 480.156295 2 0.0003 325 | 1/10
18 h-m-p 0.0003 0.0017 15.2705 YCC 480.138858 2 0.0002 341 | 1/10
19 h-m-p 0.0062 0.4381 0.5712 ++CCCC 479.820361 3 0.1026 362 | 1/10
20 h-m-p 0.0011 0.0356 54.2418 ++YCCC 476.453231 3 0.0121 391 | 1/10
21 h-m-p 0.0113 0.0565 9.6144 -YCC 476.435752 2 0.0005 408 | 1/10
22 h-m-p 0.0160 8.0000 1.2812 ++YCYCC 475.863269 4 0.5429 429 | 1/10
23 h-m-p 1.0407 5.2034 0.0658 CCCCC 475.431698 4 1.8318 450 | 1/10
24 h-m-p 1.6000 8.0000 0.0648 CCC 475.326717 2 1.9917 476 | 1/10
25 h-m-p 1.6000 8.0000 0.0115 YCC 475.307050 2 1.1888 501 | 1/10
26 h-m-p 0.6928 8.0000 0.0197 +YC 475.289002 1 2.2446 525 | 1/10
27 h-m-p 1.6000 8.0000 0.0030 C 475.283167 0 1.5542 547 | 1/10
28 h-m-p 0.3660 8.0000 0.0127 +C 475.282404 0 1.3649 570 | 1/10
29 h-m-p 1.6000 8.0000 0.0002 YC 475.282348 1 3.1088 593 | 1/10
30 h-m-p 1.6000 8.0000 0.0001 ++ 475.282077 m 8.0000 615 | 1/10
31 h-m-p 1.5047 8.0000 0.0003 YC 475.282013 1 1.1654 638 | 1/10
32 h-m-p 0.9113 8.0000 0.0004 C 475.282011 0 1.2229 660 | 1/10
33 h-m-p 1.6000 8.0000 0.0000 Y 475.282011 0 0.9361 682 | 1/10
34 h-m-p 1.6000 8.0000 0.0000 Y 475.282011 0 0.2633 704 | 1/10
35 h-m-p 0.2591 8.0000 0.0000 --C 475.282011 0 0.0040 728
Out..
lnL = -475.282011
729 lfun, 2187 eigenQcodon, 10206 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, (4, 5), (2, 3)); MP score: 27
initial w for M2:NSpselection reset.
0.058496 0.120717 0.071916 0.043760 0.035167 0.012238 0.011466 1.734504 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.624932
np = 12
lnL0 = -499.984248
Iterating by ming2
Initial: fx= 499.984248
x= 0.05850 0.12072 0.07192 0.04376 0.03517 0.01224 0.01147 1.73450 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0378 28.5758 ++YCCC 499.780019 3 0.0006 24 | 0/12
2 h-m-p 0.0004 0.0022 36.6763 CCCC 499.523973 3 0.0007 45 | 0/12
3 h-m-p 0.0007 0.0113 35.5544 +YCCCCC 496.625700 5 0.0086 71 | 0/12
4 h-m-p 0.0000 0.0001 3247.4399 +CYC 495.259542 2 0.0000 91 | 0/12
5 h-m-p 0.0000 0.0000 2531.7180 ++ 494.456595 m 0.0000 106 | 1/12
6 h-m-p 0.0023 0.0223 10.6979 YCCCC 494.096209 4 0.0049 128 | 1/12
7 h-m-p 0.0035 0.0264 15.1271 ++ 492.047858 m 0.0264 143 | 1/12
8 h-m-p 0.0000 0.0000 88.4801
h-m-p: 1.94462169e-20 9.72310845e-20 8.84801331e+01 492.047858
.. | 1/12
9 h-m-p 0.0000 0.0015 711.2318 +YCYCCC 486.179472 5 0.0001 179 | 1/12
10 h-m-p 0.0003 0.0017 31.7108 YCYCCC 485.718743 5 0.0008 202 | 1/12
11 h-m-p 0.0006 0.0033 40.3725 YCCCC 485.174954 4 0.0012 224 | 1/12
12 h-m-p 0.0003 0.0016 60.5247 CCCC 484.982740 3 0.0004 245 | 1/12
13 h-m-p 0.0015 0.0515 14.7967 ++YYC 483.478529 2 0.0206 264 | 1/12
14 h-m-p 0.0035 0.0444 88.0086 CYC 481.991921 2 0.0038 282 | 1/12
15 h-m-p 0.0033 0.0166 52.0972 +YCYCCC 479.186403 5 0.0100 306 | 0/12
16 h-m-p 0.0003 0.0015 286.1167 CC 478.816946 1 0.0003 323 | 0/12
17 h-m-p 0.0018 0.0091 46.6694 CYCCCC 478.312731 5 0.0025 347 | 0/12
18 h-m-p 0.1978 2.2439 0.5811 +YCC 477.036682 2 1.1694 366 | 0/12
19 h-m-p 0.1074 0.5369 0.8787 ++ 476.352377 m 0.5369 393 | 1/12
20 h-m-p 0.4469 3.0338 0.4796 CCCC 476.076219 3 0.7199 426 | 1/12
21 h-m-p 0.8879 4.4397 0.3798 YCC 475.941260 2 0.5110 455 | 1/12
22 h-m-p 0.6328 8.0000 0.3068 +CCC 475.645711 2 2.2679 486 | 1/12
23 h-m-p 1.1273 5.6365 0.2347 CCCC 475.522791 3 1.5025 518 | 1/12
24 h-m-p 1.3417 8.0000 0.2628 YCCC 475.466495 3 0.8150 549 | 1/12
25 h-m-p 1.2334 8.0000 0.1736 CCC 475.437496 2 1.5079 579 | 1/12
26 h-m-p 1.2760 8.0000 0.2052 +YCCC 475.381996 3 3.2736 611 | 1/12
27 h-m-p 1.6000 8.0000 0.4026 CCC 475.322850 2 1.9227 641 | 1/12
28 h-m-p 1.6000 8.0000 0.4255 YCCC 475.301869 3 0.8409 672 | 1/12
29 h-m-p 1.0956 8.0000 0.3266 CCC 475.293867 2 1.6642 702 | 1/12
30 h-m-p 1.6000 8.0000 0.2515 YCC 475.288058 2 3.3137 731 | 1/12
31 h-m-p 1.6000 8.0000 0.3571 CCC 475.284016 2 2.4201 761 | 1/12
32 h-m-p 1.6000 8.0000 0.3402 CC 475.282886 1 2.2167 789 | 1/12
33 h-m-p 1.6000 8.0000 0.3393 YC 475.282260 1 2.9453 816 | 1/12
34 h-m-p 1.6000 8.0000 0.3675 CC 475.282038 1 1.9805 844 | 1/12
35 h-m-p 1.6000 8.0000 0.3747 YC 475.281940 1 2.4312 871 | 1/12
36 h-m-p 1.6000 8.0000 0.4095 C 475.281895 0 2.0140 897 | 1/12
37 h-m-p 1.6000 8.0000 0.3472 C 475.281876 0 2.5017 923 | 1/12
38 h-m-p 1.6000 8.0000 0.3583 C 475.281868 0 2.5178 949 | 1/12
39 h-m-p 1.6000 8.0000 0.3528 C 475.281864 0 2.5396 975 | 1/12
40 h-m-p 1.6000 8.0000 0.3564 Y 475.281863 0 2.5810 1001 | 1/12
41 h-m-p 1.6000 8.0000 0.3523 C 475.281862 0 2.4938 1027 | 1/12
42 h-m-p 1.6000 8.0000 0.3588 Y 475.281862 0 2.6795 1053 | 1/12
43 h-m-p 1.6000 8.0000 0.3507 C 475.281862 0 2.3677 1079 | 1/12
44 h-m-p 1.6000 8.0000 0.3660 Y 475.281862 0 2.9396 1105 | 1/12
45 h-m-p 1.6000 8.0000 0.3483 C 475.281862 0 2.1023 1131 | 1/12
46 h-m-p 1.6000 8.0000 0.3519 Y 475.281862 0 3.4816 1157 | 1/12
47 h-m-p 1.6000 8.0000 0.3732 C 475.281862 0 1.8898 1183 | 1/12
48 h-m-p 1.4368 8.0000 0.4909 +Y 475.281862 0 6.4288 1210 | 1/12
49 h-m-p 1.6000 8.0000 0.1098 Y 475.281862 0 0.7570 1236 | 1/12
50 h-m-p 0.1444 8.0000 0.5756 Y 475.281862 0 0.1444 1262 | 1/12
51 h-m-p 1.6000 8.0000 0.0269 -Y 475.281862 0 0.1000 1289 | 1/12
52 h-m-p 0.6420 8.0000 0.0042 -----C 475.281862 0 0.0002 1320 | 1/12
53 h-m-p 0.1808 8.0000 0.0000 -------------Y 475.281862 0 0.0000 1359
Out..
lnL = -475.281862
1360 lfun, 5440 eigenQcodon, 28560 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -485.035266 S = -464.900366 -12.325902
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:11
did 20 / 53 patterns 0:11
did 30 / 53 patterns 0:11
did 40 / 53 patterns 0:11
did 50 / 53 patterns 0:11
did 53 / 53 patterns 0:11
Time used: 0:11
Model 3: discrete
TREE # 1
(1, (4, 5), (2, 3)); MP score: 27
0.058496 0.120717 0.071916 0.043760 0.035167 0.012238 0.011466 1.734490 0.331355 0.382499 0.024760 0.061811 0.103496
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 18.390865
np = 13
lnL0 = -475.431082
Iterating by ming2
Initial: fx= 475.431082
x= 0.05850 0.12072 0.07192 0.04376 0.03517 0.01224 0.01147 1.73449 0.33136 0.38250 0.02476 0.06181 0.10350
1 h-m-p 0.0000 0.0024 17.6757 +++YCCC 475.369743 3 0.0004 26 | 0/13
2 h-m-p 0.0005 0.0039 14.5527 CC 475.338871 1 0.0004 44 | 0/13
3 h-m-p 0.0008 0.0040 8.2277 YCCC 475.329363 3 0.0004 65 | 0/13
4 h-m-p 0.0002 0.0036 13.4347 YC 475.314460 1 0.0005 82 | 0/13
5 h-m-p 0.0043 0.0900 1.5042 CC 475.310335 1 0.0040 100 | 0/13
6 h-m-p 0.0017 0.0345 3.5493 +CC 475.295716 1 0.0073 119 | 0/13
7 h-m-p 0.0015 0.0075 12.8434 C 475.285389 0 0.0015 135 | 0/13
8 h-m-p 0.0061 0.0304 2.6379 CC 475.283871 1 0.0013 153 | 0/13
9 h-m-p 0.0053 0.1414 0.6472 CC 475.283629 1 0.0016 171 | 0/13
10 h-m-p 0.0049 0.4207 0.2092 +YC 475.282897 1 0.0369 202 | 0/13
11 h-m-p 0.3596 8.0000 0.0215 YC 475.281884 1 0.7275 232 | 0/13
12 h-m-p 1.6000 8.0000 0.0022 YC 475.281863 1 0.9423 262 | 0/13
13 h-m-p 1.3240 8.0000 0.0016 Y 475.281862 0 0.5683 291 | 0/13
14 h-m-p 1.6000 8.0000 0.0000 Y 475.281862 0 1.0007 320 | 0/13
15 h-m-p 1.6000 8.0000 0.0000 C 475.281862 0 2.2784 349 | 0/13
16 h-m-p 1.6000 8.0000 0.0000 -C 475.281862 0 0.1000 379 | 0/13
17 h-m-p 0.1236 8.0000 0.0000 ----C 475.281862 0 0.0001 412
Out..
lnL = -475.281862
413 lfun, 1652 eigenQcodon, 8673 P(t)
Time used: 0:13
Model 7: beta
TREE # 1
(1, (4, 5), (2, 3)); MP score: 27
0.058496 0.120717 0.071916 0.043760 0.035167 0.012238 0.011466 1.734490 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.432479
np = 10
lnL0 = -483.470057
Iterating by ming2
Initial: fx= 483.470057
x= 0.05850 0.12072 0.07192 0.04376 0.03517 0.01224 0.01147 1.73449 0.66567 1.54913
1 h-m-p 0.0000 0.0576 22.2225 ++CYCC 483.332019 3 0.0006 22 | 0/10
2 h-m-p 0.0004 0.0022 31.9444 CCCCC 483.173418 4 0.0006 43 | 0/10
3 h-m-p 0.0004 0.0020 43.6538 YCCCC 482.933217 4 0.0008 63 | 0/10
4 h-m-p 0.0002 0.0033 200.5278 ++YYCYCCC 478.082984 6 0.0024 87 | 0/10
5 h-m-p 0.0001 0.0006 274.0855 CYCCCC 477.686136 5 0.0002 109 | 0/10
6 h-m-p 0.0137 0.0869 4.0892 CCCC 477.523039 3 0.0154 128 | 0/10
7 h-m-p 0.0028 0.0203 22.2573 YCCCC 477.232557 4 0.0053 148 | 0/10
8 h-m-p 0.0012 0.0175 101.6391 +CCCC 476.063083 3 0.0055 168 | 0/10
9 h-m-p 0.0080 0.0402 2.2220 YC 476.059255 1 0.0016 182 | 0/10
10 h-m-p 0.0098 2.7169 0.3587 +++CCCCC 475.683253 4 0.6733 206 | 0/10
11 h-m-p 1.3394 6.6969 0.0628 YCC 475.620276 2 0.9579 232 | 0/10
12 h-m-p 1.4278 8.0000 0.0421 YC 475.610782 1 1.1051 256 | 0/10
13 h-m-p 0.8356 8.0000 0.0557 +YC 475.603841 1 2.3286 281 | 0/10
14 h-m-p 1.1419 8.0000 0.1137 +YC 475.584770 1 3.4961 306 | 0/10
15 h-m-p 1.2283 8.0000 0.3235 +CCC 475.522309 2 4.5645 334 | 0/10
16 h-m-p 1.6000 8.0000 0.8663 CC 475.454880 1 2.2235 359 | 0/10
17 h-m-p 1.6000 8.0000 1.1551 CC 475.414232 1 2.3763 384 | 0/10
18 h-m-p 1.4998 8.0000 1.8302 CYC 475.381427 2 2.1466 400 | 0/10
19 h-m-p 1.6000 8.0000 2.3098 YCC 475.354946 2 2.7605 416 | 0/10
20 h-m-p 1.6000 8.0000 3.4244 CYC 475.338390 2 2.2287 432 | 0/10
21 h-m-p 1.5908 8.0000 4.7975 CCC 475.326699 2 2.0685 449 | 0/10
22 h-m-p 1.5807 8.0000 6.2781 YCC 475.316536 2 2.6657 465 | 0/10
23 h-m-p 1.0650 5.3252 8.5104 +YC 475.309062 1 3.0169 480 | 0/10
24 h-m-p 0.3335 1.6674 11.7820 ++ 475.305104 m 1.6674 493 | 1/10
25 h-m-p 0.2502 7.6345 4.4210 ---------------.. | 1/10
26 h-m-p 0.0001 0.0449 0.3794 +Y 475.305087 0 0.0002 533 | 1/10
27 h-m-p 0.0010 0.5245 0.1693 C 475.305075 0 0.0010 555 | 1/10
28 h-m-p 0.0018 0.6253 0.0913 Y 475.305071 0 0.0011 577 | 1/10
29 h-m-p 0.0038 1.9197 0.2732 -C 475.305069 0 0.0003 600 | 1/10
30 h-m-p 0.0088 4.4020 0.1306 C 475.305041 0 0.0089 622 | 1/10
31 h-m-p 0.0015 0.7667 0.8579 +C 475.304932 0 0.0053 645 | 1/10
32 h-m-p 0.0024 1.2175 4.6104 ++CC 475.300056 1 0.0442 671 | 1/10
33 h-m-p 0.0019 0.0511 105.7726 CC 475.295620 1 0.0018 686 | 1/10
34 h-m-p 1.6000 8.0000 0.0132 C 475.295578 0 0.5351 699 | 1/10
35 h-m-p 1.6000 8.0000 0.0042 Y 475.295576 0 0.8893 721 | 1/10
36 h-m-p 1.6000 8.0000 0.0002 Y 475.295576 0 0.9841 743 | 1/10
37 h-m-p 1.6000 8.0000 0.0000 Y 475.295576 0 0.7192 765
Out..
lnL = -475.295576
766 lfun, 8426 eigenQcodon, 53620 P(t)
Time used: 0:26
Model 8: beta&w>1
TREE # 1
(1, (4, 5), (2, 3)); MP score: 27
initial w for M8:NSbetaw>1 reset.
0.058496 0.120717 0.071916 0.043760 0.035167 0.012238 0.011466 1.735548 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.811095
np = 12
lnL0 = -485.468292
Iterating by ming2
Initial: fx= 485.468292
x= 0.05850 0.12072 0.07192 0.04376 0.03517 0.01224 0.01147 1.73555 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0020 64.6081 ++++ 483.337766 m 0.0020 19 | 1/12
2 h-m-p 0.0009 0.0045 25.9686 +YYCCCC 482.500192 5 0.0028 43 | 1/12
3 h-m-p 0.0012 0.0059 41.5570 +YCYCCC 480.993037 5 0.0036 67 | 1/12
4 h-m-p 0.0002 0.0012 147.4553 CYCCC 480.503575 4 0.0004 89 | 1/12
5 h-m-p 0.0153 0.0782 3.9291 YCCC 480.427169 3 0.0076 109 | 0/12
6 h-m-p 0.0008 0.0285 36.1303 CCYC 479.941179 3 0.0009 129 | 0/12
7 h-m-p 0.0072 0.0527 4.2786 YCCC 479.885902 3 0.0050 149 | 0/12
8 h-m-p 0.0051 0.1521 4.1639 +++ 478.230027 m 0.1521 165 | 1/12
9 h-m-p 0.0005 0.0023 284.9437 +CYC 477.199905 2 0.0018 184 | 1/12
10 h-m-p 0.0369 0.1846 1.0840 CCCCC 477.005185 4 0.0472 207 | 1/12
11 h-m-p 0.0016 0.0080 16.2078 ++ 476.290141 m 0.0080 222 | 2/12
12 h-m-p 0.0691 1.4712 0.6428 +CCCCC 475.930392 4 0.4116 246 | 2/12
13 h-m-p 0.3163 1.5815 0.7884 YYC 475.753291 2 0.2435 273 | 2/12
14 h-m-p 0.2602 1.3011 0.3453 CCCC 475.690796 3 0.2875 304 | 2/12
15 h-m-p 0.6134 8.0000 0.1618 CCC 475.663611 2 0.5275 333 | 2/12
16 h-m-p 0.7407 8.0000 0.1153 CCC 475.653967 2 0.6844 362 | 2/12
17 h-m-p 1.0911 8.0000 0.0723 +YC 475.636621 1 3.6610 389 | 2/12
18 h-m-p 0.6230 8.0000 0.4248 +CYC 475.569767 2 2.9538 418 | 2/12
19 h-m-p 1.6000 8.0000 0.6543 YCCC 475.493095 3 2.4065 448 | 2/12
20 h-m-p 1.6000 8.0000 0.8658 YCC 475.443759 2 2.9248 476 | 2/12
21 h-m-p 1.5854 8.0000 1.5972 CCC 475.412538 2 1.5137 505 | 2/12
22 h-m-p 1.3043 8.0000 1.8537 YCC 475.382596 2 2.3816 523 | 2/12
23 h-m-p 1.6000 8.0000 2.6600 CCC 475.360718 2 2.1430 542 | 2/12
24 h-m-p 1.4533 8.0000 3.9224 CC 475.347197 1 1.6026 559 | 2/12
25 h-m-p 1.1917 8.0000 5.2750 YCC 475.335095 2 1.8754 577 | 2/12
26 h-m-p 1.5424 8.0000 6.4140 YCC 475.324456 2 2.5652 595 | 2/12
27 h-m-p 1.0778 5.3888 8.5725 +YC 475.316913 1 2.8766 612 | 2/12
28 h-m-p 0.3641 1.8205 11.8300 ++ 475.312502 m 1.8205 627 | 3/12
29 h-m-p 0.3326 6.2775 3.7240 ---------------.. | 3/12
30 h-m-p 0.0000 0.0196 0.7827 +C 475.312437 0 0.0002 671 | 3/12
31 h-m-p 0.0005 0.2610 0.3267 Y 475.312418 0 0.0004 695 | 3/12
32 h-m-p 0.0003 0.0917 0.3885 C 475.312405 0 0.0003 719 | 3/12
33 h-m-p 0.0039 1.9280 0.0900 Y 475.312396 0 0.0028 743 | 3/12
34 h-m-p 0.0068 3.3981 0.2082 C 475.312356 0 0.0060 767 | 3/12
35 h-m-p 0.0023 1.1581 0.8409 +C 475.312109 0 0.0095 792 | 3/12
36 h-m-p 0.0012 0.5897 9.7586 ++CC 475.307129 1 0.0167 820 | 3/12
37 h-m-p 0.0018 0.0605 92.4110 YC 475.295981 1 0.0038 836 | 3/12
38 h-m-p 1.6000 8.0000 0.0296 CC 475.295735 1 0.5245 853 | 3/12
39 h-m-p 1.6000 8.0000 0.0059 YC 475.295725 1 0.9140 878 | 3/12
40 h-m-p 1.6000 8.0000 0.0005 Y 475.295725 0 0.9528 902 | 3/12
41 h-m-p 1.6000 8.0000 0.0000 Y 475.295725 0 0.8684 926 | 3/12
42 h-m-p 1.6000 8.0000 0.0000 Y 475.295725 0 0.4000 950
Out..
lnL = -475.295725
951 lfun, 11412 eigenQcodon, 73227 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -485.145401 S = -464.904507 -13.317459
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:43
did 20 / 53 patterns 0:43
did 30 / 53 patterns 0:43
did 40 / 53 patterns 0:44
did 50 / 53 patterns 0:44
did 53 / 53 patterns 0:44
Time used: 0:44
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=85
D_melanogaster_CG34423-PB MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGK
D_sechellia_CG34423-PB MFALRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
D_simulans_CG34423-PB MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
D_yakuba_CG34423-PB MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
D_erecta_CG34423-PB MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
**:*****************************:*****************
D_melanogaster_CG34423-PB MEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
D_sechellia_CG34423-PB IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
D_simulans_CG34423-PB IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
D_yakuba_CG34423-PB MEAAREEEFFHKQQKEQLKNLKTKTEPKAPEAPKK
D_erecta_CG34423-PB MEAAREEEFFHKQQKEQLKNLKAKTEPKAPEAPKK
:*********:***********:************
>D_melanogaster_CG34423-PB ATGTTTACACTGCGACGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAACG GCGGCGGCGGCGGCGGATCCATCCGGGAGGCGGGCGGTTCATTTGGCAAA ATGGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA ACTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA AGAAG >D_sechellia_CG34423-PB ATGTTTGCATTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG GGGGCGGCGGAGGCGGATCCATCCGGGAGGCGGGCGGTTCCTTTGGCAAA ATAGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA GCTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA AGAAG >D_simulans_CG34423-PB ATGTTTACATTGCGGCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG GGGGCGGCGGAGGCGGATCCATCCGGGAGGCGGGCGGTTCCTTTGGCAAA ATAGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA GCTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA AGAAG >D_yakuba_CG34423-PB ATGTTTACACTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA GCACTTGAAAATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGAAAGG GGGGCGGTGGCGGGGGATCCATTCGGGAGGCGGGCGGGTCCTTTGGCAAA ATGGAGGCTGCCCGCGAGGAGGAGTTCTTCCATAAGCAGCAAAAGGAGCA GCTGAAGAACCTGAAGACGAAAACGGAACCCAAGGCACCAGAGGCTCCCA AGAAG >D_erecta_CG34423-PB ATGTTTACACTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA GCACTTGAAAATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG GTGGCGGTGGCGGAGGATCCATTCGGGAGGCAGGCGGATCCTTTGGCAAA ATGGAGGCTGCTCGCGAGGAGGAGTTCTTCCATAAGCAGCAAAAGGAGCA GCTGAAGAACCTGAAGGCCAAGACGGAACCCAAGGCACCAGAGGCTCCCA AGAAG
>D_melanogaster_CG34423-PB MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGK MEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK >D_sechellia_CG34423-PB MFALRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK >D_simulans_CG34423-PB MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK >D_yakuba_CG34423-PB MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK MEAAREEEFFHKQQKEQLKNLKTKTEPKAPEAPKK >D_erecta_CG34423-PB MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK MEAAREEEFFHKQQKEQLKNLKAKTEPKAPEAPKK
#NEXUS
[ID: 6104885926]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_CG34423-PB
D_sechellia_CG34423-PB
D_simulans_CG34423-PB
D_yakuba_CG34423-PB
D_erecta_CG34423-PB
;
end;
begin trees;
translate
1 D_melanogaster_CG34423-PB,
2 D_sechellia_CG34423-PB,
3 D_simulans_CG34423-PB,
4 D_yakuba_CG34423-PB,
5 D_erecta_CG34423-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06396634,(4:0.07900539,5:0.02718985)1.000:0.1924635,(2:0.01222893,3:0.01025049)0.777:0.04404901);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06396634,(4:0.07900539,5:0.02718985):0.1924635,(2:0.01222893,3:0.01025049):0.04404901);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -498.22 -509.43
2 -497.96 -507.14
--------------------------------------
TOTAL -498.08 -508.83
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.490172 0.028990 0.216450 0.834828 0.464532 894.60 1046.77 1.000
r(A<->C){all} 0.138992 0.006903 0.000370 0.296134 0.126904 228.56 254.94 1.000
r(A<->G){all} 0.417974 0.017217 0.176580 0.677018 0.416337 263.62 323.31 1.003
r(A<->T){all} 0.054292 0.003038 0.000009 0.162620 0.036712 468.46 479.04 1.001
r(C<->G){all} 0.081767 0.003128 0.000311 0.184175 0.070334 523.53 640.02 1.002
r(C<->T){all} 0.259696 0.012545 0.054789 0.474981 0.248233 285.50 303.97 1.003
r(G<->T){all} 0.047278 0.001917 0.000003 0.133044 0.034882 427.70 547.92 1.001
pi(A){all} 0.266089 0.000680 0.214965 0.315388 0.265517 1206.09 1267.93 1.000
pi(C){all} 0.243173 0.000682 0.191715 0.292195 0.242894 1222.02 1361.51 1.000
pi(G){all} 0.338345 0.000805 0.287186 0.396404 0.337185 1178.53 1313.30 1.000
pi(T){all} 0.152392 0.000442 0.113976 0.195240 0.151354 1049.40 1275.20 1.000
alpha{1,2} 0.072436 0.003629 0.000129 0.172846 0.061860 1221.82 1254.52 1.000
alpha{3} 1.233273 0.398202 0.276553 2.455511 1.101590 1051.36 1224.61 1.000
pinvar{all} 0.697953 0.006217 0.535812 0.828561 0.708311 1149.13 1161.50 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/132/CG34423-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 85
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 | Ser TCT 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 | Cys TGT 0 0 0 0 0
TTC 3 3 3 3 3 | TCC 1 2 2 2 2 | TAC 1 1 1 0 0 | TGC 0 0 0 0 0
Leu TTA 0 0 0 0 0 | TCA 1 0 0 0 0 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 1 2 2 1 1 | TCG 1 1 1 1 1 | TAG 0 0 0 0 0 | Trp TGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 | Pro CCT 1 1 1 0 0 | His CAT 0 0 0 1 1 | Arg CGT 0 0 0 0 0
CTC 0 0 0 0 0 | CCC 2 2 2 3 3 | CAC 1 1 1 1 1 | CGC 2 3 2 3 3
CTA 0 0 0 0 0 | CCA 1 1 1 1 1 | Gln CAA 2 1 1 1 1 | CGA 2 1 1 1 1
CTG 4 3 3 4 4 | CCG 0 0 0 0 0 | CAG 5 6 6 6 6 | CGG 1 1 2 1 1
----------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 2 2 | Thr ACT 0 0 0 0 0 | Asn AAT 0 0 0 0 0 | Ser AGT 2 2 2 2 2
ATC 2 2 2 1 1 | ACC 1 1 1 0 0 | AAC 2 1 1 1 1 | AGC 0 0 0 0 0
ATA 0 1 1 0 0 | ACA 1 0 1 1 1 | Lys AAA 1 1 1 3 2 | Arg AGA 0 0 0 0 0
Met ATG 3 2 2 3 3 | ACG 1 1 1 2 1 | AAG 10 11 11 9 10 | AGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 | Ala GCT 3 3 3 2 3 | Asp GAT 0 0 0 0 0 | Gly GGT 1 1 1 1 2
GTC 0 0 0 0 0 | GCC 1 1 1 2 2 | GAC 0 0 0 0 0 | GGC 9 7 7 5 6
GTA 0 0 0 0 0 | GCA 1 2 1 1 2 | Glu GAA 1 1 1 2 2 | GGA 3 4 4 4 5
GTG 0 0 0 0 0 | GCG 1 1 1 1 0 | GAG 8 8 8 7 7 | GGG 0 1 1 3 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG34423-PB
position 1: T:0.14118 C:0.24706 A:0.28235 G:0.32941
position 2: T:0.18824 C:0.18824 A:0.37647 G:0.24706
position 3: T:0.12941 C:0.29412 A:0.15294 G:0.42353
Average T:0.15294 C:0.24314 A:0.27059 G:0.33333
#2: D_sechellia_CG34423-PB
position 1: T:0.15294 C:0.23529 A:0.27059 G:0.34118
position 2: T:0.18824 C:0.18824 A:0.37647 G:0.24706
position 3: T:0.12941 C:0.28235 A:0.14118 G:0.44706
Average T:0.15686 C:0.23529 A:0.26275 G:0.34510
#3: D_simulans_CG34423-PB
position 1: T:0.15294 C:0.23529 A:0.28235 G:0.32941
position 2: T:0.18824 C:0.18824 A:0.37647 G:0.24706
position 3: T:0.12941 C:0.27059 A:0.14118 G:0.45882
Average T:0.15686 C:0.23137 A:0.26667 G:0.34510
#4: D_yakuba_CG34423-PB
position 1: T:0.12941 C:0.25882 A:0.28235 G:0.32941
position 2: T:0.18824 C:0.18824 A:0.37647 G:0.24706
position 3: T:0.12941 C:0.24706 A:0.16471 G:0.45882
Average T:0.14902 C:0.23137 A:0.27451 G:0.34510
#5: D_erecta_CG34423-PB
position 1: T:0.12941 C:0.25882 A:0.27059 G:0.34118
position 2: T:0.18824 C:0.18824 A:0.37647 G:0.24706
position 3: T:0.15294 C:0.25882 A:0.17647 G:0.41176
Average T:0.15686 C:0.23529 A:0.27451 G:0.33333
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 10 | Ser S TCT 0 | Tyr Y TAT 5 | Cys C TGT 0
TTC 15 | TCC 9 | TAC 3 | TGC 0
Leu L TTA 0 | TCA 1 | *** * TAA 0 | *** * TGA 0
TTG 7 | TCG 5 | TAG 0 | Trp W TGG 5
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 3 | His H CAT 2 | Arg R CGT 0
CTC 0 | CCC 12 | CAC 5 | CGC 13
CTA 0 | CCA 5 | Gln Q CAA 6 | CGA 6
CTG 18 | CCG 0 | CAG 29 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 7 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 10
ATC 8 | ACC 3 | AAC 6 | AGC 0
ATA 2 | ACA 4 | Lys K AAA 8 | Arg R AGA 0
Met M ATG 13 | ACG 6 | AAG 51 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 14 | Asp D GAT 0 | Gly G GGT 6
GTC 0 | GCC 7 | GAC 0 | GGC 34
GTA 0 | GCA 7 | Glu E GAA 7 | GGA 20
GTG 0 | GCG 4 | GAG 38 | GGG 5
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14118 C:0.24706 A:0.27765 G:0.33412
position 2: T:0.18824 C:0.18824 A:0.37647 G:0.24706
position 3: T:0.13412 C:0.27059 A:0.15529 G:0.44000
Average T:0.15451 C:0.23529 A:0.26980 G:0.34039
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG34423-PB
D_sechellia_CG34423-PB 0.1418 (0.0155 0.1091)
D_simulans_CG34423-PB 0.0946 (0.0103 0.1088) 0.2991 (0.0051 0.0171)
D_yakuba_CG34423-PB 0.0305 (0.0103 0.3369) 0.0539 (0.0154 0.2866) 0.0331 (0.0103 0.3108)
D_erecta_CG34423-PB 0.0593 (0.0155 0.2609) 0.0868 (0.0207 0.2381) 0.0593 (0.0155 0.2609) 0.0340 (0.0051 0.1504)
Model 0: one-ratio
TREE # 1: (1, (4, 5), (2, 3)); MP score: 27
lnL(ntime: 7 np: 9): -475.281862 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.062179 0.125485 0.068751 0.045854 0.041540 0.013867 0.010342 1.734490 0.049520
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.36802
(1: 0.062179, (4: 0.068751, 5: 0.045854): 0.125485, (2: 0.013867, 3: 0.010342): 0.041540);
(D_melanogaster_CG34423-PB: 0.062179, (D_yakuba_CG34423-PB: 0.068751, D_erecta_CG34423-PB: 0.045854): 0.125485, (D_sechellia_CG34423-PB: 0.013867, D_simulans_CG34423-PB: 0.010342): 0.041540);
Detailed output identifying parameters
kappa (ts/tv) = 1.73449
omega (dN/dS) = 0.04952
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.062 203.2 51.8 0.0495 0.0042 0.0855 0.9 4.4
6..7 0.125 203.2 51.8 0.0495 0.0085 0.1725 1.7 8.9
7..4 0.069 203.2 51.8 0.0495 0.0047 0.0945 1.0 4.9
7..5 0.046 203.2 51.8 0.0495 0.0031 0.0630 0.6 3.3
6..8 0.042 203.2 51.8 0.0495 0.0028 0.0571 0.6 3.0
8..2 0.014 203.2 51.8 0.0495 0.0009 0.0191 0.2 1.0
8..3 0.010 203.2 51.8 0.0495 0.0007 0.0142 0.1 0.7
tree length for dN: 0.0250
tree length for dS: 0.5059
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 27
lnL(ntime: 7 np: 10): -475.282011 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.062180 0.125487 0.068752 0.045855 0.041541 0.013867 0.010342 1.734504 0.999990 0.049517
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.36802
(1: 0.062180, (4: 0.068752, 5: 0.045855): 0.125487, (2: 0.013867, 3: 0.010342): 0.041541);
(D_melanogaster_CG34423-PB: 0.062180, (D_yakuba_CG34423-PB: 0.068752, D_erecta_CG34423-PB: 0.045855): 0.125487, (D_sechellia_CG34423-PB: 0.013867, D_simulans_CG34423-PB: 0.010342): 0.041541);
Detailed output identifying parameters
kappa (ts/tv) = 1.73450
dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.04952 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.062 203.2 51.8 0.0495 0.0042 0.0855 0.9 4.4
6..7 0.125 203.2 51.8 0.0495 0.0085 0.1725 1.7 8.9
7..4 0.069 203.2 51.8 0.0495 0.0047 0.0945 1.0 4.9
7..5 0.046 203.2 51.8 0.0495 0.0031 0.0630 0.6 3.3
6..8 0.042 203.2 51.8 0.0495 0.0028 0.0571 0.6 3.0
8..2 0.014 203.2 51.8 0.0495 0.0009 0.0191 0.2 1.0
8..3 0.010 203.2 51.8 0.0495 0.0007 0.0142 0.1 0.7
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 27
lnL(ntime: 7 np: 12): -475.281862 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.062179 0.125485 0.068751 0.045855 0.041540 0.013867 0.010342 1.734490 1.000000 0.000000 0.049520 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.36802
(1: 0.062179, (4: 0.068751, 5: 0.045855): 0.125485, (2: 0.013867, 3: 0.010342): 0.041540);
(D_melanogaster_CG34423-PB: 0.062179, (D_yakuba_CG34423-PB: 0.068751, D_erecta_CG34423-PB: 0.045855): 0.125485, (D_sechellia_CG34423-PB: 0.013867, D_simulans_CG34423-PB: 0.010342): 0.041540);
Detailed output identifying parameters
kappa (ts/tv) = 1.73449
dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.04952 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.062 203.2 51.8 0.0495 0.0042 0.0855 0.9 4.4
6..7 0.125 203.2 51.8 0.0495 0.0085 0.1725 1.7 8.9
7..4 0.069 203.2 51.8 0.0495 0.0047 0.0945 1.0 4.9
7..5 0.046 203.2 51.8 0.0495 0.0031 0.0630 0.6 3.3
6..8 0.042 203.2 51.8 0.0495 0.0028 0.0571 0.6 3.0
8..2 0.014 203.2 51.8 0.0495 0.0009 0.0191 0.2 1.0
8..3 0.010 203.2 51.8 0.0495 0.0007 0.0142 0.1 0.7
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG34423-PB)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.996 0.004 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.273 0.155 0.109 0.087 0.075 0.067 0.062 0.059 0.057 0.056
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.028
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.035 0.934
sum of density on p0-p1 = 1.000000
Time used: 0:11
Model 3: discrete (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 27
lnL(ntime: 7 np: 13): -475.281862 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.062179 0.125485 0.068751 0.045855 0.041540 0.013867 0.010342 1.734490 0.365130 0.377239 0.049520 0.049520 0.049520
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.36802
(1: 0.062179, (4: 0.068751, 5: 0.045855): 0.125485, (2: 0.013867, 3: 0.010342): 0.041540);
(D_melanogaster_CG34423-PB: 0.062179, (D_yakuba_CG34423-PB: 0.068751, D_erecta_CG34423-PB: 0.045855): 0.125485, (D_sechellia_CG34423-PB: 0.013867, D_simulans_CG34423-PB: 0.010342): 0.041540);
Detailed output identifying parameters
kappa (ts/tv) = 1.73449
dN/dS (w) for site classes (K=3)
p: 0.36513 0.37724 0.25763
w: 0.04952 0.04952 0.04952
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.062 203.2 51.8 0.0495 0.0042 0.0855 0.9 4.4
6..7 0.125 203.2 51.8 0.0495 0.0085 0.1725 1.7 8.9
7..4 0.069 203.2 51.8 0.0495 0.0047 0.0945 1.0 4.9
7..5 0.046 203.2 51.8 0.0495 0.0031 0.0630 0.6 3.3
6..8 0.042 203.2 51.8 0.0495 0.0028 0.0571 0.6 3.0
8..2 0.014 203.2 51.8 0.0495 0.0009 0.0191 0.2 1.0
8..3 0.010 203.2 51.8 0.0495 0.0007 0.0142 0.1 0.7
Naive Empirical Bayes (NEB) analysis
Time used: 0:13
Model 7: beta (10 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 27
lnL(ntime: 7 np: 10): -475.295576 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.062210 0.125565 0.068786 0.045846 0.041551 0.013873 0.010349 1.735548 5.231802 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.36818
(1: 0.062210, (4: 0.068786, 5: 0.045846): 0.125565, (2: 0.013873, 3: 0.010349): 0.041551);
(D_melanogaster_CG34423-PB: 0.062210, (D_yakuba_CG34423-PB: 0.068786, D_erecta_CG34423-PB: 0.045846): 0.125565, (D_sechellia_CG34423-PB: 0.013873, D_simulans_CG34423-PB: 0.010349): 0.041551);
Detailed output identifying parameters
kappa (ts/tv) = 1.73555
Parameters in M7 (beta):
p = 5.23180 q = 99.00000
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.02071 0.02887 0.03464 0.03977 0.04478 0.04999 0.05576 0.06266 0.07200 0.08944
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.062 203.2 51.8 0.0499 0.0043 0.0854 0.9 4.4
6..7 0.126 203.2 51.8 0.0499 0.0086 0.1724 1.7 8.9
7..4 0.069 203.2 51.8 0.0499 0.0047 0.0944 1.0 4.9
7..5 0.046 203.2 51.8 0.0499 0.0031 0.0629 0.6 3.3
6..8 0.042 203.2 51.8 0.0499 0.0028 0.0570 0.6 3.0
8..2 0.014 203.2 51.8 0.0499 0.0009 0.0190 0.2 1.0
8..3 0.010 203.2 51.8 0.0499 0.0007 0.0142 0.1 0.7
Time used: 0:26
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 27
lnL(ntime: 7 np: 12): -475.295725 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.062211 0.125567 0.068787 0.045846 0.041552 0.013873 0.010349 1.735563 0.999990 5.231457 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.36818
(1: 0.062211, (4: 0.068787, 5: 0.045846): 0.125567, (2: 0.013873, 3: 0.010349): 0.041552);
(D_melanogaster_CG34423-PB: 0.062211, (D_yakuba_CG34423-PB: 0.068787, D_erecta_CG34423-PB: 0.045846): 0.125567, (D_sechellia_CG34423-PB: 0.013873, D_simulans_CG34423-PB: 0.010349): 0.041552);
Detailed output identifying parameters
kappa (ts/tv) = 1.73556
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 5.23146 q = 99.00000
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.02071 0.02887 0.03464 0.03977 0.04477 0.04999 0.05576 0.06266 0.07199 0.08944 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.062 203.2 51.8 0.0499 0.0043 0.0854 0.9 4.4
6..7 0.126 203.2 51.8 0.0499 0.0086 0.1724 1.7 8.9
7..4 0.069 203.2 51.8 0.0499 0.0047 0.0944 1.0 4.9
7..5 0.046 203.2 51.8 0.0499 0.0031 0.0629 0.6 3.3
6..8 0.042 203.2 51.8 0.0499 0.0028 0.0570 0.6 3.0
8..2 0.014 203.2 51.8 0.0499 0.0009 0.0190 0.2 1.0
8..3 0.010 203.2 51.8 0.0499 0.0007 0.0142 0.1 0.7
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG34423-PB)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.998
p : 0.981 0.018 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.002 0.015 0.043 0.084 0.133 0.186 0.241 0.296
ws: 0.350 0.163 0.103 0.077 0.064 0.056 0.051 0.048 0.046 0.044
Time used: 0:44
Model 1: NearlyNeutral -475.282011 Model 2: PositiveSelection -475.281862 Model 0: one-ratio -475.281862 Model 3: discrete -475.281862 Model 7: beta -475.295576 Model 8: beta&w>1 -475.295725 Model 0 vs 1 2.980000000434302E-4 Model 2 vs 1 2.980000000434302E-4 Model 8 vs 7 2.980000000434302E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
