--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Nov 03 10:36:23 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/132/CG34423-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -498.22          -509.43
2       -497.96          -507.14
--------------------------------------
TOTAL     -498.08          -508.83
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.490172    0.028990    0.216450    0.834828    0.464532    894.60   1046.77    1.000
r(A<->C){all}   0.138992    0.006903    0.000370    0.296134    0.126904    228.56    254.94    1.000
r(A<->G){all}   0.417974    0.017217    0.176580    0.677018    0.416337    263.62    323.31    1.003
r(A<->T){all}   0.054292    0.003038    0.000009    0.162620    0.036712    468.46    479.04    1.001
r(C<->G){all}   0.081767    0.003128    0.000311    0.184175    0.070334    523.53    640.02    1.002
r(C<->T){all}   0.259696    0.012545    0.054789    0.474981    0.248233    285.50    303.97    1.003
r(G<->T){all}   0.047278    0.001917    0.000003    0.133044    0.034882    427.70    547.92    1.001
pi(A){all}      0.266089    0.000680    0.214965    0.315388    0.265517   1206.09   1267.93    1.000
pi(C){all}      0.243173    0.000682    0.191715    0.292195    0.242894   1222.02   1361.51    1.000
pi(G){all}      0.338345    0.000805    0.287186    0.396404    0.337185   1178.53   1313.30    1.000
pi(T){all}      0.152392    0.000442    0.113976    0.195240    0.151354   1049.40   1275.20    1.000
alpha{1,2}      0.072436    0.003629    0.000129    0.172846    0.061860   1221.82   1254.52    1.000
alpha{3}        1.233273    0.398202    0.276553    2.455511    1.101590   1051.36   1224.61    1.000
pinvar{all}     0.697953    0.006217    0.535812    0.828561    0.708311   1149.13   1161.50    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-475.282011
Model 2: PositiveSelection	-475.281862
Model 0: one-ratio	-475.281862
Model 3: discrete	-475.281862
Model 7: beta	-475.295576
Model 8: beta&w>1	-475.295725


Model 0 vs 1	2.980000000434302E-4

Model 2 vs 1	2.980000000434302E-4

Model 8 vs 7	2.980000000434302E-4
>C1
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGK
MEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C2
MFALRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C3
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C4
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKTKTEPKAPEAPKK
>C5
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKAKTEPKAPEAPKK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=85 

C1              MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGK
C2              MFALRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
C3              MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
C4              MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
C5              MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
                **:*****************************:*****************

C1              MEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
C2              IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
C3              IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
C4              MEAAREEEFFHKQQKEQLKNLKTKTEPKAPEAPKK
C5              MEAAREEEFFHKQQKEQLKNLKAKTEPKAPEAPKK
                :*********:***********:************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   85 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   85 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1700]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [1700]--->[1700]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/132/CG34423-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.240 Mb, Max= 30.404 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGK
MEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C2
MFALRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C3
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C4
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKTKTEPKAPEAPKK
>C5
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKAKTEPKAPEAPKK

FORMAT of file /tmp/tmp3965904905160445378aln Not Supported[FATAL:T-COFFEE]
>C1
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGK
MEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C2
MFALRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C3
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C4
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKTKTEPKAPEAPKK
>C5
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKAKTEPKAPEAPKK
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:85 S:100 BS:85
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 96.47 C1	 C2	 96.47
TOP	    1    0	 96.47 C2	 C1	 96.47
BOT	    0    2	 97.65 C1	 C3	 97.65
TOP	    2    0	 97.65 C3	 C1	 97.65
BOT	    0    3	 97.65 C1	 C4	 97.65
TOP	    3    0	 97.65 C4	 C1	 97.65
BOT	    0    4	 96.47 C1	 C5	 96.47
TOP	    4    0	 96.47 C5	 C1	 96.47
BOT	    1    2	 98.82 C2	 C3	 98.82
TOP	    2    1	 98.82 C3	 C2	 98.82
BOT	    1    3	 96.47 C2	 C4	 96.47
TOP	    3    1	 96.47 C4	 C2	 96.47
BOT	    1    4	 95.29 C2	 C5	 95.29
TOP	    4    1	 95.29 C5	 C2	 95.29
BOT	    2    3	 97.65 C3	 C4	 97.65
TOP	    3    2	 97.65 C4	 C3	 97.65
BOT	    2    4	 96.47 C3	 C5	 96.47
TOP	    4    2	 96.47 C5	 C3	 96.47
BOT	    3    4	 98.82 C4	 C5	 98.82
TOP	    4    3	 98.82 C5	 C4	 98.82
AVG	 0	 C1	  *	 97.06
AVG	 1	 C2	  *	 96.76
AVG	 2	 C3	  *	 97.65
AVG	 3	 C4	  *	 97.65
AVG	 4	 C5	  *	 96.76
TOT	 TOT	  *	 97.18
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTTTACACTGCGACGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
C2              ATGTTTGCATTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
C3              ATGTTTACATTGCGGCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
C4              ATGTTTACACTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
C5              ATGTTTACACTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
                ******.** **** ***********************************

C1              GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAACG
C2              GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG
C3              GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG
C4              GCACTTGAAAATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGAAAGG
C5              GCACTTGAAAATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG
                *********.***********************************.** *

C1              GCGGCGGCGGCGGCGGATCCATCCGGGAGGCGGGCGGTTCATTTGGCAAA
C2              GGGGCGGCGGAGGCGGATCCATCCGGGAGGCGGGCGGTTCCTTTGGCAAA
C3              GGGGCGGCGGAGGCGGATCCATCCGGGAGGCGGGCGGTTCCTTTGGCAAA
C4              GGGGCGGTGGCGGGGGATCCATTCGGGAGGCGGGCGGGTCCTTTGGCAAA
C5              GTGGCGGTGGCGGAGGATCCATTCGGGAGGCAGGCGGATCCTTTGGCAAA
                * ***** **.** ******** ********.***** **.*********

C1              ATGGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA
C2              ATAGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA
C3              ATAGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA
C4              ATGGAGGCTGCCCGCGAGGAGGAGTTCTTCCATAAGCAGCAAAAGGAGCA
C5              ATGGAGGCTGCTCGCGAGGAGGAGTTCTTCCATAAGCAGCAAAAGGAGCA
                **.******** ****************** * *****************

C1              ACTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA
C2              GCTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA
C3              GCTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA
C4              GCTGAAGAACCTGAAGACGAAAACGGAACCCAAGGCACCAGAGGCTCCCA
C5              GCTGAAGAACCTGAAGGCCAAGACGGAACCCAAGGCACCAGAGGCTCCCA
                .***************.* **.*****.** *******************

C1              AGAAG
C2              AGAAG
C3              AGAAG
C4              AGAAG
C5              AGAAG
                *****



>C1
ATGTTTACACTGCGACGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAACG
GCGGCGGCGGCGGCGGATCCATCCGGGAGGCGGGCGGTTCATTTGGCAAA
ATGGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA
ACTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA
AGAAG
>C2
ATGTTTGCATTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG
GGGGCGGCGGAGGCGGATCCATCCGGGAGGCGGGCGGTTCCTTTGGCAAA
ATAGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA
GCTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA
AGAAG
>C3
ATGTTTACATTGCGGCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
GCACTTGAAGATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG
GGGGCGGCGGAGGCGGATCCATCCGGGAGGCGGGCGGTTCCTTTGGCAAA
ATAGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAAGGAGCA
GCTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGGCTCCCA
AGAAG
>C4
ATGTTTACACTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
GCACTTGAAAATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGAAAGG
GGGGCGGTGGCGGGGGATCCATTCGGGAGGCGGGCGGGTCCTTTGGCAAA
ATGGAGGCTGCCCGCGAGGAGGAGTTCTTCCATAAGCAGCAAAAGGAGCA
GCTGAAGAACCTGAAGACGAAAACGGAACCCAAGGCACCAGAGGCTCCCA
AGAAG
>C5
ATGTTTACACTGCGCCGATTCAGTCAGCGCTGGTATCCCAAGCAGATTCA
GCACTTGAAAATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCGGCAAGG
GTGGCGGTGGCGGAGGATCCATTCGGGAGGCAGGCGGATCCTTTGGCAAA
ATGGAGGCTGCTCGCGAGGAGGAGTTCTTCCATAAGCAGCAAAAGGAGCA
GCTGAAGAACCTGAAGGCCAAGACGGAACCCAAGGCACCAGAGGCTCCCA
AGAAG
>C1
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGK
MEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C2
MFALRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C3
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
IEAAREEEFFYKQQKEQLKNLKTKTEPKAPEAPKK
>C4
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKTKTEPKAPEAPKK
>C5
MFTLRRFSQRWYPKQIQHLKMSQIGELGSGAGKGGGGGGSIREAGGSFGK
MEAAREEEFFHKQQKEQLKNLKAKTEPKAPEAPKK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 255 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1478169239
      Setting output file names to "/opt/ADOPS/132/CG34423-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1461126660
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 6104885926
      Seed = 1833019423
      Swapseed = 1478169239
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 8 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 21 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -650.490860 -- -25.624409
         Chain 2 -- -623.554495 -- -25.624409
         Chain 3 -- -635.101925 -- -25.624409
         Chain 4 -- -647.631498 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -635.101925 -- -25.624409
         Chain 2 -- -635.101925 -- -25.624409
         Chain 3 -- -650.490860 -- -25.624409
         Chain 4 -- -635.101925 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-650.491] (-623.554) (-635.102) (-647.631) * [-635.102] (-635.102) (-650.491) (-635.102) 
        500 -- (-510.217) (-518.474) (-519.287) [-510.269] * (-513.901) (-512.259) [-513.778] (-517.039) -- 0:00:00
       1000 -- (-512.609) (-516.030) [-512.471] (-518.281) * (-513.886) [-510.862] (-508.847) (-517.338) -- 0:00:00
       1500 -- [-506.431] (-513.897) (-515.923) (-517.905) * (-513.332) (-516.418) (-516.150) [-510.758] -- 0:11:05
       2000 -- (-509.431) [-508.298] (-513.835) (-511.860) * (-514.311) [-514.879] (-511.125) (-509.087) -- 0:08:19
       2500 -- (-507.915) (-512.971) (-508.238) [-511.040] * [-509.710] (-518.229) (-511.155) (-510.358) -- 0:06:39
       3000 -- (-508.801) [-507.107] (-509.159) (-510.069) * (-514.965) (-514.892) (-511.036) [-507.545] -- 0:05:32
       3500 -- (-505.368) [-506.199] (-509.958) (-509.915) * (-511.011) [-513.369] (-514.545) (-507.571) -- 0:04:44
       4000 -- [-505.085] (-512.481) (-505.356) (-507.156) * (-509.257) (-510.902) (-511.607) [-512.264] -- 0:04:09
       4500 -- (-503.376) (-515.078) [-512.380] (-516.931) * (-521.558) (-509.092) (-507.248) [-513.570] -- 0:03:41
       5000 -- (-502.204) (-508.777) [-506.224] (-519.364) * (-509.564) (-515.403) [-506.409] (-509.900) -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-507.963) [-503.754] (-509.901) (-512.436) * [-507.009] (-510.162) (-505.522) (-514.682) -- 0:03:00
       6000 -- (-501.835) [-508.714] (-507.489) (-512.086) * (-510.221) (-512.721) [-502.747] (-509.804) -- 0:02:45
       6500 -- (-501.132) (-509.765) (-508.767) [-508.441] * [-502.831] (-514.034) (-504.532) (-510.566) -- 0:02:32
       7000 -- (-507.997) [-501.814] (-512.705) (-512.012) * (-502.928) (-510.215) [-502.060] (-511.580) -- 0:02:21
       7500 -- (-504.285) (-506.144) [-510.160] (-515.603) * (-500.334) (-512.366) (-509.282) [-511.234] -- 0:04:24
       8000 -- (-503.859) (-507.314) [-506.077] (-523.225) * [-501.702] (-512.565) (-500.906) (-507.133) -- 0:04:08
       8500 -- (-497.536) (-504.920) [-505.549] (-519.224) * [-499.028] (-515.869) (-503.678) (-510.507) -- 0:03:53
       9000 -- (-498.973) [-501.127] (-505.078) (-508.640) * (-501.094) (-513.581) [-499.810] (-503.381) -- 0:03:40
       9500 -- [-501.918] (-506.756) (-501.513) (-510.005) * (-500.851) (-515.911) (-502.004) [-506.708] -- 0:03:28
      10000 -- (-501.144) (-504.818) [-504.817] (-506.595) * [-502.209] (-509.376) (-504.872) (-511.377) -- 0:03:18

      Average standard deviation of split frequencies: 0.022097

      10500 -- [-497.584] (-503.429) (-505.132) (-506.019) * [-505.966] (-510.408) (-503.901) (-508.849) -- 0:03:08
      11000 -- (-500.103) [-499.209] (-504.344) (-504.245) * (-502.854) (-510.847) [-499.652] (-502.390) -- 0:02:59
      11500 -- (-500.478) [-499.784] (-505.705) (-503.787) * [-501.957] (-508.277) (-500.016) (-510.068) -- 0:02:51
      12000 -- [-504.969] (-502.920) (-507.300) (-510.955) * (-509.188) (-510.900) (-499.832) [-505.179] -- 0:02:44
      12500 -- (-503.739) (-504.991) [-505.410] (-503.221) * (-503.943) (-510.300) [-497.299] (-505.288) -- 0:02:38
      13000 -- [-501.980] (-503.595) (-507.592) (-509.037) * [-501.182] (-512.481) (-507.930) (-510.008) -- 0:02:31
      13500 -- (-503.791) (-507.068) (-507.188) [-508.499] * (-500.370) [-500.116] (-501.748) (-507.617) -- 0:02:26
      14000 -- (-500.245) [-498.333] (-498.687) (-502.724) * (-499.109) [-499.950] (-506.600) (-505.826) -- 0:02:20
      14500 -- (-504.510) [-497.916] (-502.619) (-506.679) * [-498.378] (-503.302) (-501.477) (-505.024) -- 0:02:15
      15000 -- (-500.893) (-502.484) [-498.250] (-507.012) * (-497.451) (-498.142) [-500.490] (-505.940) -- 0:02:11

      Average standard deviation of split frequencies: 0.019642

      15500 -- [-500.119] (-500.671) (-501.043) (-505.175) * (-502.254) [-505.906] (-503.276) (-511.799) -- 0:02:07
      16000 -- [-499.135] (-498.964) (-504.983) (-502.649) * (-504.868) (-501.556) [-501.222] (-504.034) -- 0:02:03
      16500 -- (-501.965) (-498.847) [-500.349] (-502.612) * [-502.628] (-504.594) (-500.293) (-504.732) -- 0:01:59
      17000 -- [-497.487] (-504.198) (-503.251) (-505.767) * [-503.276] (-502.593) (-507.794) (-505.427) -- 0:02:53
      17500 -- (-497.836) [-503.494] (-508.477) (-502.870) * (-499.865) [-505.540] (-501.656) (-508.034) -- 0:02:48
      18000 -- [-498.199] (-502.901) (-500.902) (-503.040) * (-509.115) (-506.450) [-500.266] (-501.127) -- 0:02:43
      18500 -- (-506.149) [-503.377] (-500.628) (-501.313) * [-502.262] (-512.555) (-499.111) (-502.531) -- 0:02:39
      19000 -- [-499.176] (-507.326) (-511.718) (-500.296) * (-499.167) (-507.150) [-503.385] (-496.714) -- 0:02:34
      19500 -- (-501.738) [-502.259] (-502.292) (-503.186) * (-501.246) (-506.236) (-501.108) [-499.316] -- 0:02:30
      20000 -- [-498.837] (-505.590) (-504.250) (-505.039) * (-500.417) (-509.357) (-500.888) [-501.011] -- 0:02:27

      Average standard deviation of split frequencies: 0.060826

      20500 -- (-498.637) (-500.049) [-499.585] (-505.398) * [-495.582] (-508.923) (-511.770) (-497.735) -- 0:02:23
      21000 -- (-504.003) [-501.104] (-501.191) (-497.569) * (-503.386) (-507.011) [-507.063] (-499.903) -- 0:02:19
      21500 -- (-501.523) (-504.880) [-499.038] (-500.940) * (-505.083) (-509.340) (-501.193) [-500.024] -- 0:02:16
      22000 -- (-501.265) (-499.224) (-502.260) [-497.797] * (-507.353) (-513.276) (-507.748) [-501.381] -- 0:02:13
      22500 -- [-502.229] (-501.913) (-498.104) (-499.610) * (-503.366) [-502.410] (-506.913) (-500.850) -- 0:02:10
      23000 -- (-499.800) (-500.101) [-500.665] (-502.034) * (-502.206) [-504.771] (-503.488) (-505.107) -- 0:02:07
      23500 -- (-497.966) (-502.710) (-502.363) [-501.394] * (-498.534) (-507.513) [-504.534] (-497.331) -- 0:02:04
      24000 -- [-497.155] (-502.910) (-506.536) (-505.750) * (-503.061) (-504.840) (-505.705) [-503.615] -- 0:02:02
      24500 -- (-500.875) (-504.104) [-502.577] (-503.842) * [-498.523] (-506.470) (-507.523) (-498.383) -- 0:01:59
      25000 -- (-499.555) [-500.794] (-503.192) (-498.402) * [-500.515] (-509.848) (-512.361) (-504.014) -- 0:01:57

      Average standard deviation of split frequencies: 0.027196

      25500 -- (-510.185) (-504.931) [-503.125] (-504.747) * (-503.906) (-508.449) (-502.949) [-501.673] -- 0:01:54
      26000 -- (-502.673) (-502.963) (-496.358) [-501.500] * (-500.792) (-502.612) (-504.615) [-501.299] -- 0:01:52
      26500 -- (-499.087) (-506.133) (-499.782) [-506.163] * (-503.414) (-501.783) (-509.984) [-500.479] -- 0:01:50
      27000 -- [-504.013] (-504.293) (-496.570) (-504.171) * (-503.000) (-502.654) (-508.971) [-496.339] -- 0:02:24
      27500 -- (-508.352) [-504.060] (-498.534) (-503.210) * (-503.264) [-508.125] (-506.678) (-502.523) -- 0:02:21
      28000 -- (-507.909) (-505.834) (-503.580) [-498.383] * [-506.292] (-501.311) (-501.605) (-500.069) -- 0:02:18
      28500 -- (-501.064) [-501.516] (-499.811) (-502.716) * [-506.906] (-504.701) (-501.154) (-501.098) -- 0:02:16
      29000 -- [-500.807] (-506.135) (-502.538) (-507.792) * (-502.433) (-502.875) [-499.461] (-510.694) -- 0:02:13
      29500 -- (-501.372) (-502.623) [-499.631] (-508.125) * (-507.887) (-502.595) (-500.147) [-502.612] -- 0:02:11
      30000 -- (-502.920) [-502.140] (-502.837) (-506.079) * (-501.241) (-501.101) (-499.760) [-503.130] -- 0:02:09

      Average standard deviation of split frequencies: 0.025620

      30500 -- (-503.368) [-505.982] (-500.626) (-504.242) * [-500.336] (-505.964) (-503.502) (-500.791) -- 0:02:07
      31000 -- (-502.046) [-500.881] (-502.666) (-503.229) * (-502.813) (-503.647) [-508.211] (-508.509) -- 0:02:05
      31500 -- [-500.287] (-501.818) (-501.830) (-504.104) * [-503.382] (-506.903) (-503.256) (-504.119) -- 0:02:02
      32000 -- (-503.787) (-500.584) (-504.113) [-512.263] * (-507.986) (-509.268) (-499.201) [-500.928] -- 0:02:01
      32500 -- (-508.571) (-502.617) [-500.075] (-505.670) * [-502.501] (-507.593) (-496.908) (-499.435) -- 0:01:59
      33000 -- (-505.489) (-500.326) (-505.720) [-504.232] * [-504.756] (-504.793) (-495.412) (-501.839) -- 0:01:57
      33500 -- [-502.380] (-504.282) (-499.671) (-504.685) * (-499.782) (-508.846) (-501.771) [-498.416] -- 0:01:55
      34000 -- [-502.759] (-500.637) (-509.436) (-504.951) * [-501.404] (-506.047) (-506.946) (-500.239) -- 0:01:53
      34500 -- (-501.098) (-501.096) [-503.176] (-499.614) * [-499.678] (-508.277) (-498.683) (-497.210) -- 0:01:51
      35000 -- (-501.922) (-502.077) [-500.712] (-500.858) * [-498.717] (-511.254) (-500.866) (-502.353) -- 0:01:50

      Average standard deviation of split frequencies: 0.013095

      35500 -- (-499.171) [-498.414] (-506.032) (-498.756) * (-501.067) (-504.648) (-501.477) [-495.688] -- 0:01:48
      36000 -- (-504.095) [-500.870] (-507.335) (-503.222) * [-496.952] (-502.547) (-499.434) (-499.189) -- 0:01:47
      36500 -- (-510.627) [-503.031] (-503.055) (-502.627) * (-500.444) (-507.423) (-503.003) [-503.316] -- 0:01:45
      37000 -- (-497.811) (-500.597) [-506.864] (-508.164) * (-499.749) (-504.756) (-500.430) [-503.956] -- 0:02:10
      37500 -- [-502.075] (-502.852) (-504.773) (-502.824) * [-499.758] (-497.571) (-503.562) (-500.010) -- 0:02:08
      38000 -- (-501.015) (-504.130) [-502.471] (-501.469) * (-502.444) (-499.290) (-505.686) [-497.671] -- 0:02:06
      38500 -- (-497.107) (-498.534) [-499.579] (-503.466) * (-507.348) [-496.698] (-498.207) (-501.441) -- 0:02:04
      39000 -- (-498.492) (-504.749) [-498.040] (-500.281) * (-502.861) (-497.834) [-500.703] (-506.262) -- 0:02:03
      39500 -- (-500.859) [-501.433] (-504.673) (-499.845) * [-499.480] (-502.959) (-503.175) (-507.605) -- 0:02:01
      40000 -- (-503.829) (-500.385) (-506.938) [-503.029] * (-501.291) (-501.740) [-500.628] (-496.354) -- 0:02:00

      Average standard deviation of split frequencies: 0.034776

      40500 -- (-504.182) [-500.303] (-498.506) (-501.762) * (-506.953) (-502.260) (-503.540) [-496.582] -- 0:01:58
      41000 -- (-501.834) (-499.390) (-503.316) [-500.046] * (-499.451) (-501.618) (-502.312) [-497.524] -- 0:01:56
      41500 -- (-502.547) (-506.305) (-505.979) [-498.985] * (-499.076) [-503.072] (-506.866) (-500.288) -- 0:01:55
      42000 -- (-499.796) (-498.749) (-502.195) [-498.858] * (-507.227) (-500.879) (-506.242) [-501.105] -- 0:01:54
      42500 -- [-496.617] (-504.164) (-499.163) (-501.944) * (-498.236) (-503.136) (-500.969) [-499.158] -- 0:01:52
      43000 -- (-500.826) (-502.187) (-501.941) [-497.064] * [-496.995] (-502.548) (-504.582) (-498.238) -- 0:01:51
      43500 -- (-499.418) (-501.507) (-501.512) [-498.508] * (-499.236) [-500.276] (-499.779) (-498.558) -- 0:01:49
      44000 -- (-499.557) (-501.392) [-502.389] (-506.769) * (-501.307) (-504.138) (-500.627) [-499.660] -- 0:01:48
      44500 -- (-496.691) (-498.643) [-498.020] (-501.422) * (-498.285) (-505.590) [-495.855] (-498.654) -- 0:01:47
      45000 -- (-501.867) (-503.557) (-500.949) [-505.309] * (-502.073) (-503.645) (-498.893) [-495.419] -- 0:01:46

      Average standard deviation of split frequencies: 0.023912

      45500 -- (-503.986) (-500.586) (-499.796) [-502.547] * (-502.749) (-502.010) (-506.210) [-499.018] -- 0:01:44
      46000 -- (-497.720) (-502.509) (-499.607) [-498.969] * [-500.915] (-503.932) (-501.134) (-500.511) -- 0:01:43
      46500 -- (-497.276) (-501.291) [-500.259] (-499.332) * [-500.343] (-502.255) (-504.275) (-498.573) -- 0:01:42
      47000 -- (-500.105) (-502.258) (-501.940) [-501.245] * (-504.306) (-501.241) [-504.451] (-506.308) -- 0:01:41
      47500 -- (-499.271) [-501.419] (-506.532) (-504.307) * (-505.144) [-502.815] (-505.427) (-503.807) -- 0:02:00
      48000 -- [-498.529] (-498.083) (-505.574) (-508.269) * [-504.692] (-504.925) (-503.470) (-503.492) -- 0:01:59
      48500 -- (-502.005) (-502.628) [-504.612] (-508.647) * (-506.958) (-494.887) [-504.211] (-502.226) -- 0:01:57
      49000 -- (-503.823) [-499.877] (-498.105) (-508.629) * (-504.353) (-499.745) [-504.495] (-504.425) -- 0:01:56
      49500 -- (-498.386) (-500.377) [-507.143] (-509.182) * [-504.293] (-498.788) (-500.216) (-503.006) -- 0:01:55
      50000 -- (-502.149) (-500.389) (-504.011) [-508.822] * (-505.313) (-508.288) (-500.135) [-499.671] -- 0:01:54

      Average standard deviation of split frequencies: 0.031013

      50500 -- (-502.534) (-498.525) (-502.816) [-510.366] * (-502.240) [-500.824] (-499.588) (-503.684) -- 0:01:52
      51000 -- [-502.178] (-498.769) (-508.386) (-508.999) * (-503.886) (-501.295) (-501.625) [-497.870] -- 0:01:51
      51500 -- (-502.767) [-499.517] (-502.444) (-508.860) * (-501.722) (-501.012) (-499.639) [-498.901] -- 0:01:50
      52000 -- (-502.369) (-501.225) [-504.662] (-504.297) * (-501.342) [-503.551] (-502.522) (-503.856) -- 0:01:49
      52500 -- (-507.529) [-500.831] (-499.138) (-500.675) * (-502.884) (-503.463) [-503.882] (-503.193) -- 0:01:48
      53000 -- [-501.950] (-495.336) (-500.751) (-504.144) * (-502.063) (-505.844) (-511.553) [-503.678] -- 0:01:47
      53500 -- (-502.531) (-501.930) (-498.519) [-502.725] * (-503.717) [-503.375] (-509.610) (-500.724) -- 0:01:46
      54000 -- (-510.382) (-501.150) [-500.496] (-502.392) * [-500.693] (-501.636) (-505.034) (-502.439) -- 0:01:45
      54500 -- (-506.145) (-500.564) [-497.097] (-509.185) * (-505.054) (-500.013) (-507.056) [-496.955] -- 0:01:44
      55000 -- (-502.759) [-500.703] (-501.304) (-501.829) * (-503.336) [-500.900] (-506.289) (-502.325) -- 0:01:43

      Average standard deviation of split frequencies: 0.019642

      55500 -- (-503.508) (-502.872) (-498.137) [-498.657] * (-502.661) (-502.652) [-498.468] (-508.154) -- 0:01:42
      56000 -- [-498.588] (-501.378) (-498.643) (-503.402) * (-502.664) (-503.620) [-497.413] (-507.398) -- 0:01:41
      56500 -- (-496.961) [-498.551] (-500.803) (-499.798) * (-505.830) (-504.336) [-503.500] (-507.572) -- 0:01:40
      57000 -- (-498.922) (-499.437) [-498.229] (-510.828) * [-502.557] (-499.660) (-501.991) (-509.244) -- 0:01:39
      57500 -- [-502.446] (-496.979) (-504.869) (-502.984) * (-510.116) [-503.577] (-503.602) (-517.324) -- 0:01:54
      58000 -- (-498.500) (-496.392) (-504.466) [-496.132] * (-510.649) (-499.857) [-498.759] (-505.638) -- 0:01:53
      58500 -- [-502.067] (-499.318) (-504.377) (-503.047) * (-506.598) (-496.434) [-501.143] (-509.903) -- 0:01:52
      59000 -- [-505.707] (-496.328) (-507.076) (-504.775) * (-507.409) [-502.616] (-502.607) (-510.498) -- 0:01:51
      59500 -- (-505.253) [-497.726] (-503.131) (-498.182) * (-506.714) (-497.378) (-500.801) [-507.903] -- 0:01:50
      60000 -- [-504.293] (-499.701) (-500.578) (-498.463) * [-504.178] (-498.468) (-500.410) (-503.061) -- 0:01:49

      Average standard deviation of split frequencies: 0.018131

      60500 -- (-504.460) [-497.644] (-499.119) (-502.202) * (-507.297) [-497.880] (-501.696) (-505.310) -- 0:01:48
      61000 -- (-502.378) [-497.841] (-502.146) (-501.603) * (-501.228) (-500.647) [-502.589] (-506.804) -- 0:01:47
      61500 -- (-503.419) (-504.434) [-502.087] (-498.497) * (-503.980) [-499.943] (-501.583) (-503.227) -- 0:01:46
      62000 -- (-505.117) [-499.207] (-498.980) (-504.158) * (-510.635) (-497.896) [-499.202] (-503.634) -- 0:01:45
      62500 -- [-501.575] (-506.380) (-501.665) (-501.021) * (-499.445) (-503.937) [-502.888] (-504.171) -- 0:01:45
      63000 -- [-505.963] (-500.578) (-499.424) (-506.042) * (-501.562) [-499.393] (-507.487) (-507.024) -- 0:01:44
      63500 -- (-508.303) (-503.035) (-499.327) [-500.358] * [-498.918] (-498.977) (-500.521) (-501.771) -- 0:01:43
      64000 -- [-509.719] (-504.429) (-501.115) (-497.744) * (-502.722) (-500.263) (-502.009) [-505.930] -- 0:01:42
      64500 -- [-500.047] (-507.797) (-503.193) (-499.901) * [-498.750] (-498.719) (-503.919) (-506.424) -- 0:01:41
      65000 -- (-509.265) (-506.784) [-497.401] (-502.439) * (-499.386) (-502.769) (-500.349) [-502.316] -- 0:01:40

      Average standard deviation of split frequencies: 0.011904

      65500 -- [-501.881] (-499.714) (-499.898) (-501.463) * (-509.277) (-503.704) [-497.145] (-500.971) -- 0:01:39
      66000 -- [-503.870] (-502.210) (-499.802) (-501.516) * (-504.045) (-500.794) [-501.340] (-498.325) -- 0:01:39
      66500 -- (-502.897) (-501.523) [-502.211] (-503.362) * (-503.323) (-495.085) [-497.891] (-501.183) -- 0:01:38
      67000 -- (-504.685) (-501.685) (-502.335) [-499.645] * (-502.679) (-501.562) (-499.959) [-498.595] -- 0:01:37
      67500 -- (-509.942) (-502.601) [-502.228] (-500.748) * [-502.715] (-506.011) (-505.028) (-497.255) -- 0:01:36
      68000 -- (-507.713) (-505.066) (-506.037) [-497.568] * (-503.732) [-505.002] (-500.868) (-503.945) -- 0:01:49
      68500 -- (-512.010) [-503.874] (-514.132) (-499.925) * (-503.471) (-501.787) (-500.278) [-498.194] -- 0:01:48
      69000 -- (-510.538) (-499.690) [-502.566] (-501.877) * (-497.077) (-505.146) [-501.794] (-498.497) -- 0:01:47
      69500 -- (-501.268) (-503.176) (-503.142) [-500.613] * (-500.191) [-501.241] (-502.166) (-502.495) -- 0:01:47
      70000 -- (-504.517) (-497.779) (-497.646) [-497.069] * (-500.810) [-501.870] (-504.845) (-498.987) -- 0:01:46

      Average standard deviation of split frequencies: 0.008894

      70500 -- (-510.798) (-501.723) (-498.615) [-499.865] * (-502.265) (-503.053) [-501.805] (-502.547) -- 0:01:45
      71000 -- (-503.742) (-501.431) [-500.548] (-498.525) * [-499.034] (-504.713) (-505.545) (-517.791) -- 0:01:44
      71500 -- (-502.727) [-497.073] (-496.577) (-505.722) * [-495.465] (-508.667) (-499.861) (-503.863) -- 0:01:43
      72000 -- (-500.803) [-502.054] (-498.308) (-502.336) * [-498.782] (-504.403) (-503.505) (-502.872) -- 0:01:43
      72500 -- (-507.951) (-500.227) (-497.506) [-501.172] * (-494.351) (-503.300) (-501.847) [-499.463] -- 0:01:42
      73000 -- [-506.549] (-497.327) (-505.613) (-498.290) * (-494.606) (-504.429) (-499.765) [-498.755] -- 0:01:41
      73500 -- (-507.220) (-497.211) (-502.841) [-496.958] * (-499.930) (-510.648) (-500.531) [-502.317] -- 0:01:40
      74000 -- (-499.321) (-498.334) (-508.622) [-496.577] * (-498.012) (-501.961) [-501.457] (-501.541) -- 0:01:40
      74500 -- (-508.827) (-498.305) [-503.093] (-494.768) * (-500.545) [-496.406] (-496.844) (-505.949) -- 0:01:39
      75000 -- (-504.539) (-503.476) (-501.127) [-497.902] * (-498.226) (-502.223) [-502.932] (-499.625) -- 0:01:38

      Average standard deviation of split frequencies: 0.004135

      75500 -- [-504.334] (-499.367) (-503.350) (-494.857) * [-497.126] (-498.701) (-502.429) (-499.995) -- 0:01:37
      76000 -- (-496.732) (-501.770) [-500.843] (-499.701) * [-501.849] (-504.347) (-499.720) (-499.395) -- 0:01:37
      76500 -- [-501.039] (-499.826) (-499.200) (-499.210) * (-505.012) (-503.655) (-499.681) [-500.221] -- 0:01:36
      77000 -- (-504.115) (-502.284) [-503.678] (-500.076) * (-498.056) [-501.334] (-500.906) (-503.968) -- 0:01:35
      77500 -- [-501.900] (-500.959) (-501.010) (-504.134) * (-499.248) (-497.942) [-498.061] (-502.573) -- 0:01:35
      78000 -- (-502.305) (-503.280) [-498.757] (-505.990) * (-500.980) (-501.778) (-498.200) [-504.057] -- 0:01:34
      78500 -- (-502.265) (-501.194) [-500.804] (-497.831) * (-499.989) (-497.610) [-501.208] (-504.790) -- 0:01:45
      79000 -- (-502.108) (-504.336) [-500.446] (-503.861) * (-497.541) (-498.923) [-498.179] (-507.076) -- 0:01:44
      79500 -- [-495.700] (-505.332) (-506.180) (-499.326) * (-497.137) (-498.741) (-500.029) [-501.351] -- 0:01:44
      80000 -- (-503.326) (-502.954) (-499.551) [-496.877] * (-500.763) (-504.352) (-503.926) [-495.544] -- 0:01:43

      Average standard deviation of split frequencies: 0.003896

      80500 -- (-499.268) (-510.123) (-502.340) [-498.736] * [-497.236] (-511.281) (-495.951) (-496.523) -- 0:01:42
      81000 -- [-502.467] (-500.340) (-500.015) (-502.259) * (-502.006) (-499.508) [-504.257] (-498.075) -- 0:01:42
      81500 -- [-499.761] (-499.172) (-502.204) (-501.470) * (-509.103) (-504.363) [-497.057] (-499.921) -- 0:01:41
      82000 -- (-500.070) [-510.117] (-499.202) (-501.533) * (-504.633) (-501.617) (-498.266) [-500.237] -- 0:01:40
      82500 -- (-500.129) [-502.228] (-497.039) (-500.185) * (-497.282) (-506.943) [-498.699] (-504.236) -- 0:01:40
      83000 -- (-500.800) (-503.930) [-500.442] (-503.467) * (-498.600) (-506.602) (-506.235) [-498.703] -- 0:01:39
      83500 -- (-500.193) [-502.370] (-501.425) (-499.242) * (-500.574) (-498.753) (-502.747) [-499.661] -- 0:01:38
      84000 -- (-499.963) [-497.889] (-508.782) (-500.651) * (-503.721) [-498.851] (-498.387) (-498.775) -- 0:01:38
      84500 -- (-504.182) (-501.277) [-502.196] (-506.330) * (-506.006) (-505.225) [-499.784] (-497.766) -- 0:01:37
      85000 -- (-502.830) [-501.581] (-505.758) (-505.417) * (-501.791) (-501.707) [-500.072] (-508.220) -- 0:01:36

      Average standard deviation of split frequencies: 0.007309

      85500 -- (-501.434) [-502.075] (-502.619) (-499.273) * (-506.639) (-504.554) [-501.206] (-498.768) -- 0:01:36
      86000 -- (-506.446) (-500.146) [-502.794] (-500.064) * (-502.911) [-499.659] (-500.626) (-502.479) -- 0:01:35
      86500 -- (-503.506) (-501.557) [-505.059] (-506.524) * (-499.016) [-499.864] (-498.902) (-511.361) -- 0:01:35
      87000 -- (-506.712) [-500.500] (-507.698) (-499.596) * [-497.113] (-499.595) (-502.007) (-505.695) -- 0:01:34
      87500 -- [-504.864] (-505.964) (-506.898) (-501.828) * [-500.496] (-502.185) (-499.439) (-505.667) -- 0:01:33
      88000 -- [-504.044] (-502.839) (-508.607) (-500.755) * (-505.276) (-498.188) [-496.773] (-512.412) -- 0:01:33
      88500 -- [-500.131] (-500.202) (-503.991) (-508.539) * [-504.322] (-501.329) (-498.012) (-502.121) -- 0:01:32
      89000 -- (-501.197) (-498.932) (-500.895) [-500.913] * (-505.289) (-502.584) (-501.588) [-504.078] -- 0:01:42
      89500 -- (-505.375) [-499.544] (-500.425) (-507.775) * [-502.887] (-499.795) (-500.105) (-499.023) -- 0:01:41
      90000 -- [-497.833] (-497.060) (-501.285) (-507.224) * (-500.832) (-503.940) [-500.024] (-499.520) -- 0:01:41

      Average standard deviation of split frequencies: 0.008666

      90500 -- (-503.300) [-498.021] (-498.378) (-503.359) * (-502.724) [-501.113] (-500.934) (-501.722) -- 0:01:40
      91000 -- (-502.777) (-499.327) (-504.075) [-505.567] * (-503.687) (-496.813) (-504.646) [-502.673] -- 0:01:39
      91500 -- (-506.410) [-500.887] (-502.739) (-500.564) * [-500.464] (-498.642) (-501.440) (-501.664) -- 0:01:39
      92000 -- (-504.935) [-499.271] (-498.627) (-500.966) * (-501.157) (-498.247) (-507.307) [-498.690] -- 0:01:38
      92500 -- (-499.138) (-502.099) [-498.641] (-500.303) * (-499.549) [-498.939] (-503.631) (-496.361) -- 0:01:38
      93000 -- (-503.212) (-497.748) [-496.684] (-501.011) * (-498.762) (-505.890) [-502.022] (-499.243) -- 0:01:37
      93500 -- (-502.860) (-501.133) (-505.544) [-504.053] * (-504.996) (-502.564) (-501.090) [-506.963] -- 0:01:36
      94000 -- (-502.404) [-501.788] (-499.933) (-503.307) * (-506.454) (-500.257) (-498.800) [-497.782] -- 0:01:36
      94500 -- (-509.260) (-502.825) (-497.781) [-498.908] * (-500.482) (-499.212) (-497.244) [-499.720] -- 0:01:35
      95000 -- (-510.631) [-501.713] (-500.258) (-501.568) * (-502.546) (-498.881) [-503.628] (-499.409) -- 0:01:35

      Average standard deviation of split frequencies: 0.006547

      95500 -- (-501.802) (-503.633) (-499.148) [-497.931] * (-504.432) [-496.846] (-510.080) (-505.447) -- 0:01:34
      96000 -- (-512.286) (-502.309) [-498.847] (-504.506) * (-501.053) (-500.672) [-509.952] (-501.133) -- 0:01:34
      96500 -- (-500.755) [-501.349] (-506.015) (-501.868) * (-500.072) [-501.922] (-503.445) (-497.701) -- 0:01:33
      97000 -- (-503.387) (-507.944) (-501.959) [-502.636] * (-504.003) [-504.630] (-496.959) (-505.474) -- 0:01:33
      97500 -- (-510.741) (-501.952) [-504.570] (-501.891) * (-501.289) (-505.070) (-502.292) [-504.056] -- 0:01:32
      98000 -- (-503.794) (-498.616) [-501.514] (-503.367) * (-499.030) [-500.487] (-499.938) (-502.444) -- 0:01:32
      98500 -- (-505.818) (-498.164) (-496.835) [-499.415] * (-499.805) (-505.577) (-498.950) [-499.782] -- 0:01:31
      99000 -- (-507.758) (-499.217) [-497.551] (-504.423) * [-496.220] (-504.320) (-501.846) (-500.921) -- 0:01:40
      99500 -- (-504.640) (-506.512) [-497.521] (-506.560) * [-499.569] (-506.495) (-503.899) (-497.100) -- 0:01:39
      100000 -- (-498.650) [-503.343] (-500.893) (-501.698) * (-500.089) (-500.873) [-501.614] (-504.129) -- 0:01:39

      Average standard deviation of split frequencies: 0.003122

      100500 -- (-501.371) [-506.748] (-501.649) (-507.748) * (-505.783) (-499.831) [-499.317] (-499.371) -- 0:01:38
      101000 -- (-503.162) [-508.487] (-507.545) (-500.479) * (-500.052) (-506.302) [-505.271] (-501.959) -- 0:01:37
      101500 -- (-501.863) (-506.550) (-503.350) [-500.506] * (-500.829) (-499.305) [-499.898] (-507.970) -- 0:01:37
      102000 -- (-506.118) (-503.881) [-499.500] (-498.241) * (-503.885) (-507.926) [-500.791] (-505.561) -- 0:01:36
      102500 -- (-504.473) (-499.213) (-499.702) [-497.767] * [-500.823] (-503.121) (-507.032) (-500.577) -- 0:01:36
      103000 -- (-505.033) (-498.225) (-499.482) [-498.117] * (-501.678) (-510.075) (-500.401) [-498.834] -- 0:01:35
      103500 -- (-505.261) (-503.264) (-504.559) [-496.564] * [-497.128] (-506.027) (-506.291) (-507.894) -- 0:01:35
      104000 -- (-506.604) (-506.392) (-502.844) [-498.536] * (-496.788) [-503.797] (-501.329) (-502.145) -- 0:01:34
      104500 -- (-499.829) [-499.203] (-500.714) (-503.394) * (-497.677) (-503.536) [-503.543] (-508.523) -- 0:01:34
      105000 -- (-509.147) (-501.126) (-499.419) [-503.295] * [-502.210] (-503.073) (-504.203) (-505.442) -- 0:01:33

      Average standard deviation of split frequencies: 0.005930

      105500 -- (-502.270) [-499.231] (-501.487) (-497.627) * (-500.477) (-501.940) (-502.252) [-502.240] -- 0:01:33
      106000 -- (-501.626) [-497.882] (-502.925) (-501.710) * (-501.056) [-499.591] (-504.855) (-502.769) -- 0:01:32
      106500 -- (-499.546) [-502.522] (-507.975) (-498.956) * [-501.214] (-501.886) (-504.780) (-505.838) -- 0:01:32
      107000 -- (-497.651) (-503.613) (-501.555) [-501.938] * (-502.889) (-501.443) [-496.265] (-506.472) -- 0:01:31
      107500 -- [-499.241] (-500.020) (-502.938) (-498.376) * (-511.216) [-502.820] (-499.079) (-514.703) -- 0:01:31
      108000 -- (-499.678) (-503.986) (-502.825) [-498.978] * (-500.744) [-501.375] (-503.509) (-511.767) -- 0:01:30
      108500 -- [-497.942] (-502.940) (-502.253) (-500.687) * (-507.855) (-507.879) (-501.145) [-506.474] -- 0:01:30
      109000 -- (-499.788) [-504.282] (-503.684) (-500.812) * [-500.662] (-507.435) (-508.160) (-509.252) -- 0:01:38
      109500 -- (-501.808) [-504.154] (-499.415) (-501.138) * [-496.358] (-515.528) (-501.636) (-501.596) -- 0:01:37
      110000 -- (-499.561) [-498.682] (-502.454) (-499.592) * [-498.390] (-504.763) (-499.960) (-504.060) -- 0:01:37

      Average standard deviation of split frequencies: 0.004260

      110500 -- [-500.089] (-500.612) (-503.401) (-508.445) * [-498.447] (-500.341) (-501.912) (-507.477) -- 0:01:36
      111000 -- [-503.457] (-500.505) (-502.128) (-500.663) * (-499.573) (-510.172) (-501.310) [-503.325] -- 0:01:36
      111500 -- (-504.671) [-499.160] (-505.517) (-505.507) * (-504.556) (-504.207) [-498.801] (-506.491) -- 0:01:35
      112000 -- (-502.052) (-499.985) [-499.147] (-498.697) * (-504.589) (-502.339) [-501.019] (-506.890) -- 0:01:35
      112500 -- (-505.405) [-496.894] (-502.722) (-505.331) * [-500.907] (-504.384) (-503.685) (-506.606) -- 0:01:34
      113000 -- (-501.565) (-505.516) (-499.414) [-505.546] * (-508.152) (-507.545) [-501.831] (-507.833) -- 0:01:34
      113500 -- (-498.643) [-501.033] (-498.606) (-506.553) * [-503.110] (-505.111) (-502.860) (-504.379) -- 0:01:33
      114000 -- (-496.798) (-500.374) (-496.423) [-500.829] * (-502.234) (-501.551) (-500.758) [-505.520] -- 0:01:33
      114500 -- (-500.353) [-498.373] (-501.281) (-499.655) * (-504.504) (-503.708) (-497.701) [-503.589] -- 0:01:32
      115000 -- (-496.511) (-501.070) (-507.211) [-499.598] * (-502.300) [-501.107] (-503.642) (-501.027) -- 0:01:32

      Average standard deviation of split frequencies: 0.002709

      115500 -- (-497.197) (-497.865) (-499.853) [-498.734] * (-503.116) (-500.632) (-504.316) [-504.261] -- 0:01:31
      116000 -- (-500.641) (-496.615) (-504.513) [-499.130] * (-499.472) (-499.660) (-502.912) [-499.764] -- 0:01:31
      116500 -- [-496.807] (-502.525) (-505.720) (-502.311) * (-498.866) (-499.958) (-497.998) [-501.343] -- 0:01:31
      117000 -- (-499.019) [-500.631] (-503.326) (-502.505) * (-501.521) (-501.474) [-497.553] (-504.925) -- 0:01:30
      117500 -- (-504.350) (-499.073) (-503.449) [-501.384] * (-506.529) [-498.279] (-504.823) (-503.137) -- 0:01:30
      118000 -- [-502.842] (-497.248) (-504.792) (-499.954) * [-499.432] (-504.546) (-506.435) (-501.975) -- 0:01:29
      118500 -- (-504.028) [-497.448] (-505.775) (-506.386) * (-501.853) (-499.682) [-502.150] (-508.164) -- 0:01:29
      119000 -- (-508.300) (-500.591) [-502.324] (-507.646) * (-499.701) (-504.330) (-500.287) [-502.818] -- 0:01:28
      119500 -- (-497.769) [-496.299] (-501.479) (-499.468) * (-501.449) (-511.544) (-497.979) [-501.130] -- 0:01:35
      120000 -- (-501.590) (-495.691) (-508.684) [-501.919] * (-497.116) (-503.981) (-500.079) [-500.846] -- 0:01:35

      Average standard deviation of split frequencies: 0.006511

      120500 -- (-500.031) [-500.062] (-511.718) (-500.056) * (-498.840) (-498.896) [-501.824] (-502.139) -- 0:01:34
      121000 -- (-499.262) (-502.473) (-507.653) [-503.486] * (-510.065) [-495.674] (-498.757) (-502.314) -- 0:01:34
      121500 -- (-502.975) [-500.237] (-504.254) (-508.085) * (-503.944) (-500.267) [-498.055] (-504.653) -- 0:01:33
      122000 -- (-499.737) (-502.698) (-510.317) [-500.553] * (-500.792) (-497.124) [-498.795] (-503.037) -- 0:01:33
      122500 -- [-499.949] (-502.155) (-501.224) (-501.885) * [-498.019] (-499.230) (-500.844) (-500.209) -- 0:01:33
      123000 -- (-508.830) [-505.294] (-503.763) (-509.959) * (-501.059) (-500.196) [-500.364] (-502.904) -- 0:01:32
      123500 -- (-504.179) [-500.176] (-503.501) (-500.861) * [-501.393] (-504.017) (-497.579) (-504.597) -- 0:01:32
      124000 -- (-498.877) [-505.826] (-507.588) (-501.161) * [-506.518] (-498.383) (-496.965) (-508.698) -- 0:01:31
      124500 -- (-509.963) [-500.568] (-504.127) (-505.325) * (-505.077) (-497.758) (-497.668) [-504.716] -- 0:01:31
      125000 -- (-503.782) (-499.330) [-503.922] (-496.805) * (-505.394) (-498.176) (-499.439) [-498.555] -- 0:01:31

      Average standard deviation of split frequencies: 0.004988

      125500 -- (-507.247) (-502.108) (-504.245) [-502.178] * (-508.997) (-499.107) (-500.443) [-497.289] -- 0:01:30
      126000 -- (-507.418) [-500.308] (-503.499) (-501.579) * (-506.874) (-507.085) (-508.873) [-503.461] -- 0:01:30
      126500 -- [-504.176] (-500.534) (-498.268) (-506.111) * (-503.980) [-499.737] (-504.522) (-504.152) -- 0:01:29
      127000 -- [-500.247] (-500.559) (-505.205) (-504.077) * [-502.422] (-502.189) (-504.081) (-502.133) -- 0:01:29
      127500 -- [-500.609] (-499.046) (-498.356) (-502.813) * [-508.668] (-505.065) (-500.221) (-497.025) -- 0:01:28
      128000 -- (-498.925) (-498.768) [-499.316] (-501.595) * (-512.915) (-502.385) (-499.435) [-500.864] -- 0:01:28
      128500 -- (-501.411) (-498.619) [-498.607] (-508.182) * (-500.701) (-503.253) [-497.717] (-502.839) -- 0:01:28
      129000 -- (-504.933) (-498.085) (-504.189) [-504.038] * (-501.891) (-497.180) (-498.279) [-502.004] -- 0:01:27
      129500 -- (-501.959) [-497.162] (-501.644) (-500.852) * (-502.108) (-503.093) (-499.621) [-499.513] -- 0:01:34
      130000 -- [-500.378] (-502.031) (-503.613) (-502.243) * [-499.969] (-499.454) (-500.675) (-499.392) -- 0:01:33

      Average standard deviation of split frequencies: 0.009621

      130500 -- (-506.426) [-499.034] (-501.262) (-508.983) * (-507.646) (-499.232) (-506.629) [-502.861] -- 0:01:33
      131000 -- [-502.333] (-505.061) (-503.074) (-505.894) * (-507.864) (-501.072) (-502.201) [-503.078] -- 0:01:32
      131500 -- [-501.217] (-502.119) (-498.450) (-503.577) * (-500.763) [-499.299] (-509.755) (-501.888) -- 0:01:32
      132000 -- [-504.222] (-508.715) (-500.851) (-505.410) * (-508.501) (-501.227) [-500.568] (-498.601) -- 0:01:32
      132500 -- (-501.719) (-502.296) (-500.905) [-505.882] * (-501.032) [-496.078] (-507.134) (-498.973) -- 0:01:31
      133000 -- (-503.191) (-506.429) [-499.678] (-506.443) * [-503.246] (-501.799) (-507.458) (-497.476) -- 0:01:31
      133500 -- (-504.815) (-499.673) (-504.245) [-504.050] * (-495.933) (-496.604) (-507.542) [-498.336] -- 0:01:30
      134000 -- (-505.134) (-503.022) (-506.565) [-502.287] * (-499.279) [-498.320] (-506.098) (-497.199) -- 0:01:30
      134500 -- (-502.899) (-500.384) [-504.105] (-504.250) * (-504.697) (-498.991) (-499.256) [-500.640] -- 0:01:30
      135000 -- (-510.991) (-499.397) [-504.942] (-503.477) * [-498.920] (-498.344) (-500.215) (-500.684) -- 0:01:29

      Average standard deviation of split frequencies: 0.010399

      135500 -- (-510.893) [-497.011] (-501.325) (-506.037) * (-504.796) (-499.326) [-502.439] (-505.808) -- 0:01:29
      136000 -- (-511.053) [-498.716] (-501.949) (-500.866) * (-503.167) [-498.154] (-503.892) (-497.488) -- 0:01:28
      136500 -- (-511.996) [-500.927] (-500.197) (-505.897) * [-504.863] (-510.299) (-506.483) (-505.743) -- 0:01:28
      137000 -- (-509.808) [-498.520] (-505.799) (-501.848) * (-503.398) (-498.910) (-500.822) [-503.094] -- 0:01:28
      137500 -- (-504.192) (-500.503) (-503.090) [-502.390] * [-498.385] (-507.701) (-499.121) (-501.259) -- 0:01:27
      138000 -- (-510.199) (-508.352) (-500.618) [-510.036] * [-496.003] (-504.477) (-499.366) (-504.959) -- 0:01:27
      138500 -- (-506.876) [-495.756] (-498.391) (-501.693) * [-497.837] (-501.167) (-499.552) (-504.237) -- 0:01:27
      139000 -- (-505.327) [-498.366] (-500.234) (-504.901) * (-501.831) [-497.791] (-501.812) (-496.686) -- 0:01:26
      139500 -- (-503.933) [-501.516] (-501.323) (-506.473) * (-500.357) [-498.427] (-501.270) (-502.531) -- 0:01:26
      140000 -- (-502.183) [-501.018] (-499.828) (-500.336) * (-502.736) [-499.019] (-497.651) (-497.678) -- 0:01:32

      Average standard deviation of split frequencies: 0.006702

      140500 -- (-504.876) [-501.425] (-499.397) (-501.699) * [-495.609] (-502.726) (-497.581) (-498.698) -- 0:01:31
      141000 -- (-507.770) [-498.223] (-498.348) (-500.999) * (-503.622) [-499.264] (-500.945) (-500.394) -- 0:01:31
      141500 -- (-507.406) [-508.104] (-499.827) (-500.654) * (-502.016) (-503.690) (-498.059) [-501.526] -- 0:01:31
      142000 -- (-505.101) (-503.551) [-500.837] (-501.087) * [-498.117] (-502.535) (-502.019) (-502.951) -- 0:01:30
      142500 -- (-503.686) [-503.578] (-499.607) (-498.284) * (-496.509) [-500.295] (-498.806) (-503.484) -- 0:01:30
      143000 -- (-503.021) [-497.136] (-501.434) (-504.115) * (-497.723) [-495.970] (-497.735) (-498.841) -- 0:01:29
      143500 -- (-510.903) (-499.093) [-497.645] (-502.376) * [-500.839] (-500.729) (-500.374) (-505.504) -- 0:01:29
      144000 -- (-501.236) (-498.477) (-500.922) [-503.325] * (-501.507) [-499.195] (-506.974) (-498.936) -- 0:01:29
      144500 -- (-506.061) (-498.724) [-502.180] (-502.281) * (-506.855) [-498.465] (-502.582) (-499.436) -- 0:01:28
      145000 -- (-502.558) (-506.322) (-497.257) [-499.678] * (-500.684) [-496.951] (-501.797) (-503.986) -- 0:01:28

      Average standard deviation of split frequencies: 0.002153

      145500 -- (-502.984) (-496.341) [-500.602] (-503.433) * (-500.620) (-499.884) (-504.020) [-498.955] -- 0:01:28
      146000 -- (-504.714) [-497.847] (-502.547) (-505.870) * (-498.546) (-503.704) (-502.548) [-503.166] -- 0:01:27
      146500 -- (-502.308) (-502.208) [-498.044] (-502.221) * [-500.689] (-498.314) (-500.661) (-498.503) -- 0:01:27
      147000 -- (-502.972) (-500.173) (-499.353) [-499.421] * (-500.756) (-503.835) (-506.114) [-497.901] -- 0:01:27
      147500 -- (-506.542) [-497.675] (-501.517) (-500.135) * (-496.542) (-510.614) [-501.116] (-499.641) -- 0:01:26
      148000 -- (-506.136) (-498.130) [-498.243] (-496.648) * [-500.439] (-498.396) (-503.104) (-495.888) -- 0:01:26
      148500 -- (-498.751) [-504.935] (-497.710) (-500.021) * (-503.720) (-499.603) (-502.891) [-499.835] -- 0:01:26
      149000 -- (-501.994) [-505.766] (-500.616) (-495.231) * (-502.942) (-501.985) (-502.007) [-501.050] -- 0:01:25
      149500 -- (-503.959) [-504.008] (-498.177) (-499.413) * [-499.296] (-502.878) (-499.867) (-501.021) -- 0:01:25
      150000 -- (-507.578) [-497.652] (-497.477) (-500.051) * (-497.398) (-499.803) (-500.630) [-497.152] -- 0:01:25

      Average standard deviation of split frequencies: 0.003129

      150500 -- (-502.834) [-500.134] (-507.205) (-496.880) * (-505.232) (-501.912) [-500.821] (-501.670) -- 0:01:30
      151000 -- (-502.184) [-500.938] (-502.325) (-499.822) * (-505.172) [-497.461] (-500.254) (-497.613) -- 0:01:29
      151500 -- (-500.439) (-506.117) (-503.200) [-499.135] * (-500.413) (-500.360) [-505.116] (-506.523) -- 0:01:29
      152000 -- (-500.002) [-500.933] (-500.531) (-496.603) * (-504.094) [-499.667] (-500.777) (-499.139) -- 0:01:29
      152500 -- (-501.808) (-507.824) (-510.393) [-500.623] * (-497.422) [-501.430] (-496.212) (-497.948) -- 0:01:28
      153000 -- [-501.599] (-498.476) (-502.641) (-501.792) * (-500.771) (-498.005) (-501.466) [-500.903] -- 0:01:28
      153500 -- (-503.978) (-506.401) (-504.437) [-501.430] * [-497.564] (-496.626) (-500.100) (-496.818) -- 0:01:28
      154000 -- (-501.823) (-499.499) (-503.756) [-497.511] * [-497.388] (-497.228) (-507.443) (-503.010) -- 0:01:27
      154500 -- (-508.677) [-495.597] (-501.072) (-499.507) * [-499.543] (-500.698) (-506.524) (-501.419) -- 0:01:27
      155000 -- (-504.625) (-507.627) (-499.018) [-503.459] * [-502.912] (-499.493) (-507.072) (-500.936) -- 0:01:27

      Average standard deviation of split frequencies: 0.003022

      155500 -- [-501.506] (-502.591) (-499.890) (-507.325) * [-500.590] (-502.679) (-507.520) (-499.681) -- 0:01:26
      156000 -- (-503.108) (-502.171) (-501.605) [-506.394] * (-504.723) (-502.829) (-503.281) [-497.039] -- 0:01:26
      156500 -- [-503.095] (-503.948) (-501.640) (-505.033) * (-505.606) [-498.372] (-500.092) (-496.193) -- 0:01:26
      157000 -- (-501.064) (-502.075) [-498.588] (-509.996) * (-509.668) (-500.553) (-500.014) [-501.492] -- 0:01:25
      157500 -- (-502.396) [-496.809] (-496.995) (-502.230) * (-504.859) (-503.231) (-503.359) [-504.648] -- 0:01:25
      158000 -- [-501.088] (-502.342) (-500.242) (-508.368) * (-507.866) [-503.248] (-500.805) (-501.633) -- 0:01:25
      158500 -- (-503.782) (-500.417) [-496.653] (-499.974) * [-501.636] (-498.633) (-500.915) (-498.117) -- 0:01:24
      159000 -- (-502.280) (-501.684) (-504.377) [-499.648] * (-505.359) (-500.680) [-504.681] (-498.806) -- 0:01:24
      159500 -- (-497.501) (-498.857) [-501.680] (-502.035) * (-500.660) (-504.631) [-504.882] (-501.746) -- 0:01:24
      160000 -- (-501.110) (-497.312) (-501.425) [-501.474] * (-504.697) (-499.729) (-497.556) [-504.880] -- 0:01:24

      Average standard deviation of split frequencies: 0.002934

      160500 -- (-507.185) (-496.418) (-501.312) [-504.834] * (-504.961) (-502.072) (-507.388) [-503.401] -- 0:01:28
      161000 -- (-504.637) (-505.119) [-504.937] (-501.889) * (-499.571) (-503.477) (-505.755) [-500.420] -- 0:01:28
      161500 -- [-501.784] (-500.159) (-501.213) (-509.244) * (-510.406) [-501.330] (-503.533) (-502.825) -- 0:01:28
      162000 -- [-502.023] (-497.716) (-501.172) (-506.132) * (-507.297) [-499.120] (-499.958) (-498.973) -- 0:01:27
      162500 -- (-502.395) (-499.259) [-503.949] (-508.609) * (-501.004) (-500.766) (-501.558) [-498.993] -- 0:01:27
      163000 -- [-501.276] (-505.028) (-502.625) (-505.034) * (-509.203) (-502.026) (-502.176) [-501.814] -- 0:01:27
      163500 -- [-497.967] (-496.959) (-505.509) (-502.802) * (-501.290) (-502.198) (-509.558) [-499.663] -- 0:01:26
      164000 -- [-501.767] (-495.333) (-497.034) (-501.950) * (-509.743) [-497.815] (-505.033) (-499.135) -- 0:01:26
      164500 -- (-504.060) (-496.716) [-498.411] (-511.264) * (-501.169) (-499.880) (-500.052) [-499.074] -- 0:01:26
      165000 -- [-499.968] (-497.921) (-499.117) (-506.839) * (-500.515) [-501.864] (-501.485) (-504.396) -- 0:01:26

      Average standard deviation of split frequencies: 0.002840

      165500 -- (-501.396) (-498.728) [-498.651] (-508.192) * [-498.692] (-510.293) (-503.180) (-500.220) -- 0:01:25
      166000 -- (-499.076) (-498.701) (-503.311) [-505.915] * (-502.401) (-507.959) (-499.581) [-502.617] -- 0:01:25
      166500 -- (-501.644) [-501.596] (-503.962) (-512.255) * (-508.754) (-511.312) (-498.523) [-498.016] -- 0:01:25
      167000 -- (-499.555) (-505.581) (-498.555) [-499.485] * (-504.475) [-506.708] (-500.975) (-505.533) -- 0:01:24
      167500 -- (-501.367) (-506.443) (-506.744) [-497.695] * (-509.558) [-504.495] (-506.233) (-499.775) -- 0:01:24
      168000 -- (-505.818) (-504.937) [-495.153] (-501.062) * (-504.694) [-508.522] (-505.851) (-499.066) -- 0:01:24
      168500 -- [-505.657] (-510.589) (-497.126) (-500.674) * (-505.949) (-504.609) (-502.932) [-497.544] -- 0:01:23
      169000 -- (-507.799) (-504.087) [-495.050] (-500.094) * (-508.009) (-508.388) (-503.127) [-505.014] -- 0:01:23
      169500 -- (-503.162) (-507.224) [-499.777] (-504.313) * (-506.807) (-508.002) (-506.109) [-503.837] -- 0:01:23
      170000 -- (-503.820) (-502.499) (-497.908) [-500.670] * (-505.756) (-504.823) (-498.882) [-498.355] -- 0:01:23

      Average standard deviation of split frequencies: 0.001841

      170500 -- [-503.745] (-503.360) (-501.155) (-502.884) * (-502.082) (-505.784) [-500.409] (-501.638) -- 0:01:27
      171000 -- (-502.683) (-498.223) [-502.671] (-505.442) * (-508.711) (-504.023) (-499.670) [-501.303] -- 0:01:27
      171500 -- (-504.872) [-500.633] (-503.599) (-505.983) * (-501.138) (-500.825) [-497.408] (-500.975) -- 0:01:26
      172000 -- [-506.115] (-504.197) (-501.627) (-502.454) * (-507.290) [-497.884] (-504.209) (-501.706) -- 0:01:26
      172500 -- (-507.667) (-503.250) (-498.304) [-507.250] * (-499.064) [-499.075] (-503.040) (-502.603) -- 0:01:26
      173000 -- (-508.716) (-505.058) [-500.498] (-501.315) * (-499.138) [-500.565] (-504.167) (-499.511) -- 0:01:26
      173500 -- [-503.536] (-503.180) (-501.377) (-498.695) * [-499.816] (-498.073) (-497.083) (-500.261) -- 0:01:25
      174000 -- (-506.077) (-502.472) [-500.903] (-501.344) * (-501.038) (-512.446) (-503.497) [-498.249] -- 0:01:25
      174500 -- (-505.749) (-501.912) [-500.352] (-507.572) * (-497.738) (-501.089) (-508.474) [-499.329] -- 0:01:25
      175000 -- (-506.975) (-500.057) [-505.530] (-498.110) * (-505.779) (-500.245) (-508.910) [-499.783] -- 0:01:24

      Average standard deviation of split frequencies: 0.001786

      175500 -- [-502.784] (-500.713) (-501.547) (-502.374) * [-497.554] (-498.020) (-500.461) (-508.927) -- 0:01:24
      176000 -- (-501.113) (-507.114) [-499.854] (-505.162) * [-497.384] (-498.820) (-502.102) (-500.707) -- 0:01:24
      176500 -- (-504.337) (-500.583) [-499.821] (-497.607) * [-501.379] (-502.988) (-508.232) (-502.538) -- 0:01:23
      177000 -- (-504.228) [-500.333] (-501.492) (-499.413) * (-503.884) (-500.140) [-501.209] (-501.304) -- 0:01:23
      177500 -- (-506.101) [-503.936] (-500.740) (-500.721) * [-500.601] (-504.549) (-503.733) (-506.244) -- 0:01:23
      178000 -- (-505.315) (-501.990) [-501.503] (-499.411) * (-504.170) [-500.707] (-503.758) (-504.012) -- 0:01:23
      178500 -- [-499.757] (-500.672) (-503.020) (-502.344) * (-499.625) (-501.130) [-500.815] (-501.699) -- 0:01:22
      179000 -- (-499.287) [-498.170] (-502.861) (-505.765) * (-501.373) [-497.463] (-503.462) (-504.212) -- 0:01:22
      179500 -- (-499.620) (-505.388) (-499.888) [-507.664] * (-499.697) [-501.242] (-501.308) (-503.157) -- 0:01:22
      180000 -- (-499.636) [-502.977] (-501.476) (-501.762) * (-509.311) [-501.954] (-499.993) (-506.038) -- 0:01:22

      Average standard deviation of split frequencies: 0.001740

      180500 -- [-499.152] (-503.594) (-500.853) (-504.561) * (-501.114) (-499.668) (-506.031) [-504.714] -- 0:01:21
      181000 -- [-500.004] (-497.658) (-497.904) (-503.748) * (-498.685) [-497.608] (-504.919) (-500.017) -- 0:01:25
      181500 -- [-502.861] (-497.772) (-502.038) (-496.415) * (-501.258) (-498.672) [-502.579] (-502.836) -- 0:01:25
      182000 -- (-497.301) (-504.855) (-500.552) [-500.651] * [-499.785] (-499.111) (-501.352) (-504.003) -- 0:01:25
      182500 -- [-500.984] (-504.330) (-498.159) (-504.219) * (-503.315) [-501.305] (-504.254) (-498.228) -- 0:01:25
      183000 -- [-496.773] (-505.705) (-497.267) (-504.036) * (-498.666) [-502.911] (-499.204) (-499.773) -- 0:01:24
      183500 -- (-500.201) (-498.524) (-504.125) [-501.723] * (-503.465) (-503.441) [-501.244] (-500.465) -- 0:01:24
      184000 -- (-495.815) (-503.651) [-500.594] (-506.309) * (-501.683) (-504.602) (-499.835) [-500.550] -- 0:01:24
      184500 -- (-501.504) (-498.435) [-500.328] (-500.337) * (-502.443) [-502.666] (-498.514) (-500.067) -- 0:01:23
      185000 -- (-506.084) (-498.737) [-501.851] (-502.540) * [-502.349] (-497.723) (-502.016) (-501.235) -- 0:01:23

      Average standard deviation of split frequencies: 0.000845

      185500 -- [-497.541] (-499.749) (-501.231) (-509.248) * (-505.647) [-503.141] (-496.888) (-498.138) -- 0:01:23
      186000 -- (-502.574) (-502.903) [-500.830] (-501.892) * (-505.858) (-501.696) [-499.431] (-500.523) -- 0:01:23
      186500 -- (-505.494) (-505.993) [-502.173] (-499.163) * (-500.633) (-497.801) (-502.259) [-496.764] -- 0:01:22
      187000 -- [-501.691] (-498.458) (-502.174) (-503.124) * (-504.618) [-499.720] (-503.018) (-505.932) -- 0:01:22
      187500 -- (-502.096) (-502.750) [-499.649] (-510.107) * (-506.501) [-498.781] (-500.790) (-501.966) -- 0:01:22
      188000 -- [-499.901] (-497.084) (-502.639) (-505.455) * (-506.876) (-498.627) (-503.552) [-498.750] -- 0:01:22
      188500 -- (-499.225) [-499.748] (-501.904) (-501.996) * (-508.753) [-504.251] (-499.943) (-495.803) -- 0:01:21
      189000 -- (-498.408) (-497.506) [-498.530] (-499.321) * (-508.755) (-500.762) (-501.195) [-504.149] -- 0:01:21
      189500 -- (-500.093) (-499.058) [-506.409] (-502.028) * [-505.713] (-499.335) (-509.206) (-505.319) -- 0:01:21
      190000 -- (-499.181) (-505.948) (-504.579) [-500.840] * (-508.593) [-500.545] (-505.033) (-503.555) -- 0:01:21

      Average standard deviation of split frequencies: 0.003297

      190500 -- (-504.416) (-502.136) (-501.221) [-501.787] * (-507.356) (-506.221) [-507.476] (-502.999) -- 0:01:20
      191000 -- [-507.593] (-508.486) (-498.877) (-500.636) * (-504.314) (-503.806) (-505.605) [-504.365] -- 0:01:24
      191500 -- (-498.691) (-500.305) [-496.467] (-500.787) * (-503.326) (-499.420) (-510.915) [-505.963] -- 0:01:24
      192000 -- (-497.895) (-497.365) [-501.000] (-499.488) * (-505.112) (-498.678) (-506.559) [-498.763] -- 0:01:24
      192500 -- [-498.548] (-499.881) (-502.831) (-502.919) * (-501.798) (-500.942) [-510.950] (-503.425) -- 0:01:23
      193000 -- [-503.366] (-500.641) (-501.405) (-500.771) * (-502.954) (-500.242) (-506.581) [-500.531] -- 0:01:23
      193500 -- (-500.206) [-498.550] (-503.502) (-504.244) * [-503.263] (-499.382) (-507.972) (-503.090) -- 0:01:23
      194000 -- [-496.009] (-501.110) (-500.881) (-505.492) * (-505.269) (-498.027) [-503.684] (-505.744) -- 0:01:23
      194500 -- (-502.179) (-502.146) (-508.186) [-508.314] * (-497.468) (-498.540) (-506.644) [-499.894] -- 0:01:22
      195000 -- (-504.479) (-499.449) (-502.492) [-505.243] * (-502.141) (-501.626) (-506.989) [-500.554] -- 0:01:22

      Average standard deviation of split frequencies: 0.008017

      195500 -- [-501.002] (-500.085) (-498.942) (-501.961) * [-504.315] (-501.074) (-502.446) (-499.745) -- 0:01:22
      196000 -- (-502.975) [-503.092] (-500.592) (-506.135) * (-501.878) (-501.424) (-502.050) [-502.323] -- 0:01:22
      196500 -- (-500.722) (-501.639) [-499.548] (-501.723) * (-502.513) (-506.580) (-506.210) [-499.442] -- 0:01:21
      197000 -- (-500.183) (-499.038) (-502.218) [-504.214] * (-502.862) (-507.060) (-507.538) [-509.017] -- 0:01:21
      197500 -- (-500.457) [-496.743] (-501.067) (-506.638) * (-501.183) (-502.106) (-508.513) [-502.848] -- 0:01:21
      198000 -- (-503.395) (-499.908) [-500.945] (-509.852) * (-502.826) (-500.042) [-502.093] (-510.422) -- 0:01:21
      198500 -- (-502.119) [-505.637] (-497.521) (-504.145) * (-502.475) (-499.372) (-512.801) [-502.401] -- 0:01:20
      199000 -- (-500.552) (-500.552) (-499.690) [-504.532] * [-504.002] (-503.748) (-501.608) (-499.500) -- 0:01:20
      199500 -- (-506.657) (-502.495) (-499.604) [-501.930] * (-504.245) [-504.721] (-503.694) (-506.484) -- 0:01:20
      200000 -- (-510.549) (-497.202) [-495.908] (-506.530) * [-499.827] (-501.832) (-500.956) (-505.161) -- 0:01:20

      Average standard deviation of split frequencies: 0.011746

      200500 -- (-503.789) (-499.760) [-498.816] (-508.346) * (-506.078) [-499.744] (-509.143) (-504.393) -- 0:01:19
      201000 -- (-511.229) [-500.154] (-503.204) (-502.046) * [-497.942] (-496.689) (-501.143) (-498.978) -- 0:01:23
      201500 -- (-497.252) [-502.337] (-497.611) (-502.096) * [-499.356] (-495.849) (-499.231) (-499.615) -- 0:01:23
      202000 -- (-500.917) (-499.606) (-509.123) [-497.158] * (-500.242) (-499.921) (-503.189) [-500.713] -- 0:01:22
      202500 -- (-505.963) [-502.851] (-503.686) (-497.573) * (-500.546) (-501.568) [-498.547] (-507.228) -- 0:01:22
      203000 -- (-505.513) (-500.879) (-504.467) [-499.898] * (-498.986) [-498.989] (-497.401) (-502.329) -- 0:01:22
      203500 -- (-504.203) (-496.489) [-498.308] (-496.822) * [-496.947] (-501.487) (-499.998) (-503.502) -- 0:01:22
      204000 -- (-505.157) (-498.785) [-496.412] (-502.185) * (-501.213) (-500.797) (-502.803) [-503.752] -- 0:01:21
      204500 -- (-508.469) (-497.995) (-502.527) [-500.360] * (-503.622) (-498.212) [-504.488] (-511.999) -- 0:01:21
      205000 -- (-509.558) [-501.041] (-499.847) (-499.589) * (-505.944) (-501.893) [-501.603] (-504.547) -- 0:01:21

      Average standard deviation of split frequencies: 0.012967

      205500 -- (-507.073) (-501.586) [-496.413] (-501.068) * [-496.993] (-497.612) (-502.064) (-507.530) -- 0:01:21
      206000 -- (-505.515) (-500.094) (-497.934) [-502.518] * (-503.502) [-498.602] (-498.830) (-511.360) -- 0:01:20
      206500 -- [-506.922] (-502.389) (-498.047) (-504.250) * (-502.033) [-500.356] (-502.058) (-508.001) -- 0:01:20
      207000 -- (-504.996) (-504.384) [-503.174] (-502.826) * (-499.048) (-500.549) [-504.530] (-507.880) -- 0:01:20
      207500 -- (-504.078) (-499.465) (-502.857) [-502.109] * (-498.035) (-505.572) [-500.060] (-503.735) -- 0:01:20
      208000 -- (-501.595) (-498.992) (-501.043) [-510.277] * [-496.794] (-500.260) (-500.430) (-502.459) -- 0:01:19
      208500 -- (-499.654) (-502.076) (-504.380) [-503.830] * (-501.111) (-502.126) [-503.270] (-503.098) -- 0:01:19
      209000 -- (-502.530) [-502.506] (-504.109) (-506.146) * [-502.407] (-497.488) (-505.405) (-503.407) -- 0:01:19
      209500 -- (-499.187) [-503.428] (-502.503) (-511.723) * (-506.426) [-496.295] (-509.120) (-503.036) -- 0:01:19
      210000 -- (-500.319) (-499.653) [-505.032] (-502.095) * (-499.857) (-502.697) [-500.145] (-511.558) -- 0:01:19

      Average standard deviation of split frequencies: 0.009697

      210500 -- (-506.404) (-500.725) [-496.674] (-511.317) * (-498.875) [-502.359] (-503.663) (-508.768) -- 0:01:18
      211000 -- [-504.727] (-500.015) (-500.732) (-508.430) * (-498.474) [-502.622] (-500.121) (-502.440) -- 0:01:22
      211500 -- (-499.700) (-498.798) (-503.905) [-506.912] * (-498.941) [-500.826] (-497.896) (-501.002) -- 0:01:22
      212000 -- (-501.470) (-500.209) [-498.457] (-507.570) * (-497.301) [-500.804] (-506.034) (-503.667) -- 0:01:21
      212500 -- (-498.938) [-495.631] (-503.134) (-506.295) * (-498.414) (-509.773) (-500.635) [-502.283] -- 0:01:21
      213000 -- (-499.664) [-498.365] (-497.294) (-513.735) * [-499.704] (-502.762) (-499.156) (-503.154) -- 0:01:21
      213500 -- [-499.492] (-503.281) (-495.488) (-506.467) * (-502.793) [-502.231] (-497.518) (-505.494) -- 0:01:21
      214000 -- [-500.440] (-500.373) (-504.553) (-510.746) * [-502.711] (-504.402) (-503.170) (-507.092) -- 0:01:20
      214500 -- (-498.679) (-499.827) (-504.921) [-502.960] * [-499.667] (-499.884) (-500.302) (-501.729) -- 0:01:20
      215000 -- (-496.924) (-499.139) [-498.795] (-505.145) * [-502.882] (-503.458) (-504.241) (-508.853) -- 0:01:20

      Average standard deviation of split frequencies: 0.008002

      215500 -- (-503.825) (-503.086) (-502.247) [-500.405] * [-500.876] (-503.545) (-502.651) (-499.705) -- 0:01:20
      216000 -- [-501.701] (-507.910) (-507.383) (-504.739) * [-495.070] (-502.733) (-497.247) (-498.037) -- 0:01:19
      216500 -- [-500.733] (-501.633) (-506.128) (-502.704) * [-500.217] (-502.341) (-497.213) (-500.575) -- 0:01:19
      217000 -- (-497.635) (-499.038) [-502.379] (-503.525) * (-497.658) [-494.492] (-497.427) (-500.724) -- 0:01:19
      217500 -- (-500.475) (-498.558) [-499.613] (-504.262) * (-502.020) (-505.499) (-502.543) [-500.745] -- 0:01:19
      218000 -- (-496.577) (-503.025) (-500.796) [-506.679] * (-503.742) [-500.396] (-502.284) (-504.343) -- 0:01:18
      218500 -- (-498.986) (-508.444) [-499.619] (-505.277) * (-505.824) (-500.905) [-499.587] (-503.531) -- 0:01:18
      219000 -- (-500.498) [-496.702] (-497.897) (-499.869) * (-498.235) [-505.130] (-500.463) (-502.561) -- 0:01:18
      219500 -- [-499.320] (-500.743) (-498.948) (-503.207) * (-503.935) [-504.425] (-498.260) (-502.633) -- 0:01:18
      220000 -- (-498.339) [-499.530] (-497.533) (-503.586) * [-499.830] (-498.194) (-502.862) (-502.361) -- 0:01:18

      Average standard deviation of split frequencies: 0.011393

      220500 -- (-500.996) [-499.506] (-498.226) (-502.894) * (-501.220) [-499.088] (-498.622) (-503.506) -- 0:01:17
      221000 -- (-505.245) [-502.206] (-501.317) (-503.719) * (-502.494) (-502.885) [-503.268] (-505.894) -- 0:01:21
      221500 -- (-497.455) [-499.133] (-498.995) (-502.757) * (-503.735) [-497.436] (-502.653) (-501.681) -- 0:01:20
      222000 -- [-500.375] (-498.367) (-498.016) (-506.352) * (-502.693) (-502.045) [-504.477] (-502.960) -- 0:01:20
      222500 -- (-499.167) (-506.922) [-497.787] (-504.490) * (-502.130) (-499.988) (-505.205) [-496.677] -- 0:01:20
      223000 -- (-501.745) (-507.602) [-499.749] (-504.636) * [-502.454] (-500.486) (-508.122) (-505.154) -- 0:01:20
      223500 -- (-501.777) (-505.379) [-501.895] (-500.602) * (-499.535) [-502.547] (-503.057) (-500.139) -- 0:01:19
      224000 -- (-498.857) (-499.038) (-497.644) [-499.338] * (-505.564) (-505.440) [-510.262] (-503.255) -- 0:01:19
      224500 -- (-498.616) (-505.086) [-499.163] (-500.348) * [-502.107] (-505.849) (-502.170) (-506.735) -- 0:01:19
      225000 -- [-497.832] (-504.749) (-498.761) (-500.581) * [-508.528] (-497.043) (-502.203) (-500.925) -- 0:01:19

      Average standard deviation of split frequencies: 0.008343

      225500 -- (-498.460) [-498.637] (-504.510) (-501.995) * (-500.380) [-496.733] (-498.547) (-507.932) -- 0:01:18
      226000 -- (-504.489) (-505.261) [-505.418] (-503.670) * (-505.742) (-500.721) [-500.732] (-502.770) -- 0:01:18
      226500 -- (-503.353) [-496.527] (-509.932) (-505.719) * (-511.453) (-498.574) (-501.763) [-500.291] -- 0:01:18
      227000 -- (-505.074) (-496.268) (-502.968) [-503.615] * (-505.874) (-505.200) (-501.751) [-500.516] -- 0:01:18
      227500 -- (-508.117) [-500.290] (-501.954) (-501.183) * [-500.399] (-498.314) (-507.787) (-502.376) -- 0:01:18
      228000 -- (-500.809) (-504.350) (-507.663) [-503.806] * (-501.394) [-498.939] (-509.450) (-510.786) -- 0:01:17
      228500 -- [-497.291] (-498.190) (-502.403) (-503.029) * [-502.410] (-499.587) (-506.402) (-504.182) -- 0:01:17
      229000 -- (-500.636) (-507.263) (-499.742) [-502.229] * (-501.675) [-499.423] (-506.980) (-501.267) -- 0:01:17
      229500 -- (-501.101) (-507.639) [-500.558] (-504.949) * [-501.492] (-501.903) (-512.305) (-507.680) -- 0:01:17
      230000 -- (-498.211) [-501.066] (-502.283) (-501.070) * (-501.565) [-499.509] (-509.807) (-502.587) -- 0:01:17

      Average standard deviation of split frequencies: 0.005450

      230500 -- (-501.863) [-505.194] (-500.302) (-498.679) * [-504.576] (-497.424) (-512.002) (-506.346) -- 0:01:16
      231000 -- [-501.355] (-503.991) (-505.167) (-504.605) * (-508.612) (-498.804) (-509.615) [-504.860] -- 0:01:16
      231500 -- (-496.912) (-502.605) (-503.007) [-501.246] * (-507.923) [-498.671] (-504.683) (-503.298) -- 0:01:19
      232000 -- (-500.094) [-496.918] (-504.762) (-502.842) * (-502.601) (-502.624) (-505.374) [-503.609] -- 0:01:19
      232500 -- [-497.059] (-501.393) (-505.730) (-498.936) * [-501.950] (-505.784) (-507.297) (-507.281) -- 0:01:19
      233000 -- [-498.458] (-495.097) (-500.116) (-499.828) * (-515.831) [-500.267] (-502.615) (-501.038) -- 0:01:19
      233500 -- (-499.947) (-497.776) [-505.288] (-500.962) * (-511.628) (-499.403) [-507.853] (-503.788) -- 0:01:18
      234000 -- (-504.451) (-506.338) [-504.650] (-508.376) * [-505.471] (-499.314) (-504.581) (-501.256) -- 0:01:18
      234500 -- (-504.906) [-497.952] (-500.229) (-498.678) * (-505.242) (-505.441) [-502.583] (-506.262) -- 0:01:18
      235000 -- [-499.256] (-500.548) (-498.827) (-500.407) * [-500.335] (-501.589) (-502.741) (-507.050) -- 0:01:18

      Average standard deviation of split frequencies: 0.001997

      235500 -- (-503.115) [-497.854] (-498.725) (-499.056) * (-507.025) [-496.605] (-505.182) (-506.244) -- 0:01:17
      236000 -- (-501.280) (-495.778) (-501.259) [-500.976] * (-506.015) [-496.192] (-502.185) (-500.268) -- 0:01:17
      236500 -- (-500.802) (-505.042) [-496.974] (-504.859) * (-502.370) [-499.935] (-500.942) (-501.476) -- 0:01:17
      237000 -- (-499.082) [-502.511] (-496.163) (-500.221) * (-507.204) (-500.907) (-503.132) [-502.805] -- 0:01:17
      237500 -- (-496.380) (-501.443) (-502.416) [-501.829] * [-501.439] (-500.027) (-501.186) (-504.259) -- 0:01:17
      238000 -- (-498.781) [-500.691] (-499.806) (-503.732) * (-506.069) (-498.332) (-503.159) [-500.108] -- 0:01:16
      238500 -- (-504.391) (-497.819) [-502.784] (-501.753) * (-507.392) [-497.121] (-501.951) (-500.836) -- 0:01:16
      239000 -- (-506.308) [-496.527] (-497.788) (-499.712) * (-504.143) (-501.608) [-516.823] (-502.919) -- 0:01:16
      239500 -- (-503.131) (-501.124) [-496.311] (-504.307) * (-505.780) [-498.095] (-501.963) (-497.700) -- 0:01:16
      240000 -- (-507.448) (-502.124) (-497.434) [-498.815] * (-510.362) (-497.916) [-496.129] (-502.992) -- 0:01:16

      Average standard deviation of split frequencies: 0.002612

      240500 -- (-500.626) [-497.781] (-500.753) (-499.500) * (-508.224) (-506.527) (-500.901) [-498.877] -- 0:01:15
      241000 -- (-498.314) [-497.397] (-505.650) (-508.294) * (-504.882) [-499.809] (-499.999) (-501.577) -- 0:01:15
      241500 -- (-496.084) [-498.888] (-503.229) (-504.415) * (-509.514) (-502.793) (-497.687) [-502.207] -- 0:01:18
      242000 -- (-500.629) [-499.967] (-499.690) (-501.037) * (-509.244) (-507.130) (-498.583) [-501.425] -- 0:01:18
      242500 -- [-503.110] (-501.027) (-502.234) (-503.009) * (-507.578) [-503.408] (-498.856) (-509.330) -- 0:01:18
      243000 -- (-508.493) (-500.225) (-506.410) [-500.272] * (-504.875) (-503.853) [-501.939] (-498.127) -- 0:01:17
      243500 -- (-506.583) (-500.330) (-509.127) [-508.635] * (-504.254) (-500.161) [-499.438] (-495.651) -- 0:01:17
      244000 -- (-506.147) [-501.342] (-503.373) (-499.596) * (-501.014) (-499.028) [-499.782] (-498.707) -- 0:01:17
      244500 -- (-509.468) (-507.633) [-499.723] (-502.786) * (-508.093) [-499.531] (-499.227) (-500.445) -- 0:01:17
      245000 -- [-504.825] (-503.697) (-500.483) (-503.789) * (-500.492) (-498.517) (-506.418) [-500.438] -- 0:01:17

      Average standard deviation of split frequencies: 0.001278

      245500 -- (-500.603) (-513.646) [-501.188] (-498.893) * [-498.199] (-498.569) (-503.433) (-499.512) -- 0:01:16
      246000 -- (-500.441) [-497.082] (-500.254) (-500.612) * (-498.210) (-498.843) (-507.332) [-497.386] -- 0:01:16
      246500 -- (-502.428) (-502.142) (-501.799) [-503.728] * (-499.239) [-501.032] (-498.872) (-498.400) -- 0:01:16
      247000 -- (-503.418) (-503.413) [-497.881] (-500.562) * (-500.376) (-496.698) [-499.221] (-501.690) -- 0:01:16
      247500 -- (-502.877) (-510.745) (-507.241) [-500.615] * (-498.948) (-500.070) (-499.245) [-501.042] -- 0:01:16
      248000 -- [-498.100] (-500.183) (-497.046) (-502.345) * (-502.605) (-503.804) [-499.330] (-499.239) -- 0:01:15
      248500 -- [-496.691] (-499.698) (-502.633) (-504.684) * (-502.374) [-504.230] (-500.487) (-510.874) -- 0:01:15
      249000 -- (-500.026) (-503.496) [-495.959] (-504.729) * [-500.873] (-503.694) (-500.680) (-500.951) -- 0:01:15
      249500 -- (-502.863) (-502.896) [-500.361] (-502.215) * [-499.280] (-497.829) (-499.142) (-500.142) -- 0:01:15
      250000 -- (-498.715) (-498.862) [-496.662] (-502.683) * (-497.695) (-501.365) [-495.445] (-496.493) -- 0:01:15

      Average standard deviation of split frequencies: 0.004388

      250500 -- (-500.366) (-502.071) (-502.839) [-503.721] * (-506.569) (-499.084) [-498.879] (-498.048) -- 0:01:14
      251000 -- (-500.577) (-501.632) [-503.504] (-495.081) * (-499.461) [-498.279] (-500.324) (-500.612) -- 0:01:14
      251500 -- (-498.797) [-498.592] (-496.937) (-503.779) * [-506.700] (-501.762) (-497.238) (-501.875) -- 0:01:17
      252000 -- (-504.403) (-503.036) [-500.604] (-504.895) * (-501.576) (-500.426) (-501.417) [-502.293] -- 0:01:17
      252500 -- (-500.778) [-500.982] (-506.669) (-503.728) * [-504.895] (-500.780) (-499.755) (-511.883) -- 0:01:16
      253000 -- [-500.393] (-504.961) (-505.013) (-505.705) * (-504.491) (-498.517) (-504.269) [-502.640] -- 0:01:16
      253500 -- [-501.306] (-505.772) (-504.023) (-502.753) * [-500.395] (-501.528) (-501.171) (-509.286) -- 0:01:16
      254000 -- [-503.652] (-498.692) (-498.415) (-505.989) * (-499.580) [-500.725] (-503.612) (-504.979) -- 0:01:16
      254500 -- (-499.476) (-497.258) [-500.708] (-506.075) * (-500.953) (-500.630) (-499.765) [-508.462] -- 0:01:16
      255000 -- (-502.944) (-496.001) [-500.379] (-499.340) * [-500.334] (-506.598) (-499.189) (-506.839) -- 0:01:15

      Average standard deviation of split frequencies: 0.006138

      255500 -- (-508.744) (-499.484) [-503.247] (-502.779) * (-503.936) (-508.703) [-497.532] (-510.756) -- 0:01:15
      256000 -- [-502.603] (-501.580) (-502.802) (-501.405) * (-506.764) (-502.831) (-502.856) [-499.809] -- 0:01:15
      256500 -- (-504.808) (-499.287) (-503.928) [-500.947] * [-502.833] (-508.598) (-498.565) (-500.581) -- 0:01:15
      257000 -- (-505.748) [-498.739] (-499.965) (-496.463) * (-509.452) (-505.777) (-507.350) [-498.679] -- 0:01:15
      257500 -- [-500.129] (-497.476) (-502.317) (-503.664) * [-501.113] (-501.270) (-496.058) (-498.094) -- 0:01:14
      258000 -- [-500.663] (-498.315) (-498.904) (-498.477) * (-505.532) (-497.689) [-498.254] (-502.553) -- 0:01:14
      258500 -- (-502.599) [-500.886] (-498.163) (-503.867) * (-508.071) [-500.630] (-504.969) (-505.059) -- 0:01:14
      259000 -- [-500.397] (-505.585) (-500.519) (-503.434) * (-507.794) (-505.017) [-498.636] (-500.928) -- 0:01:14
      259500 -- (-497.972) (-501.252) (-498.844) [-500.106] * (-506.545) (-501.025) (-501.865) [-503.296] -- 0:01:14
      260000 -- (-504.470) (-503.008) (-497.775) [-497.962] * (-504.741) (-502.206) [-500.142] (-501.654) -- 0:01:14

      Average standard deviation of split frequencies: 0.007234

      260500 -- [-501.378] (-503.302) (-496.209) (-498.101) * (-508.302) (-499.537) (-500.585) [-504.295] -- 0:01:13
      261000 -- [-502.449] (-503.766) (-496.632) (-499.193) * (-508.530) [-504.640] (-501.100) (-500.820) -- 0:01:13
      261500 -- (-498.071) [-503.857] (-503.186) (-507.419) * (-503.982) [-506.698] (-504.494) (-497.725) -- 0:01:13
      262000 -- (-505.103) [-498.786] (-504.194) (-500.528) * (-505.405) [-501.244] (-507.823) (-496.750) -- 0:01:16
      262500 -- (-501.226) [-502.532] (-502.976) (-496.768) * (-515.234) (-502.261) (-507.095) [-499.301] -- 0:01:15
      263000 -- (-503.339) [-502.162] (-496.184) (-502.085) * (-512.168) (-500.752) (-503.809) [-497.834] -- 0:01:15
      263500 -- (-503.436) (-500.633) (-498.644) [-503.047] * (-506.218) [-500.866] (-509.274) (-497.788) -- 0:01:15
      264000 -- (-504.373) (-500.867) [-509.357] (-502.728) * (-511.229) (-505.929) (-501.218) [-498.061] -- 0:01:15
      264500 -- [-505.609] (-502.133) (-501.185) (-500.744) * (-510.360) (-502.218) [-510.264] (-499.811) -- 0:01:15
      265000 -- [-505.528] (-499.163) (-500.526) (-502.589) * (-504.885) (-505.135) (-506.676) [-497.416] -- 0:01:14

      Average standard deviation of split frequencies: 0.007089

      265500 -- (-510.824) (-500.220) (-500.587) [-506.090] * (-504.243) (-502.903) (-501.275) [-500.494] -- 0:01:14
      266000 -- [-505.723] (-499.825) (-497.583) (-500.935) * (-502.999) [-500.463] (-508.585) (-498.812) -- 0:01:14
      266500 -- (-501.628) [-502.266] (-498.078) (-498.464) * (-506.570) (-496.823) [-497.878] (-499.980) -- 0:01:14
      267000 -- (-507.619) (-506.129) [-497.309] (-502.402) * (-508.032) (-500.724) [-499.889] (-498.837) -- 0:01:14
      267500 -- (-498.715) (-498.918) (-497.157) [-502.686] * (-506.591) (-498.947) [-498.723] (-497.611) -- 0:01:13
      268000 -- (-505.349) [-500.397] (-497.654) (-501.979) * (-514.583) (-502.185) (-497.293) [-498.151] -- 0:01:13
      268500 -- (-505.735) [-499.913] (-501.325) (-498.989) * (-511.093) (-499.286) [-497.735] (-502.949) -- 0:01:13
      269000 -- (-502.941) (-500.659) [-497.722] (-498.815) * (-506.249) [-501.338] (-497.980) (-505.986) -- 0:01:13
      269500 -- (-505.555) (-504.126) [-494.913] (-510.614) * (-501.109) [-498.156] (-500.507) (-498.837) -- 0:01:13
      270000 -- (-505.958) (-499.481) (-502.465) [-505.531] * (-506.547) [-502.541] (-502.071) (-499.253) -- 0:01:13

      Average standard deviation of split frequencies: 0.008708

      270500 -- [-508.288] (-510.571) (-501.461) (-509.067) * (-502.453) (-502.782) (-497.904) [-497.060] -- 0:01:12
      271000 -- (-504.597) (-507.603) (-498.740) [-503.413] * (-506.414) (-505.821) [-497.849] (-500.879) -- 0:01:12
      271500 -- (-503.800) [-502.943] (-495.854) (-500.835) * (-512.376) (-501.619) (-500.590) [-498.756] -- 0:01:12
      272000 -- (-503.771) (-505.589) (-500.136) [-512.564] * (-503.708) (-504.128) [-498.321] (-496.619) -- 0:01:14
      272500 -- (-498.308) [-503.034] (-506.628) (-503.910) * (-516.656) (-502.098) (-503.212) [-500.215] -- 0:01:14
      273000 -- (-498.355) (-500.971) (-499.523) [-502.010] * [-502.774] (-509.714) (-499.198) (-504.826) -- 0:01:14
      273500 -- (-499.515) (-503.760) [-501.394] (-510.312) * (-505.480) [-497.462] (-499.191) (-501.464) -- 0:01:14
      274000 -- [-501.570] (-506.575) (-499.510) (-507.918) * (-505.893) (-501.699) [-504.428] (-498.376) -- 0:01:14
      274500 -- (-502.196) (-501.889) [-499.791] (-519.144) * (-500.022) (-503.988) (-502.942) [-498.239] -- 0:01:14
      275000 -- [-498.828] (-501.747) (-504.993) (-509.121) * (-497.695) (-504.678) [-498.188] (-501.763) -- 0:01:13

      Average standard deviation of split frequencies: 0.010248

      275500 -- (-498.926) [-505.753] (-498.116) (-506.376) * (-497.301) (-499.155) [-500.235] (-498.497) -- 0:01:13
      276000 -- [-501.010] (-503.815) (-500.651) (-509.302) * [-501.117] (-500.345) (-500.677) (-501.851) -- 0:01:13
      276500 -- (-503.967) [-505.475] (-500.664) (-509.953) * (-509.876) (-499.112) [-499.890] (-499.010) -- 0:01:13
      277000 -- [-499.055] (-504.868) (-497.374) (-510.943) * (-497.988) (-498.954) (-501.734) [-506.826] -- 0:01:13
      277500 -- (-497.983) (-500.481) [-502.874] (-511.089) * [-498.799] (-500.673) (-501.178) (-497.098) -- 0:01:12
      278000 -- (-504.711) [-497.800] (-497.889) (-505.206) * (-502.491) (-497.748) (-502.390) [-499.801] -- 0:01:12
      278500 -- (-503.967) (-502.038) [-495.955] (-502.800) * (-497.785) [-496.665] (-504.222) (-498.786) -- 0:01:12
      279000 -- (-500.059) (-502.134) (-501.077) [-503.311] * [-501.675] (-500.900) (-502.131) (-503.486) -- 0:01:12
      279500 -- [-503.993] (-502.542) (-497.091) (-505.937) * (-505.500) [-496.555] (-502.495) (-500.358) -- 0:01:12
      280000 -- [-499.696] (-499.899) (-495.772) (-500.037) * (-496.779) [-498.109] (-503.173) (-506.990) -- 0:01:12

      Average standard deviation of split frequencies: 0.011197

      280500 -- (-497.906) [-500.807] (-501.813) (-500.891) * [-497.085] (-498.372) (-501.193) (-502.589) -- 0:01:11
      281000 -- (-501.426) (-500.411) [-499.268] (-502.447) * (-502.818) [-497.042] (-499.638) (-503.634) -- 0:01:11
      281500 -- (-497.185) (-508.957) (-500.008) [-503.202] * (-501.981) (-506.871) [-496.921] (-502.030) -- 0:01:11
      282000 -- [-497.557] (-502.876) (-501.830) (-508.278) * (-495.865) [-495.216] (-501.369) (-506.382) -- 0:01:11
      282500 -- (-502.795) [-507.293] (-497.561) (-504.586) * (-499.331) [-503.057] (-502.170) (-506.461) -- 0:01:13
      283000 -- (-500.932) [-499.239] (-494.527) (-507.500) * [-505.619] (-501.996) (-501.232) (-500.262) -- 0:01:13
      283500 -- (-500.490) [-505.588] (-498.654) (-506.220) * (-511.118) [-500.583] (-496.402) (-495.881) -- 0:01:13
      284000 -- (-501.861) (-501.574) [-501.832] (-505.428) * (-497.530) (-497.686) (-497.461) [-500.842] -- 0:01:13
      284500 -- (-496.448) (-502.370) (-501.546) [-502.708] * (-499.060) (-497.914) (-501.800) [-498.623] -- 0:01:12
      285000 -- (-499.985) [-500.928] (-498.391) (-506.496) * (-507.440) [-502.519] (-503.540) (-501.949) -- 0:01:12

      Average standard deviation of split frequencies: 0.010988

      285500 -- (-506.038) [-498.339] (-496.603) (-505.481) * [-502.749] (-498.289) (-505.018) (-500.011) -- 0:01:12
      286000 -- [-506.500] (-500.018) (-498.892) (-506.867) * [-501.922] (-502.693) (-508.934) (-499.212) -- 0:01:12
      286500 -- (-507.194) [-498.677] (-502.498) (-512.408) * (-507.781) (-500.508) (-506.003) [-499.930] -- 0:01:12
      287000 -- (-505.485) (-503.131) [-498.090] (-501.306) * [-502.916] (-508.784) (-510.914) (-502.745) -- 0:01:12
      287500 -- [-502.032] (-501.956) (-497.524) (-504.176) * [-496.466] (-503.571) (-506.265) (-504.844) -- 0:01:11
      288000 -- (-499.617) (-501.118) (-503.774) [-502.700] * (-501.375) (-499.950) (-500.591) [-504.001] -- 0:01:11
      288500 -- (-504.121) (-500.339) [-502.118] (-497.488) * (-497.662) [-506.452] (-503.444) (-500.608) -- 0:01:11
      289000 -- (-512.315) [-496.629] (-503.748) (-501.678) * (-501.790) (-506.619) (-506.604) [-502.114] -- 0:01:11
      289500 -- [-505.570] (-500.444) (-503.421) (-505.578) * (-500.599) (-502.146) [-501.939] (-497.302) -- 0:01:11
      290000 -- (-502.849) [-497.990] (-507.315) (-506.196) * (-503.006) (-501.980) (-505.116) [-498.866] -- 0:01:11

      Average standard deviation of split frequencies: 0.012434

      290500 -- (-505.266) [-496.384] (-502.065) (-501.909) * (-497.613) (-504.964) (-502.431) [-498.580] -- 0:01:10
      291000 -- [-500.635] (-500.436) (-501.577) (-506.899) * [-496.512] (-504.365) (-510.010) (-501.133) -- 0:01:10
      291500 -- [-502.418] (-500.567) (-505.436) (-499.894) * (-498.671) (-507.386) [-503.517] (-500.891) -- 0:01:10
      292000 -- [-497.583] (-502.973) (-500.087) (-500.809) * (-506.898) (-501.397) [-504.523] (-502.600) -- 0:01:10
      292500 -- (-497.510) [-501.743] (-503.721) (-498.396) * (-501.346) (-500.196) [-503.291] (-497.688) -- 0:01:12
      293000 -- [-499.531] (-499.162) (-509.871) (-503.727) * (-498.961) (-500.818) (-501.701) [-501.096] -- 0:01:12
      293500 -- [-505.260] (-499.413) (-500.155) (-501.022) * (-500.294) (-501.935) [-501.346] (-498.332) -- 0:01:12
      294000 -- (-501.024) (-501.252) (-507.353) [-507.177] * (-500.101) (-502.858) (-502.231) [-502.432] -- 0:01:12
      294500 -- (-502.224) [-500.588] (-506.707) (-501.440) * (-501.977) (-506.684) [-501.836] (-496.466) -- 0:01:11
      295000 -- [-504.356] (-498.896) (-506.705) (-503.672) * (-499.906) [-501.428] (-502.339) (-499.663) -- 0:01:11

      Average standard deviation of split frequencies: 0.012210

      295500 -- [-501.353] (-506.716) (-502.733) (-508.073) * [-498.779] (-500.640) (-505.066) (-506.898) -- 0:01:11
      296000 -- (-499.121) [-498.668] (-507.863) (-503.880) * (-500.009) (-502.630) [-500.584] (-500.630) -- 0:01:11
      296500 -- (-503.453) [-500.032] (-507.541) (-503.561) * (-503.110) (-505.061) (-501.515) [-499.926] -- 0:01:11
      297000 -- (-500.143) [-500.062] (-505.946) (-504.582) * (-500.435) (-506.395) [-498.789] (-504.096) -- 0:01:11
      297500 -- (-498.938) [-503.833] (-506.432) (-506.526) * (-502.472) (-502.141) (-504.100) [-501.127] -- 0:01:10
      298000 -- (-502.737) (-505.011) [-502.847] (-510.842) * (-501.152) [-499.008] (-502.016) (-505.682) -- 0:01:10
      298500 -- (-498.444) (-502.107) [-507.104] (-501.508) * (-506.222) (-501.904) (-498.332) [-500.360] -- 0:01:10
      299000 -- (-506.445) (-501.108) (-511.002) [-501.749] * (-497.767) (-503.270) (-500.025) [-501.578] -- 0:01:10
      299500 -- (-502.152) (-506.867) [-502.927] (-502.188) * (-505.791) (-501.019) [-500.517] (-499.371) -- 0:01:10
      300000 -- [-501.120] (-507.919) (-502.254) (-505.855) * (-500.768) (-500.892) (-502.760) [-499.234] -- 0:01:10

      Average standard deviation of split frequencies: 0.012020

      300500 -- (-505.929) [-507.497] (-502.278) (-506.122) * (-501.935) (-510.022) [-501.506] (-502.195) -- 0:01:09
      301000 -- [-499.118] (-502.405) (-506.249) (-500.379) * (-503.846) (-501.655) (-508.757) [-502.037] -- 0:01:09
      301500 -- (-504.766) [-499.385] (-507.630) (-504.736) * (-501.959) [-498.379] (-504.019) (-499.324) -- 0:01:09
      302000 -- (-504.127) [-501.763] (-502.517) (-498.347) * (-502.255) (-502.721) (-503.774) [-503.526] -- 0:01:09
      302500 -- (-503.845) (-504.631) (-506.931) [-499.552] * (-499.367) (-502.958) (-505.683) [-497.401] -- 0:01:11
      303000 -- (-507.354) (-502.491) (-500.158) [-498.064] * [-499.091] (-499.840) (-502.536) (-502.308) -- 0:01:11
      303500 -- (-509.470) (-503.662) (-506.980) [-495.771] * [-496.617] (-506.228) (-499.200) (-500.446) -- 0:01:11
      304000 -- (-505.292) (-500.232) (-502.812) [-497.996] * (-499.557) (-500.380) (-503.015) [-507.183] -- 0:01:10
      304500 -- (-503.403) (-505.594) (-501.713) [-498.901] * (-498.181) [-506.988] (-496.146) (-500.377) -- 0:01:10
      305000 -- (-500.397) (-498.951) (-498.679) [-498.180] * (-503.864) [-503.519] (-499.831) (-499.733) -- 0:01:10

      Average standard deviation of split frequencies: 0.011811

      305500 -- (-500.507) (-501.924) (-501.893) [-498.828] * [-501.512] (-501.142) (-497.980) (-499.331) -- 0:01:10
      306000 -- (-500.613) (-501.956) (-505.183) [-499.420] * (-504.513) (-503.291) (-497.757) [-500.168] -- 0:01:10
      306500 -- [-505.135] (-503.077) (-502.527) (-505.927) * [-500.189] (-500.438) (-500.425) (-503.191) -- 0:01:10
      307000 -- (-500.489) (-501.254) [-499.410] (-500.748) * (-496.459) (-504.365) [-506.383] (-500.344) -- 0:01:09
      307500 -- (-499.746) (-503.461) [-500.256] (-503.027) * [-500.017] (-506.261) (-508.358) (-503.736) -- 0:01:09
      308000 -- (-503.364) [-503.086] (-499.863) (-499.520) * (-507.274) (-501.433) [-507.783] (-500.696) -- 0:01:09
      308500 -- (-498.924) (-506.867) [-500.112] (-504.252) * (-497.888) [-501.524] (-504.892) (-503.741) -- 0:01:09
      309000 -- [-501.160] (-498.889) (-502.311) (-500.526) * [-499.672] (-505.230) (-505.799) (-503.536) -- 0:01:09
      309500 -- (-498.322) [-496.817] (-499.830) (-505.018) * (-501.707) (-504.395) (-498.269) [-501.027] -- 0:01:09
      310000 -- (-505.782) (-504.912) [-508.273] (-500.871) * (-501.433) (-500.614) (-500.453) [-495.056] -- 0:01:09

      Average standard deviation of split frequencies: 0.011633

      310500 -- [-501.233] (-500.799) (-502.324) (-497.737) * (-501.692) [-499.080] (-504.230) (-501.770) -- 0:01:08
      311000 -- (-502.318) (-506.873) [-500.725] (-501.068) * (-503.127) [-505.127] (-500.900) (-503.545) -- 0:01:08
      311500 -- (-497.202) (-501.819) [-496.494] (-500.825) * (-501.445) [-505.988] (-499.955) (-499.188) -- 0:01:08
      312000 -- (-503.147) [-497.657] (-500.216) (-499.385) * [-500.160] (-502.776) (-507.599) (-500.872) -- 0:01:08
      312500 -- (-499.146) (-499.831) (-497.804) [-500.762] * [-503.262] (-499.931) (-499.329) (-496.237) -- 0:01:08
      313000 -- (-498.660) (-496.762) [-497.529] (-507.310) * (-505.940) [-497.447] (-497.280) (-495.837) -- 0:01:10
      313500 -- (-507.688) [-497.446] (-498.560) (-499.633) * [-501.856] (-499.605) (-497.062) (-502.425) -- 0:01:10
      314000 -- [-504.644] (-497.034) (-499.530) (-508.958) * [-512.980] (-498.042) (-501.502) (-501.629) -- 0:01:09
      314500 -- [-511.861] (-499.755) (-503.525) (-501.443) * (-498.266) (-506.764) [-498.021] (-497.638) -- 0:01:09
      315000 -- (-502.147) (-498.893) [-499.858] (-498.251) * (-500.034) (-508.038) (-499.125) [-496.779] -- 0:01:09

      Average standard deviation of split frequencies: 0.013426

      315500 -- [-500.007] (-497.818) (-499.365) (-502.743) * (-502.245) [-509.072] (-497.800) (-502.896) -- 0:01:09
      316000 -- (-503.416) (-495.963) [-498.163] (-497.738) * (-498.044) (-502.230) [-498.828] (-501.077) -- 0:01:09
      316500 -- (-499.254) (-503.513) [-499.314] (-500.505) * (-498.355) (-500.973) (-501.384) [-498.592] -- 0:01:09
      317000 -- (-498.728) [-498.337] (-504.044) (-511.378) * (-503.400) (-500.782) (-508.064) [-502.244] -- 0:01:08
      317500 -- (-507.074) [-503.356] (-502.625) (-500.533) * (-503.036) (-501.046) (-500.355) [-504.844] -- 0:01:08
      318000 -- (-503.306) (-498.444) [-501.670] (-495.553) * (-501.743) [-506.961] (-496.879) (-497.379) -- 0:01:08
      318500 -- (-504.187) [-502.035] (-498.480) (-501.204) * (-503.703) (-498.453) [-496.937] (-495.437) -- 0:01:08
      319000 -- (-497.914) (-498.011) [-502.916] (-502.517) * (-502.187) (-500.819) (-503.144) [-496.082] -- 0:01:08
      319500 -- (-502.316) (-505.451) [-497.701] (-506.393) * [-505.073] (-500.504) (-507.824) (-500.670) -- 0:01:08
      320000 -- (-499.729) (-501.484) [-496.761] (-498.383) * (-497.059) (-497.763) (-505.599) [-498.704] -- 0:01:08

      Average standard deviation of split frequencies: 0.012741

      320500 -- (-498.187) (-500.013) (-503.874) [-500.984] * [-499.458] (-498.706) (-497.052) (-499.570) -- 0:01:07
      321000 -- (-503.980) [-505.698] (-499.392) (-498.497) * (-504.185) (-503.449) [-499.865] (-502.123) -- 0:01:07
      321500 -- (-502.656) (-502.391) [-501.399] (-501.937) * [-500.007] (-504.558) (-500.876) (-500.005) -- 0:01:07
      322000 -- (-503.284) (-498.353) [-498.075] (-498.661) * [-500.347] (-501.209) (-498.918) (-498.878) -- 0:01:07
      322500 -- (-499.239) (-496.040) (-498.320) [-500.997] * (-501.530) (-501.966) (-501.323) [-501.506] -- 0:01:07
      323000 -- (-496.566) (-501.942) [-504.256] (-498.676) * [-498.740] (-503.804) (-505.784) (-497.838) -- 0:01:09
      323500 -- (-497.416) [-501.284] (-502.071) (-498.679) * (-499.770) [-498.737] (-504.165) (-502.536) -- 0:01:09
      324000 -- (-503.157) [-502.732] (-501.277) (-503.491) * (-499.643) [-507.084] (-498.187) (-501.167) -- 0:01:08
      324500 -- [-501.126] (-501.596) (-500.581) (-498.673) * (-503.466) (-505.906) (-495.979) [-497.304] -- 0:01:08
      325000 -- (-501.622) (-504.631) [-502.425] (-501.397) * (-501.153) [-497.770] (-499.024) (-501.158) -- 0:01:08

      Average standard deviation of split frequencies: 0.013014

      325500 -- [-499.759] (-500.169) (-497.825) (-502.274) * [-500.748] (-501.771) (-502.742) (-502.920) -- 0:01:08
      326000 -- (-503.677) (-503.595) [-496.084] (-499.965) * (-501.797) (-502.152) (-496.929) [-495.151] -- 0:01:08
      326500 -- (-503.665) (-507.108) [-496.447] (-498.418) * [-503.234] (-499.801) (-502.205) (-499.961) -- 0:01:08
      327000 -- (-501.851) (-501.854) (-501.015) [-501.508] * (-503.767) (-497.433) (-500.197) [-496.271] -- 0:01:07
      327500 -- (-505.684) (-508.221) (-500.773) [-497.662] * [-501.493] (-506.659) (-500.518) (-502.884) -- 0:01:07
      328000 -- (-500.818) (-502.492) (-499.697) [-503.200] * (-502.119) [-494.997] (-506.327) (-508.231) -- 0:01:07
      328500 -- (-501.437) (-503.053) [-499.752] (-504.076) * (-505.629) (-500.641) (-512.396) [-497.952] -- 0:01:07
      329000 -- [-506.558] (-504.775) (-507.795) (-506.363) * (-499.446) (-497.732) [-499.643] (-502.263) -- 0:01:07
      329500 -- (-500.342) (-511.724) (-501.297) [-501.664] * (-501.274) [-497.140] (-497.139) (-503.194) -- 0:01:07
      330000 -- (-499.338) (-507.312) [-504.460] (-504.267) * (-499.542) [-500.637] (-498.371) (-503.486) -- 0:01:07

      Average standard deviation of split frequencies: 0.013781

      330500 -- (-502.240) (-507.645) (-504.483) [-504.721] * (-501.549) [-497.483] (-507.222) (-500.172) -- 0:01:06
      331000 -- (-497.269) (-502.867) [-501.785] (-502.130) * (-507.236) (-499.264) (-508.577) [-498.461] -- 0:01:06
      331500 -- [-500.884] (-506.045) (-503.684) (-503.901) * (-505.968) (-500.464) (-501.883) [-498.170] -- 0:01:06
      332000 -- (-502.879) [-504.802] (-498.962) (-508.372) * (-503.899) [-499.137] (-505.271) (-506.042) -- 0:01:06
      332500 -- (-497.641) [-500.733] (-500.902) (-501.180) * (-506.484) (-504.786) [-501.164] (-504.925) -- 0:01:06
      333000 -- (-504.492) (-505.770) (-498.218) [-506.336] * (-504.825) (-501.070) (-503.506) [-502.437] -- 0:01:06
      333500 -- [-502.251] (-502.898) (-503.543) (-508.340) * (-502.870) (-504.027) (-498.180) [-499.730] -- 0:01:07
      334000 -- (-498.889) [-504.285] (-505.826) (-507.331) * (-501.284) [-497.280] (-503.432) (-502.079) -- 0:01:07
      334500 -- (-505.935) [-499.116] (-500.001) (-506.668) * (-510.203) (-510.495) [-503.237] (-502.809) -- 0:01:07
      335000 -- [-496.849] (-502.635) (-498.645) (-504.418) * (-508.158) (-501.132) (-497.698) [-498.033] -- 0:01:07

      Average standard deviation of split frequencies: 0.015433

      335500 -- (-499.597) (-503.900) [-498.208] (-509.339) * (-506.029) [-500.819] (-501.036) (-496.636) -- 0:01:07
      336000 -- [-495.736] (-503.248) (-498.282) (-503.881) * (-507.805) [-500.393] (-499.627) (-497.636) -- 0:01:07
      336500 -- [-497.248] (-503.526) (-497.000) (-508.539) * (-504.087) (-503.565) (-502.617) [-498.772] -- 0:01:07
      337000 -- (-502.762) (-498.902) [-499.297] (-505.384) * (-501.049) [-498.251] (-496.238) (-501.356) -- 0:01:06
      337500 -- [-500.797] (-500.654) (-498.924) (-514.113) * [-505.063] (-500.415) (-496.622) (-503.801) -- 0:01:06
      338000 -- (-500.224) (-502.761) (-496.182) [-505.525] * (-502.181) (-500.813) (-499.997) [-505.180] -- 0:01:06
      338500 -- [-498.297] (-498.198) (-500.243) (-506.684) * (-504.816) (-501.319) (-497.484) [-495.700] -- 0:01:06
      339000 -- (-497.394) [-495.496] (-497.910) (-511.687) * (-505.064) [-500.032] (-498.448) (-499.840) -- 0:01:06
      339500 -- (-501.121) (-500.749) (-502.479) [-506.415] * (-503.648) [-501.110] (-502.104) (-501.446) -- 0:01:06
      340000 -- (-500.578) [-499.672] (-497.800) (-507.408) * (-501.579) (-500.910) [-502.105] (-499.992) -- 0:01:06

      Average standard deviation of split frequencies: 0.015221

      340500 -- [-498.369] (-497.775) (-500.957) (-500.732) * (-502.141) (-495.016) (-503.127) [-497.608] -- 0:01:05
      341000 -- (-500.809) [-498.420] (-501.180) (-503.292) * [-503.601] (-498.196) (-497.198) (-496.861) -- 0:01:05
      341500 -- (-500.206) [-497.675] (-502.452) (-504.722) * [-502.100] (-502.893) (-501.950) (-497.343) -- 0:01:05
      342000 -- [-497.663] (-495.799) (-506.773) (-501.836) * (-504.245) [-501.007] (-498.297) (-504.365) -- 0:01:05
      342500 -- (-498.051) (-499.168) [-503.764] (-502.954) * (-504.557) [-495.995] (-502.486) (-504.843) -- 0:01:05
      343000 -- (-502.693) [-501.660] (-504.745) (-498.828) * (-504.461) [-500.288] (-505.435) (-504.597) -- 0:01:05
      343500 -- [-495.934] (-504.269) (-498.930) (-503.748) * (-505.973) (-504.323) (-497.514) [-499.772] -- 0:01:06
      344000 -- (-497.972) [-504.537] (-498.136) (-499.396) * [-503.623] (-504.030) (-498.889) (-501.051) -- 0:01:06
      344500 -- (-503.417) (-502.822) [-497.819] (-505.248) * (-504.887) (-501.056) (-505.288) [-498.039] -- 0:01:06
      345000 -- (-499.867) (-500.909) (-506.307) [-499.050] * (-502.486) (-499.474) [-503.997] (-501.985) -- 0:01:06

      Average standard deviation of split frequencies: 0.014079

      345500 -- (-499.299) (-502.209) [-498.303] (-502.266) * (-503.580) (-501.804) (-503.441) [-497.312] -- 0:01:06
      346000 -- [-500.388] (-500.624) (-504.355) (-500.601) * (-501.413) (-505.451) (-498.172) [-500.404] -- 0:01:06
      346500 -- (-497.731) (-498.520) (-499.111) [-502.904] * [-502.383] (-509.838) (-500.409) (-501.307) -- 0:01:06
      347000 -- (-500.768) [-498.385] (-500.851) (-501.379) * (-503.172) (-505.638) (-506.161) [-503.274] -- 0:01:05
      347500 -- (-502.107) [-496.735] (-503.049) (-503.555) * (-505.802) (-496.779) [-501.950] (-503.978) -- 0:01:05
      348000 -- (-498.035) (-497.886) [-498.943] (-500.310) * (-512.815) [-501.426] (-505.810) (-500.903) -- 0:01:05
      348500 -- (-502.527) [-500.959] (-497.360) (-499.506) * (-502.264) [-501.235] (-505.667) (-503.260) -- 0:01:05
      349000 -- (-502.170) (-501.537) (-497.062) [-504.965] * (-505.960) [-504.355] (-501.744) (-505.070) -- 0:01:05
      349500 -- (-500.231) (-498.392) (-502.916) [-499.270] * (-503.623) [-497.667] (-507.932) (-507.861) -- 0:01:05
      350000 -- (-500.811) (-501.346) (-499.505) [-500.144] * (-505.321) [-496.649] (-501.495) (-503.646) -- 0:01:05

      Average standard deviation of split frequencies: 0.013443

      350500 -- (-509.692) (-500.729) [-498.448] (-500.470) * (-502.670) [-496.877] (-507.881) (-504.450) -- 0:01:04
      351000 -- (-502.381) (-499.130) [-501.307] (-501.407) * (-500.008) [-505.197] (-501.428) (-501.934) -- 0:01:04
      351500 -- (-500.905) (-498.877) [-503.201] (-499.126) * [-501.922] (-499.277) (-503.615) (-503.104) -- 0:01:04
      352000 -- (-506.547) (-500.726) (-501.454) [-498.107] * (-498.795) (-500.096) [-502.478] (-506.891) -- 0:01:04
      352500 -- (-504.796) (-501.997) (-499.220) [-497.473] * [-499.721] (-502.695) (-501.776) (-500.025) -- 0:01:04
      353000 -- (-502.974) [-498.881] (-502.055) (-500.309) * (-500.162) (-501.337) [-503.010] (-507.077) -- 0:01:04
      353500 -- [-499.946] (-505.437) (-504.451) (-499.089) * (-499.805) (-502.349) (-507.122) [-498.984] -- 0:01:05
      354000 -- (-502.190) [-499.956] (-500.301) (-503.658) * (-496.372) [-498.162] (-506.703) (-499.773) -- 0:01:05
      354500 -- (-505.053) (-504.933) (-497.892) [-503.535] * [-497.565] (-501.309) (-507.490) (-502.051) -- 0:01:05
      355000 -- (-506.928) (-502.424) (-504.158) [-507.853] * (-503.700) (-503.817) [-498.601] (-498.983) -- 0:01:05

      Average standard deviation of split frequencies: 0.012800

      355500 -- (-501.021) [-498.782] (-502.049) (-502.957) * (-502.498) [-499.028] (-504.904) (-502.540) -- 0:01:05
      356000 -- (-509.082) [-502.474] (-500.290) (-501.579) * [-506.555] (-502.824) (-509.568) (-499.800) -- 0:01:05
      356500 -- [-501.786] (-501.562) (-502.840) (-503.768) * (-505.578) [-500.953] (-502.028) (-502.178) -- 0:01:04
      357000 -- (-503.890) [-502.989] (-504.626) (-520.870) * [-500.061] (-503.821) (-504.072) (-497.072) -- 0:01:04
      357500 -- [-502.877] (-500.924) (-496.745) (-505.526) * (-505.552) (-504.704) [-500.781] (-503.354) -- 0:01:04
      358000 -- (-500.153) (-504.931) [-499.471] (-510.154) * [-498.752] (-502.926) (-495.398) (-502.811) -- 0:01:04
      358500 -- [-503.933] (-507.884) (-503.044) (-509.169) * [-505.466] (-507.758) (-499.534) (-500.448) -- 0:01:04
      359000 -- (-506.419) (-506.550) [-498.629] (-504.524) * (-506.038) [-501.870] (-508.301) (-501.539) -- 0:01:04
      359500 -- (-503.567) (-512.662) (-500.305) [-503.260] * [-498.606] (-500.975) (-504.301) (-505.520) -- 0:01:04
      360000 -- (-505.870) (-506.912) (-502.336) [-500.082] * (-497.329) [-497.864] (-502.887) (-505.206) -- 0:01:04

      Average standard deviation of split frequencies: 0.013942

      360500 -- (-508.122) (-505.456) [-502.587] (-499.717) * (-499.220) [-500.358] (-499.332) (-502.691) -- 0:01:03
      361000 -- (-503.140) (-508.259) [-500.554] (-498.865) * (-500.581) (-497.665) (-504.963) [-500.546] -- 0:01:03
      361500 -- (-505.316) (-509.541) (-498.805) [-500.577] * [-497.858] (-496.539) (-504.099) (-500.466) -- 0:01:03
      362000 -- (-503.146) (-507.841) [-500.546] (-503.939) * (-498.101) [-497.021] (-508.606) (-501.543) -- 0:01:03
      362500 -- (-510.444) (-506.935) (-505.166) [-499.788] * (-498.793) [-499.476] (-497.375) (-500.812) -- 0:01:03
      363000 -- (-506.241) (-503.144) (-498.046) [-498.245] * (-497.091) [-499.450] (-505.541) (-501.422) -- 0:01:03
      363500 -- (-505.012) (-503.985) (-499.157) [-502.640] * (-511.020) (-499.508) (-504.751) [-504.001] -- 0:01:03
      364000 -- (-503.627) [-507.212] (-505.590) (-500.246) * (-502.792) (-500.382) (-501.952) [-498.953] -- 0:01:04
      364500 -- [-503.125] (-498.829) (-505.752) (-496.844) * [-500.945] (-506.800) (-499.067) (-500.648) -- 0:01:04
      365000 -- (-501.350) (-499.219) (-508.246) [-496.573] * (-499.669) [-504.315] (-500.162) (-499.812) -- 0:01:04

      Average standard deviation of split frequencies: 0.012021

      365500 -- (-504.625) [-501.395] (-504.549) (-501.136) * (-499.293) [-502.157] (-497.396) (-501.034) -- 0:01:04
      366000 -- (-503.175) (-505.445) (-501.040) [-502.497] * (-501.965) (-505.946) [-500.630] (-500.503) -- 0:01:04
      366500 -- (-501.321) (-509.727) [-503.061] (-504.124) * [-510.456] (-503.802) (-501.042) (-508.277) -- 0:01:03
      367000 -- (-508.150) [-497.561] (-498.710) (-503.924) * (-512.225) (-504.965) (-508.518) [-499.753] -- 0:01:03
      367500 -- (-504.058) (-503.669) [-502.838] (-499.807) * [-499.438] (-505.766) (-503.505) (-501.377) -- 0:01:03
      368000 -- [-503.051] (-499.551) (-499.806) (-504.457) * [-500.360] (-510.934) (-506.138) (-507.781) -- 0:01:03
      368500 -- (-504.613) (-500.852) [-499.913] (-504.600) * (-503.731) (-504.878) [-499.845] (-505.083) -- 0:01:03
      369000 -- (-512.915) (-502.183) [-501.657] (-507.665) * [-500.929] (-507.145) (-502.143) (-498.766) -- 0:01:03
      369500 -- (-504.274) (-496.117) (-501.493) [-500.615] * [-501.754] (-508.609) (-499.396) (-502.163) -- 0:01:03
      370000 -- (-501.903) (-502.470) [-501.154] (-500.552) * (-504.003) (-506.273) [-499.191] (-501.064) -- 0:01:03

      Average standard deviation of split frequencies: 0.013566

      370500 -- (-501.730) (-498.548) [-500.084] (-501.020) * (-498.001) [-502.560] (-500.060) (-499.759) -- 0:01:02
      371000 -- (-499.190) [-499.204] (-509.340) (-506.317) * [-497.567] (-505.144) (-498.008) (-497.770) -- 0:01:02
      371500 -- (-498.794) (-493.857) [-497.364] (-502.185) * (-497.145) (-506.859) (-502.942) [-501.896] -- 0:01:02
      372000 -- (-502.987) [-498.277] (-498.129) (-507.398) * (-500.789) (-505.235) (-502.902) [-499.361] -- 0:01:02
      372500 -- (-503.277) [-498.166] (-502.683) (-503.776) * [-501.454] (-507.916) (-496.469) (-507.026) -- 0:01:02
      373000 -- (-502.459) (-502.409) [-495.534] (-504.416) * [-495.893] (-501.323) (-499.988) (-506.117) -- 0:01:02
      373500 -- (-501.471) (-499.361) [-499.120] (-504.011) * (-500.577) (-504.076) (-499.993) [-498.606] -- 0:01:02
      374000 -- (-506.963) [-507.802] (-500.308) (-499.829) * (-505.823) (-497.354) (-502.404) [-500.664] -- 0:01:01
      374500 -- (-502.139) [-506.078] (-502.128) (-502.883) * (-499.607) [-500.795] (-504.545) (-501.799) -- 0:01:03
      375000 -- (-496.949) (-510.214) (-496.762) [-501.372] * (-509.172) (-504.451) [-511.087] (-503.976) -- 0:01:03

      Average standard deviation of split frequencies: 0.015045

      375500 -- (-500.436) [-499.729] (-502.829) (-502.607) * (-505.125) (-506.424) [-503.801] (-500.628) -- 0:01:03
      376000 -- (-499.896) [-497.502] (-501.423) (-497.723) * (-503.253) [-498.033] (-510.977) (-504.984) -- 0:01:03
      376500 -- [-501.000] (-502.327) (-501.086) (-498.670) * (-501.846) (-503.960) [-509.324] (-500.073) -- 0:01:02
      377000 -- (-502.938) (-499.969) [-501.743] (-500.936) * (-506.769) (-504.652) [-500.148] (-505.151) -- 0:01:02
      377500 -- (-507.142) (-502.243) [-498.469] (-499.321) * (-504.134) [-504.241] (-501.100) (-504.793) -- 0:01:02
      378000 -- (-504.346) (-501.131) (-497.850) [-498.893] * (-504.079) (-501.570) (-502.855) [-498.078] -- 0:01:02
      378500 -- (-505.456) [-506.101] (-507.514) (-502.673) * (-510.223) (-503.722) (-499.484) [-503.979] -- 0:01:02
      379000 -- (-500.761) (-510.307) (-498.633) [-501.385] * (-504.509) (-502.660) (-500.013) [-500.161] -- 0:01:02
      379500 -- (-506.695) (-504.371) (-504.794) [-500.234] * (-504.804) (-502.921) [-500.442] (-503.010) -- 0:01:02
      380000 -- [-500.359] (-504.448) (-497.565) (-503.052) * (-503.184) [-504.616] (-499.908) (-499.378) -- 0:01:02

      Average standard deviation of split frequencies: 0.015686

      380500 -- (-504.774) [-507.541] (-497.867) (-496.343) * (-517.595) [-504.695] (-509.744) (-498.450) -- 0:01:01
      381000 -- (-503.328) (-497.869) (-504.145) [-499.134] * (-502.861) [-499.460] (-499.151) (-504.706) -- 0:01:01
      381500 -- (-506.532) (-503.363) [-497.955] (-499.673) * (-500.758) (-504.009) [-500.486] (-499.962) -- 0:01:01
      382000 -- (-507.499) (-501.350) [-498.668] (-500.912) * (-499.642) [-506.793] (-498.214) (-501.617) -- 0:01:01
      382500 -- (-500.013) (-497.635) [-501.199] (-506.237) * (-506.937) (-501.169) [-505.844] (-498.754) -- 0:01:01
      383000 -- [-499.130] (-508.775) (-498.840) (-504.617) * [-507.288] (-504.316) (-501.052) (-495.407) -- 0:01:01
      383500 -- (-496.311) [-504.890] (-503.388) (-502.211) * (-505.832) (-501.373) (-499.452) [-499.158] -- 0:01:01
      384000 -- (-499.992) (-500.144) (-510.624) [-503.582] * (-508.264) [-496.909] (-503.979) (-504.289) -- 0:01:00
      384500 -- (-499.478) (-508.720) [-499.713] (-497.798) * (-505.800) (-497.261) [-495.016] (-502.598) -- 0:01:02
      385000 -- (-503.660) [-503.033] (-499.230) (-500.427) * (-498.977) (-498.907) [-503.764] (-498.717) -- 0:01:02

      Average standard deviation of split frequencies: 0.014655

      385500 -- [-498.400] (-503.040) (-498.240) (-505.640) * (-500.643) (-506.467) [-499.983] (-502.585) -- 0:01:02
      386000 -- (-497.030) (-505.309) [-496.705] (-498.238) * (-503.737) (-502.272) (-510.580) [-503.800] -- 0:01:02
      386500 -- (-501.086) [-505.596] (-502.781) (-499.148) * [-497.094] (-505.645) (-498.204) (-503.211) -- 0:01:01
      387000 -- (-504.283) (-507.698) [-501.540] (-499.762) * (-502.021) (-500.311) [-495.787] (-505.598) -- 0:01:01
      387500 -- (-502.490) [-504.251] (-501.577) (-505.384) * (-499.826) [-498.374] (-500.475) (-502.087) -- 0:01:01
      388000 -- (-504.607) [-498.798] (-498.669) (-506.076) * (-500.161) (-508.186) [-501.325] (-505.683) -- 0:01:01
      388500 -- (-498.195) (-497.425) (-499.347) [-500.525] * [-502.262] (-502.444) (-498.963) (-504.270) -- 0:01:01
      389000 -- (-498.945) (-499.694) (-501.771) [-497.661] * (-499.704) (-504.839) [-501.306] (-505.276) -- 0:01:01
      389500 -- [-498.901] (-503.344) (-500.438) (-500.464) * (-503.596) (-503.212) [-504.101] (-504.981) -- 0:01:01
      390000 -- (-497.162) (-501.892) [-500.139] (-502.014) * (-499.812) (-503.359) [-500.612] (-505.900) -- 0:01:01

      Average standard deviation of split frequencies: 0.016491

      390500 -- [-499.978] (-504.971) (-506.434) (-501.852) * (-499.129) (-500.358) (-507.184) [-500.172] -- 0:01:00
      391000 -- (-504.556) (-504.380) (-499.476) [-500.851] * (-503.504) (-507.183) (-503.922) [-499.155] -- 0:01:00
      391500 -- (-501.604) (-506.771) [-499.122] (-504.624) * (-502.516) (-498.609) (-498.898) [-497.637] -- 0:01:00
      392000 -- (-507.587) (-496.802) (-499.098) [-504.265] * [-499.616] (-499.547) (-502.935) (-502.906) -- 0:01:00
      392500 -- (-500.118) (-500.196) (-505.539) [-502.229] * (-498.891) (-501.057) [-503.639] (-504.365) -- 0:01:00
      393000 -- [-498.957] (-499.748) (-500.993) (-501.293) * (-501.263) [-500.176] (-505.156) (-502.720) -- 0:01:00
      393500 -- (-498.743) (-499.396) (-502.152) [-499.426] * (-500.609) (-508.284) (-502.038) [-504.564] -- 0:01:00
      394000 -- (-503.966) (-497.671) (-501.763) [-498.556] * (-507.044) (-503.104) (-499.072) [-501.608] -- 0:00:59
      394500 -- (-498.434) (-498.996) (-500.418) [-500.791] * (-506.601) (-497.813) (-499.672) [-500.207] -- 0:00:59
      395000 -- (-504.545) [-497.764] (-505.306) (-501.082) * (-498.193) (-503.039) [-497.529] (-503.376) -- 0:01:01

      Average standard deviation of split frequencies: 0.013888

      395500 -- [-502.113] (-503.736) (-505.537) (-504.608) * (-505.893) (-499.886) (-500.131) [-501.895] -- 0:01:01
      396000 -- [-497.514] (-500.835) (-503.875) (-505.220) * [-496.789] (-507.199) (-499.790) (-503.773) -- 0:01:01
      396500 -- (-506.501) [-499.221] (-508.659) (-502.618) * (-502.661) (-502.612) [-502.564] (-501.942) -- 0:01:00
      397000 -- (-505.469) [-502.909] (-503.901) (-509.407) * (-500.746) [-500.408] (-502.206) (-509.335) -- 0:01:00
      397500 -- (-499.424) [-503.420] (-506.167) (-513.447) * [-501.570] (-502.920) (-502.247) (-505.182) -- 0:01:00
      398000 -- (-501.023) [-503.249] (-499.517) (-509.540) * [-499.226] (-503.380) (-501.332) (-499.472) -- 0:01:00
      398500 -- (-497.893) (-507.314) [-497.039] (-511.227) * (-506.519) [-500.041] (-499.189) (-505.970) -- 0:01:00
      399000 -- (-498.876) (-504.925) (-498.935) [-502.294] * (-499.720) [-501.288] (-498.026) (-505.251) -- 0:01:00
      399500 -- (-499.315) (-506.689) (-500.175) [-504.381] * (-499.358) (-507.432) [-500.552] (-502.314) -- 0:01:00
      400000 -- (-499.566) (-499.367) [-497.914] (-500.227) * (-504.186) (-501.473) (-500.355) [-501.047] -- 0:01:00

      Average standard deviation of split frequencies: 0.014903

      400500 -- (-503.146) (-508.877) [-496.986] (-503.381) * (-502.597) (-503.467) (-494.674) [-498.270] -- 0:00:59
      401000 -- (-500.695) [-496.395] (-500.359) (-503.765) * (-506.423) [-498.663] (-496.287) (-501.046) -- 0:00:59
      401500 -- (-503.237) (-502.071) (-503.426) [-502.962] * (-502.783) (-502.252) (-498.695) [-501.183] -- 0:00:59
      402000 -- (-503.968) (-502.689) (-501.390) [-499.089] * (-503.560) (-500.396) [-500.475] (-499.169) -- 0:00:59
      402500 -- (-503.714) [-501.993] (-503.603) (-496.132) * (-502.503) (-503.619) (-500.272) [-500.109] -- 0:00:59
      403000 -- [-497.048] (-509.786) (-508.148) (-512.113) * [-501.473] (-503.733) (-503.252) (-503.503) -- 0:00:59
      403500 -- (-500.122) (-500.028) (-500.006) [-509.142] * (-498.941) [-499.707] (-500.339) (-504.157) -- 0:00:59
      404000 -- [-497.344] (-498.344) (-508.303) (-506.508) * [-501.137] (-498.709) (-506.708) (-502.639) -- 0:00:59
      404500 -- (-500.297) (-502.297) [-500.278] (-500.518) * (-500.567) (-499.291) (-502.200) [-502.652] -- 0:00:58
      405000 -- (-497.526) (-498.083) (-504.674) [-502.731] * (-501.772) [-498.939] (-504.283) (-505.786) -- 0:01:00

      Average standard deviation of split frequencies: 0.011998

      405500 -- (-499.391) (-501.055) (-499.509) [-500.429] * (-503.930) [-504.945] (-503.487) (-509.588) -- 0:01:00
      406000 -- [-498.245] (-496.101) (-501.391) (-497.614) * (-506.929) (-500.572) [-506.428] (-506.540) -- 0:00:59
      406500 -- (-500.456) [-498.732] (-505.680) (-502.622) * (-501.113) [-502.715] (-499.178) (-503.967) -- 0:00:59
      407000 -- [-499.673] (-510.555) (-500.307) (-502.452) * (-498.180) (-504.508) (-499.280) [-498.995] -- 0:00:59
      407500 -- [-498.072] (-501.827) (-504.391) (-504.323) * (-500.787) (-500.708) [-497.416] (-502.440) -- 0:00:59
      408000 -- (-501.429) [-500.518] (-502.739) (-503.477) * (-502.875) (-506.646) (-502.087) [-498.686] -- 0:00:59
      408500 -- (-497.405) (-497.797) [-503.374] (-501.816) * (-503.378) (-503.019) (-499.688) [-501.088] -- 0:00:59
      409000 -- [-499.701] (-502.270) (-500.026) (-502.932) * (-495.987) (-512.740) (-499.374) [-501.172] -- 0:00:59
      409500 -- (-501.946) [-497.062] (-502.996) (-496.014) * (-500.227) (-516.598) [-500.453] (-501.685) -- 0:00:59
      410000 -- (-508.670) [-498.418] (-501.249) (-503.236) * (-499.610) (-510.201) (-496.819) [-498.308] -- 0:00:59

      Average standard deviation of split frequencies: 0.011479

      410500 -- (-499.776) [-501.299] (-501.054) (-497.387) * [-500.239] (-509.595) (-502.015) (-499.859) -- 0:00:58
      411000 -- (-508.998) (-501.371) [-501.556] (-496.147) * (-501.529) (-508.043) [-501.685] (-501.286) -- 0:00:58
      411500 -- [-498.563] (-500.545) (-503.979) (-499.648) * [-501.310] (-508.811) (-502.859) (-500.357) -- 0:00:58
      412000 -- (-499.844) [-501.128] (-507.327) (-503.696) * [-499.396] (-505.749) (-502.588) (-508.231) -- 0:00:58
      412500 -- (-497.532) (-497.910) (-506.581) [-496.755] * (-501.472) (-512.961) [-497.280] (-500.323) -- 0:00:58
      413000 -- (-500.554) (-503.502) (-498.373) [-499.067] * (-504.730) (-522.388) (-502.977) [-504.994] -- 0:00:58
      413500 -- (-496.834) (-507.371) [-500.715] (-503.765) * (-501.084) (-511.720) (-503.938) [-507.151] -- 0:00:58
      414000 -- [-494.872] (-502.002) (-501.213) (-508.453) * (-502.912) (-511.760) [-505.759] (-501.658) -- 0:00:58
      414500 -- (-496.256) [-501.419] (-497.093) (-508.799) * (-501.107) (-503.985) (-506.142) [-501.858] -- 0:00:57
      415000 -- (-501.286) (-497.918) (-505.041) [-503.788] * (-506.309) (-510.277) (-509.769) [-506.726] -- 0:00:59

      Average standard deviation of split frequencies: 0.012843

      415500 -- (-501.689) (-507.531) [-498.981] (-502.962) * (-504.929) (-511.871) (-502.231) [-507.886] -- 0:00:59
      416000 -- (-501.116) [-499.283] (-501.684) (-498.480) * (-505.883) (-508.398) (-498.756) [-504.207] -- 0:00:58
      416500 -- [-500.042] (-508.141) (-503.169) (-499.753) * (-500.228) (-512.738) [-496.187] (-503.030) -- 0:00:58
      417000 -- (-495.755) (-499.529) [-498.780] (-498.217) * (-497.978) (-505.623) [-498.282] (-503.265) -- 0:00:58
      417500 -- [-496.727] (-502.598) (-504.716) (-497.976) * (-498.409) [-510.529] (-499.500) (-500.385) -- 0:00:58
      418000 -- (-500.729) [-502.699] (-499.586) (-501.386) * (-502.637) (-513.227) [-499.000] (-503.562) -- 0:00:58
      418500 -- (-499.058) (-506.944) [-502.992] (-501.644) * (-504.159) (-506.263) (-501.249) [-500.283] -- 0:00:58
      419000 -- [-504.858] (-502.593) (-499.941) (-510.875) * (-497.148) (-507.084) (-499.105) [-502.296] -- 0:00:58
      419500 -- (-500.408) (-501.303) [-497.845] (-502.546) * (-506.513) (-509.199) [-499.917] (-503.410) -- 0:00:58
      420000 -- (-498.475) (-501.657) [-507.641] (-502.842) * (-506.733) (-511.135) (-508.076) [-507.872] -- 0:00:58

      Average standard deviation of split frequencies: 0.012700

      420500 -- [-498.551] (-512.211) (-496.350) (-502.640) * [-500.163] (-502.075) (-501.565) (-502.800) -- 0:00:57
      421000 -- [-500.772] (-511.997) (-499.029) (-498.599) * (-501.789) [-503.910] (-507.454) (-513.536) -- 0:00:57
      421500 -- (-499.231) (-502.029) [-499.657] (-504.818) * [-500.744] (-503.861) (-506.662) (-505.604) -- 0:00:57
      422000 -- (-501.274) (-512.824) (-503.191) [-500.414] * (-502.656) (-505.253) (-506.337) [-501.766] -- 0:00:57
      422500 -- (-498.636) [-516.667] (-499.033) (-496.979) * (-502.404) [-501.261] (-505.312) (-499.736) -- 0:00:57
      423000 -- (-500.683) (-498.437) [-493.788] (-500.219) * (-502.893) (-499.994) [-499.914] (-502.400) -- 0:00:57
      423500 -- [-495.907] (-501.052) (-505.166) (-504.024) * [-498.314] (-498.521) (-498.807) (-500.932) -- 0:00:57
      424000 -- (-496.724) (-499.782) (-501.417) [-500.718] * [-498.464] (-505.514) (-498.265) (-510.177) -- 0:00:57
      424500 -- (-505.191) (-504.255) [-498.937] (-501.162) * (-497.492) (-501.815) (-499.302) [-502.830] -- 0:00:56
      425000 -- (-498.860) [-502.322] (-503.222) (-502.989) * (-501.328) [-501.417] (-502.249) (-502.190) -- 0:00:56

      Average standard deviation of split frequencies: 0.014017

      425500 -- (-502.974) (-504.892) [-497.428] (-508.720) * (-503.337) [-498.367] (-514.664) (-511.990) -- 0:00:58
      426000 -- [-498.494] (-502.050) (-504.603) (-501.014) * (-503.749) (-505.721) [-500.623] (-505.911) -- 0:00:57
      426500 -- (-499.753) [-500.804] (-500.781) (-505.506) * (-498.044) [-501.465] (-498.108) (-509.608) -- 0:00:57
      427000 -- (-502.046) [-497.924] (-504.326) (-501.185) * (-500.206) [-501.579] (-500.795) (-501.102) -- 0:00:57
      427500 -- (-500.344) [-504.965] (-500.634) (-500.970) * [-498.455] (-507.063) (-500.833) (-504.424) -- 0:00:57
      428000 -- [-496.655] (-502.082) (-503.130) (-497.070) * [-503.295] (-496.622) (-506.706) (-499.552) -- 0:00:57
      428500 -- (-503.802) (-499.256) [-502.988] (-500.735) * (-501.572) (-498.688) [-503.618] (-501.264) -- 0:00:57
      429000 -- [-501.119] (-502.976) (-501.160) (-498.346) * (-499.791) [-499.098] (-501.574) (-503.865) -- 0:00:57
      429500 -- (-502.807) (-500.435) (-503.721) [-504.900] * (-498.085) [-496.847] (-502.609) (-512.012) -- 0:00:57
      430000 -- (-497.673) (-505.413) [-501.313] (-501.239) * [-501.018] (-500.143) (-500.161) (-502.740) -- 0:00:57

      Average standard deviation of split frequencies: 0.016419

      430500 -- (-498.352) (-496.234) [-507.036] (-497.570) * (-494.714) [-497.230] (-505.497) (-500.875) -- 0:00:56
      431000 -- [-506.349] (-499.952) (-498.499) (-499.580) * (-497.724) [-499.563] (-499.382) (-506.058) -- 0:00:56
      431500 -- (-505.097) (-504.799) (-498.799) [-501.013] * (-498.771) [-496.737] (-502.202) (-503.000) -- 0:00:56
      432000 -- (-495.888) (-502.288) (-502.672) [-499.523] * (-501.822) (-496.914) (-504.168) [-501.243] -- 0:00:56
      432500 -- (-506.323) (-500.248) [-502.861] (-501.430) * (-500.561) [-498.372] (-495.894) (-497.985) -- 0:00:56
      433000 -- (-505.560) [-498.872] (-503.975) (-497.648) * (-500.372) (-500.257) (-494.711) [-502.504] -- 0:00:56
      433500 -- [-503.636] (-499.345) (-498.103) (-502.834) * (-503.271) [-502.859] (-500.977) (-504.761) -- 0:00:56
      434000 -- (-507.505) [-504.162] (-500.480) (-498.814) * (-506.150) (-500.429) (-503.029) [-510.886] -- 0:00:56
      434500 -- [-501.288] (-508.565) (-498.484) (-499.371) * [-498.942] (-504.896) (-501.393) (-510.089) -- 0:00:55
      435000 -- (-500.308) (-502.655) [-501.316] (-501.458) * [-497.744] (-502.559) (-499.354) (-511.566) -- 0:00:55

      Average standard deviation of split frequencies: 0.017299

      435500 -- (-506.511) [-505.241] (-506.228) (-501.162) * (-498.976) [-501.429] (-502.945) (-502.939) -- 0:00:55
      436000 -- (-498.711) (-503.272) [-501.154] (-498.451) * (-501.716) (-502.672) [-499.134] (-505.993) -- 0:00:56
      436500 -- (-501.695) (-497.614) (-503.530) [-498.231] * [-500.981] (-498.853) (-496.526) (-503.268) -- 0:00:56
      437000 -- (-504.540) [-497.917] (-512.418) (-494.517) * (-504.502) (-508.983) [-499.415] (-507.790) -- 0:00:56
      437500 -- (-502.185) (-500.887) (-507.282) [-499.438] * (-500.205) (-500.002) [-495.436] (-502.133) -- 0:00:56
      438000 -- [-496.290] (-504.061) (-508.989) (-506.684) * (-501.587) (-503.344) [-494.415] (-523.287) -- 0:00:56
      438500 -- [-502.141] (-501.674) (-503.833) (-509.284) * (-502.779) [-498.869] (-498.942) (-501.947) -- 0:00:56
      439000 -- (-499.214) [-499.375] (-503.353) (-501.995) * (-500.710) (-497.359) [-502.377] (-501.421) -- 0:00:56
      439500 -- (-504.379) [-504.739] (-505.787) (-497.030) * (-499.032) (-502.685) [-496.184] (-498.304) -- 0:00:56
      440000 -- (-501.510) (-499.154) [-508.739] (-497.338) * (-498.039) (-501.664) [-497.214] (-497.812) -- 0:00:56

      Average standard deviation of split frequencies: 0.016046

      440500 -- (-502.145) (-502.533) (-502.189) [-495.953] * [-500.286] (-500.152) (-501.748) (-500.924) -- 0:00:55
      441000 -- (-499.057) (-498.677) (-502.270) [-497.972] * (-499.622) (-496.502) [-499.257] (-504.534) -- 0:00:55
      441500 -- [-498.014] (-504.657) (-501.411) (-501.712) * (-502.443) (-501.375) (-500.770) [-501.469] -- 0:00:55
      442000 -- (-502.797) (-503.525) [-504.402] (-502.207) * [-501.442] (-502.326) (-494.654) (-512.801) -- 0:00:55
      442500 -- (-497.479) [-500.213] (-506.645) (-500.943) * (-503.488) (-500.537) [-498.073] (-503.995) -- 0:00:55
      443000 -- (-502.722) (-500.542) (-504.513) [-497.394] * (-504.031) (-507.375) [-501.437] (-508.103) -- 0:00:55
      443500 -- (-501.092) [-497.311] (-498.761) (-501.171) * (-502.416) [-500.078] (-503.029) (-499.563) -- 0:00:55
      444000 -- [-496.597] (-500.396) (-500.243) (-508.635) * (-507.457) (-497.409) (-499.184) [-497.176] -- 0:00:55
      444500 -- (-501.223) (-500.250) (-498.713) [-508.759] * (-504.594) [-502.512] (-504.972) (-497.831) -- 0:00:54
      445000 -- (-497.766) (-498.833) [-499.436] (-500.791) * (-504.229) (-503.701) (-503.032) [-498.963] -- 0:00:54

      Average standard deviation of split frequencies: 0.014445

      445500 -- (-502.747) [-509.701] (-498.550) (-502.679) * (-504.341) [-499.887] (-507.262) (-499.309) -- 0:00:56
      446000 -- (-501.777) (-507.451) [-498.851] (-509.452) * [-499.281] (-499.378) (-500.722) (-503.973) -- 0:00:55
      446500 -- (-504.918) (-502.297) (-507.474) [-500.590] * (-502.080) [-499.645] (-497.782) (-501.155) -- 0:00:55
      447000 -- (-498.535) [-498.903] (-499.922) (-504.554) * [-498.557] (-500.711) (-500.232) (-503.546) -- 0:00:55
      447500 -- (-501.126) (-500.494) [-498.168] (-502.901) * [-501.982] (-497.672) (-502.470) (-500.379) -- 0:00:55
      448000 -- (-501.161) [-502.725] (-502.065) (-503.969) * (-506.494) (-500.505) [-500.044] (-497.032) -- 0:00:55
      448500 -- (-500.320) [-499.164] (-501.845) (-501.862) * (-503.764) [-496.525] (-500.864) (-503.420) -- 0:00:55
      449000 -- (-501.670) (-506.773) [-501.223] (-502.434) * (-499.528) (-504.001) [-501.277] (-511.095) -- 0:00:55
      449500 -- [-497.129] (-504.116) (-498.693) (-502.192) * [-500.772] (-500.473) (-501.457) (-502.777) -- 0:00:55
      450000 -- [-498.362] (-503.890) (-499.811) (-499.129) * (-508.205) [-501.039] (-504.290) (-499.399) -- 0:00:55

      Average standard deviation of split frequencies: 0.014993

      450500 -- (-506.895) [-503.392] (-498.094) (-505.526) * (-503.579) [-499.957] (-501.299) (-497.482) -- 0:00:54
      451000 -- (-500.030) (-508.221) [-499.916] (-500.930) * [-501.777] (-501.627) (-504.737) (-497.600) -- 0:00:54
      451500 -- (-500.927) (-508.911) [-501.060] (-502.618) * (-508.947) [-500.870] (-501.390) (-500.001) -- 0:00:54
      452000 -- (-510.901) (-505.050) (-506.333) [-498.377] * (-505.613) (-498.947) [-503.979] (-502.720) -- 0:00:54
      452500 -- (-497.765) (-506.112) [-499.935] (-499.849) * (-502.353) (-500.110) [-496.993] (-498.445) -- 0:00:54
      453000 -- [-499.211] (-506.185) (-503.044) (-498.466) * [-501.423] (-501.633) (-503.860) (-502.219) -- 0:00:54
      453500 -- [-498.096] (-503.425) (-500.656) (-503.891) * (-498.333) (-498.739) (-499.608) [-503.330] -- 0:00:54
      454000 -- [-498.804] (-508.504) (-502.687) (-502.712) * (-502.014) (-501.272) (-496.014) [-501.382] -- 0:00:54
      454500 -- (-501.252) (-507.652) [-499.030] (-504.852) * (-500.162) (-499.638) [-499.406] (-508.305) -- 0:00:54
      455000 -- (-499.092) (-505.501) (-502.698) [-504.883] * (-495.864) (-502.703) [-500.607] (-505.867) -- 0:00:53

      Average standard deviation of split frequencies: 0.015851

      455500 -- (-500.443) (-509.133) [-501.833] (-506.258) * (-499.488) (-498.381) (-502.585) [-495.859] -- 0:00:53
      456000 -- (-504.255) (-502.614) (-510.394) [-502.396] * (-502.145) (-501.102) (-500.764) [-502.341] -- 0:00:54
      456500 -- (-499.533) (-506.362) [-500.697] (-503.620) * [-499.319] (-501.986) (-498.047) (-499.282) -- 0:00:54
      457000 -- (-503.520) (-509.077) [-496.969] (-499.584) * (-507.657) (-503.363) (-498.087) [-498.892] -- 0:00:54
      457500 -- (-496.705) (-501.197) (-500.784) [-495.469] * (-502.528) [-503.701] (-508.673) (-497.416) -- 0:00:54
      458000 -- (-499.464) (-502.058) (-496.836) [-502.552] * [-504.080] (-498.961) (-510.029) (-502.599) -- 0:00:54
      458500 -- (-497.772) [-503.997] (-502.650) (-504.254) * (-505.480) (-500.923) [-500.864] (-498.724) -- 0:00:54
      459000 -- (-510.482) (-499.684) [-502.920] (-500.343) * [-496.094] (-507.803) (-503.023) (-500.044) -- 0:00:54
      459500 -- (-506.706) [-501.374] (-497.104) (-504.152) * (-501.273) (-502.161) [-502.410] (-502.623) -- 0:00:54
      460000 -- [-504.270] (-496.690) (-512.099) (-506.974) * (-500.220) (-497.610) (-502.265) [-506.986] -- 0:00:54

      Average standard deviation of split frequencies: 0.017055

      460500 -- (-499.848) (-497.959) (-501.302) [-503.993] * (-501.092) [-503.291] (-495.623) (-510.849) -- 0:00:53
      461000 -- [-505.374] (-503.466) (-500.072) (-497.846) * (-501.675) (-498.310) [-501.529] (-506.680) -- 0:00:53
      461500 -- (-498.937) [-500.369] (-505.479) (-500.560) * (-498.868) [-500.215] (-499.894) (-506.063) -- 0:00:53
      462000 -- [-500.551] (-500.870) (-502.973) (-498.782) * [-501.299] (-498.627) (-499.477) (-505.871) -- 0:00:53
      462500 -- [-501.506] (-502.235) (-500.422) (-503.175) * [-499.714] (-504.029) (-504.081) (-501.777) -- 0:00:53
      463000 -- (-500.565) (-502.575) [-503.474] (-499.412) * (-502.161) (-502.205) [-504.853] (-502.719) -- 0:00:53
      463500 -- (-497.021) (-499.096) [-499.330] (-504.374) * (-503.289) (-498.263) [-500.441] (-500.128) -- 0:00:53
      464000 -- (-501.887) (-507.979) [-505.038] (-496.345) * (-501.394) (-500.420) [-501.641] (-497.136) -- 0:00:53
      464500 -- [-501.628] (-501.524) (-504.823) (-500.195) * (-502.645) (-501.949) (-507.926) [-497.843] -- 0:00:53
      465000 -- (-502.640) (-502.133) (-498.724) [-503.767] * (-508.079) [-506.932] (-497.898) (-497.753) -- 0:00:52

      Average standard deviation of split frequencies: 0.014500

      465500 -- (-503.695) (-509.641) (-498.169) [-501.112] * (-507.721) (-495.513) [-498.130] (-502.011) -- 0:00:52
      466000 -- (-506.192) (-513.146) [-499.171] (-503.847) * [-503.674] (-501.417) (-497.312) (-498.243) -- 0:00:53
      466500 -- (-504.301) (-502.178) (-500.646) [-499.425] * (-502.140) [-493.631] (-496.529) (-498.032) -- 0:00:53
      467000 -- [-505.137] (-502.231) (-499.925) (-501.828) * (-504.792) [-497.371] (-497.297) (-501.772) -- 0:00:53
      467500 -- (-500.824) [-499.924] (-503.905) (-501.132) * (-501.122) (-499.423) [-498.785] (-502.364) -- 0:00:53
      468000 -- [-502.096] (-503.945) (-501.579) (-502.198) * (-504.310) (-504.791) (-496.620) [-503.307] -- 0:00:53
      468500 -- (-507.499) (-505.942) [-497.258] (-497.511) * (-511.256) [-497.209] (-501.766) (-496.064) -- 0:00:53
      469000 -- (-502.458) (-498.218) (-503.501) [-499.798] * (-507.660) [-500.060] (-504.248) (-504.417) -- 0:00:53
      469500 -- (-501.126) [-499.811] (-501.923) (-497.842) * (-505.001) [-495.925] (-501.480) (-500.984) -- 0:00:53
      470000 -- (-502.013) (-501.419) (-502.581) [-498.242] * (-507.928) (-499.917) (-499.732) [-502.269] -- 0:00:53

      Average standard deviation of split frequencies: 0.013688

      470500 -- (-500.007) [-499.650] (-503.837) (-501.031) * (-505.491) [-496.596] (-505.502) (-510.104) -- 0:00:52
      471000 -- (-505.807) (-501.984) [-500.000] (-503.589) * (-502.933) (-504.074) [-503.030] (-503.735) -- 0:00:52
      471500 -- (-504.615) (-498.297) (-501.850) [-497.758] * (-502.767) (-496.169) (-502.006) [-499.895] -- 0:00:52
      472000 -- [-501.733] (-497.242) (-503.201) (-497.817) * (-501.493) [-497.831] (-500.167) (-504.475) -- 0:00:52
      472500 -- [-499.213] (-505.165) (-505.890) (-503.718) * (-500.669) [-497.585] (-504.524) (-507.053) -- 0:00:52
      473000 -- (-504.756) [-504.454] (-499.111) (-501.134) * (-502.100) (-500.904) [-503.465] (-501.449) -- 0:00:52
      473500 -- (-501.562) (-502.377) [-508.060] (-502.485) * (-499.120) [-501.157] (-502.950) (-503.856) -- 0:00:52
      474000 -- (-501.999) [-503.117] (-501.697) (-504.933) * [-500.799] (-500.769) (-503.322) (-503.565) -- 0:00:52
      474500 -- (-506.336) [-498.243] (-502.186) (-507.558) * (-512.423) (-503.140) [-500.387] (-503.636) -- 0:00:52
      475000 -- (-499.038) [-498.088] (-506.961) (-506.178) * (-498.873) (-500.046) [-501.371] (-506.982) -- 0:00:51

      Average standard deviation of split frequencies: 0.014195

      475500 -- [-498.580] (-511.545) (-505.192) (-499.816) * (-501.348) (-500.621) [-502.118] (-505.274) -- 0:00:51
      476000 -- (-497.377) [-498.017] (-500.218) (-508.570) * [-500.708] (-498.426) (-501.210) (-505.802) -- 0:00:51
      476500 -- [-502.900] (-501.978) (-503.707) (-501.875) * (-501.394) (-498.386) (-504.504) [-499.596] -- 0:00:52
      477000 -- (-498.826) [-502.672] (-498.722) (-501.892) * (-500.877) (-497.098) (-501.891) [-497.481] -- 0:00:52
      477500 -- (-499.562) [-499.471] (-498.983) (-498.576) * (-499.327) [-501.177] (-510.259) (-497.156) -- 0:00:52
      478000 -- [-503.833] (-501.892) (-503.513) (-501.017) * (-503.666) (-499.172) [-501.663] (-503.389) -- 0:00:52
      478500 -- [-500.757] (-499.583) (-506.458) (-496.824) * (-501.543) (-502.283) (-506.493) [-497.031] -- 0:00:52
      479000 -- (-507.496) [-500.559] (-500.120) (-501.231) * [-502.624] (-502.316) (-506.860) (-497.874) -- 0:00:52
      479500 -- [-501.700] (-500.343) (-504.854) (-503.255) * (-504.093) (-501.476) [-502.675] (-498.220) -- 0:00:52
      480000 -- (-500.519) (-500.310) (-500.885) [-498.330] * (-517.094) (-503.197) [-497.875] (-500.588) -- 0:00:52

      Average standard deviation of split frequencies: 0.011442

      480500 -- (-502.184) (-499.143) [-500.164] (-499.525) * (-508.130) [-497.082] (-500.758) (-498.446) -- 0:00:51
      481000 -- (-501.180) (-503.039) (-509.442) [-498.649] * (-503.282) (-498.037) (-497.286) [-509.927] -- 0:00:51
      481500 -- (-504.239) [-504.697] (-501.541) (-504.263) * (-504.056) [-497.588] (-500.824) (-502.986) -- 0:00:51
      482000 -- (-499.687) [-498.263] (-497.899) (-503.178) * [-497.935] (-499.733) (-499.620) (-514.621) -- 0:00:51
      482500 -- [-501.446] (-499.703) (-497.527) (-498.501) * (-500.259) [-498.954] (-505.184) (-509.119) -- 0:00:51
      483000 -- (-500.391) [-500.051] (-504.122) (-498.324) * [-502.312] (-500.952) (-502.336) (-503.573) -- 0:00:51
      483500 -- [-497.454] (-503.067) (-499.431) (-504.779) * (-498.067) [-501.495] (-504.696) (-502.574) -- 0:00:51
      484000 -- (-500.522) [-495.464] (-499.591) (-507.669) * (-500.055) (-500.615) (-499.965) [-507.850] -- 0:00:51
      484500 -- (-498.887) [-497.715] (-502.062) (-499.138) * [-502.199] (-498.483) (-502.179) (-499.975) -- 0:00:51
      485000 -- (-500.982) (-501.229) (-497.664) [-498.914] * (-502.318) (-500.752) [-504.016] (-499.486) -- 0:00:50

      Average standard deviation of split frequencies: 0.012286

      485500 -- (-499.778) (-497.738) (-514.415) [-496.500] * (-500.630) (-498.487) [-506.820] (-497.477) -- 0:00:50
      486000 -- (-500.346) (-496.339) [-505.014] (-495.999) * (-498.890) (-495.979) [-501.844] (-500.456) -- 0:00:51
      486500 -- (-500.135) [-496.061] (-494.378) (-498.779) * (-500.596) (-498.121) (-509.032) [-502.272] -- 0:00:51
      487000 -- [-499.921] (-502.833) (-500.496) (-505.294) * [-502.189] (-501.722) (-510.964) (-502.282) -- 0:00:51
      487500 -- (-497.120) (-510.278) (-497.538) [-498.236] * [-498.995] (-500.719) (-508.843) (-509.000) -- 0:00:51
      488000 -- (-501.254) (-502.006) [-501.789] (-506.690) * (-505.474) (-503.417) (-503.298) [-503.145] -- 0:00:51
      488500 -- [-499.592] (-498.839) (-502.565) (-507.337) * (-501.299) [-497.929] (-508.179) (-504.752) -- 0:00:51
      489000 -- [-498.200] (-499.380) (-504.152) (-503.902) * (-498.324) [-501.330] (-502.760) (-506.730) -- 0:00:51
      489500 -- [-496.234] (-496.494) (-500.378) (-502.646) * [-500.773] (-505.289) (-500.121) (-511.496) -- 0:00:51
      490000 -- [-501.382] (-503.383) (-499.415) (-502.256) * [-497.892] (-503.715) (-508.933) (-507.098) -- 0:00:51

      Average standard deviation of split frequencies: 0.012169

      490500 -- [-504.605] (-505.926) (-497.792) (-502.670) * (-500.442) (-503.791) [-503.922] (-505.656) -- 0:00:50
      491000 -- [-501.084] (-504.772) (-507.240) (-501.523) * (-499.307) [-502.254] (-504.591) (-500.101) -- 0:00:50
      491500 -- [-506.046] (-504.820) (-499.504) (-503.651) * [-496.605] (-499.898) (-503.088) (-501.891) -- 0:00:50
      492000 -- (-502.617) (-499.014) [-502.901] (-503.044) * (-502.639) [-498.376] (-510.834) (-500.870) -- 0:00:50
      492500 -- (-504.551) (-498.571) [-501.408] (-497.518) * (-501.796) [-499.671] (-509.557) (-505.730) -- 0:00:50
      493000 -- (-507.151) [-499.210] (-507.312) (-503.545) * (-500.852) [-497.196] (-510.372) (-504.053) -- 0:00:50
      493500 -- [-508.911] (-502.391) (-503.620) (-505.873) * (-500.221) [-499.735] (-505.302) (-508.587) -- 0:00:50
      494000 -- (-509.886) (-503.004) [-500.758] (-504.460) * (-504.872) (-499.855) [-499.804] (-506.732) -- 0:00:50
      494500 -- [-503.379] (-500.418) (-502.209) (-497.814) * (-503.750) (-500.677) (-503.456) [-503.293] -- 0:00:50
      495000 -- (-502.965) (-502.709) [-502.044] (-499.476) * (-503.610) (-498.260) (-511.369) [-503.076] -- 0:00:49

      Average standard deviation of split frequencies: 0.012355

      495500 -- [-502.397] (-501.685) (-498.506) (-496.607) * [-500.006] (-498.972) (-502.084) (-504.894) -- 0:00:49
      496000 -- (-498.233) [-499.170] (-501.991) (-498.918) * [-499.836] (-497.390) (-500.309) (-500.113) -- 0:00:49
      496500 -- [-498.392] (-503.372) (-505.008) (-504.809) * [-498.861] (-501.329) (-503.417) (-504.621) -- 0:00:50
      497000 -- (-501.906) [-502.041] (-500.770) (-502.276) * (-501.335) [-502.010] (-498.772) (-506.404) -- 0:00:50
      497500 -- (-499.449) [-497.862] (-506.556) (-503.089) * [-500.395] (-499.556) (-505.122) (-506.595) -- 0:00:50
      498000 -- (-496.768) [-507.398] (-497.522) (-505.696) * (-506.771) [-500.780] (-508.918) (-503.790) -- 0:00:50
      498500 -- (-497.246) (-500.679) (-497.097) [-499.790] * (-501.881) (-498.354) (-504.940) [-498.218] -- 0:00:50
      499000 -- (-498.142) [-499.611] (-499.098) (-501.375) * (-504.452) (-505.886) [-503.669] (-504.591) -- 0:00:50
      499500 -- (-500.675) (-504.032) [-495.645] (-500.754) * (-499.535) (-498.396) (-508.428) [-505.836] -- 0:00:50
      500000 -- (-502.514) (-515.004) [-501.148] (-504.145) * (-503.517) [-498.158] (-503.390) (-500.849) -- 0:00:50

      Average standard deviation of split frequencies: 0.012868

      500500 -- (-512.254) (-507.146) [-501.751] (-501.643) * [-501.278] (-505.122) (-500.605) (-502.851) -- 0:00:49
      501000 -- (-506.173) (-499.263) (-501.795) [-503.121] * (-502.253) (-513.602) (-504.849) [-500.428] -- 0:00:49
      501500 -- (-508.388) (-503.158) [-496.710] (-501.673) * (-501.050) (-497.214) (-500.459) [-500.096] -- 0:00:49
      502000 -- (-500.536) [-501.325] (-496.459) (-497.016) * (-500.124) (-500.780) (-503.033) [-505.300] -- 0:00:49
      502500 -- (-502.159) (-498.910) [-502.210] (-501.635) * (-497.706) [-500.350] (-499.799) (-500.488) -- 0:00:49
      503000 -- (-507.360) [-498.149] (-497.399) (-505.178) * (-502.187) [-503.168] (-501.053) (-499.445) -- 0:00:49
      503500 -- (-500.210) (-497.082) (-497.797) [-498.721] * [-497.269] (-501.665) (-503.823) (-502.644) -- 0:00:49
      504000 -- (-499.649) (-499.304) (-500.902) [-505.176] * (-501.937) [-498.185] (-504.604) (-503.880) -- 0:00:49
      504500 -- (-503.913) (-499.887) [-505.404] (-501.460) * (-498.812) (-500.336) [-502.744] (-507.797) -- 0:00:49
      505000 -- (-506.084) (-502.606) (-500.008) [-501.809] * (-499.674) [-502.121] (-504.340) (-504.311) -- 0:00:49

      Average standard deviation of split frequencies: 0.012422

      505500 -- [-499.377] (-502.646) (-497.947) (-498.912) * (-500.761) (-504.663) (-501.820) [-502.904] -- 0:00:48
      506000 -- [-502.760] (-500.658) (-498.809) (-501.054) * (-504.710) (-511.267) (-507.812) [-504.236] -- 0:00:48
      506500 -- [-502.860] (-501.959) (-509.763) (-502.443) * [-502.646] (-504.540) (-503.835) (-504.875) -- 0:00:49
      507000 -- (-498.517) [-499.275] (-506.171) (-505.686) * (-499.415) (-506.391) [-501.643] (-513.818) -- 0:00:49
      507500 -- (-502.365) (-501.027) (-509.938) [-498.440] * (-500.454) (-504.366) [-499.041] (-499.230) -- 0:00:49
      508000 -- [-500.287] (-502.938) (-502.789) (-501.325) * (-500.808) (-506.518) [-498.253] (-504.081) -- 0:00:49
      508500 -- (-501.000) [-503.346] (-498.719) (-504.343) * (-503.971) (-503.330) (-496.159) [-503.010] -- 0:00:49
      509000 -- (-495.445) (-501.945) [-499.340] (-498.416) * (-498.779) [-501.679] (-499.860) (-504.116) -- 0:00:49
      509500 -- (-499.695) (-505.534) (-503.469) [-501.837] * [-496.459] (-504.276) (-506.216) (-497.164) -- 0:00:49
      510000 -- (-501.334) (-498.147) [-498.811] (-499.198) * (-495.510) (-505.095) [-497.705] (-495.516) -- 0:00:49

      Average standard deviation of split frequencies: 0.012924

      510500 -- (-497.287) [-501.008] (-503.452) (-498.995) * (-497.159) (-500.887) [-497.889] (-496.404) -- 0:00:48
      511000 -- (-500.398) (-499.070) [-500.071] (-497.610) * (-503.409) (-500.010) [-499.364] (-498.091) -- 0:00:48
      511500 -- (-501.823) (-498.661) (-497.529) [-498.997] * (-499.678) (-506.881) (-498.803) [-497.940] -- 0:00:48
      512000 -- (-499.815) [-497.186] (-500.691) (-501.710) * [-500.692] (-502.527) (-498.716) (-504.749) -- 0:00:48
      512500 -- [-501.142] (-496.597) (-503.237) (-498.786) * (-501.025) (-502.851) (-500.742) [-499.038] -- 0:00:48
      513000 -- (-503.619) [-499.283] (-502.001) (-500.112) * (-493.852) [-501.021] (-502.301) (-494.161) -- 0:00:48
      513500 -- (-505.318) (-497.356) [-499.809] (-501.608) * (-498.035) (-502.742) (-502.425) [-496.611] -- 0:00:48
      514000 -- (-507.902) (-500.869) [-498.718] (-506.869) * (-498.680) (-499.852) [-501.305] (-497.870) -- 0:00:48
      514500 -- [-497.755] (-498.953) (-500.572) (-502.004) * (-498.329) (-496.733) [-501.375] (-502.739) -- 0:00:48
      515000 -- (-499.930) (-499.213) (-505.689) [-505.548] * [-495.903] (-508.348) (-500.917) (-497.436) -- 0:00:48

      Average standard deviation of split frequencies: 0.014313

      515500 -- (-505.335) (-504.070) (-501.421) [-500.769] * (-498.257) (-503.666) [-499.937] (-496.689) -- 0:00:47
      516000 -- (-500.920) (-503.771) [-502.960] (-500.974) * (-499.586) [-498.066] (-501.437) (-496.890) -- 0:00:47
      516500 -- (-501.137) (-502.496) (-503.318) [-498.591] * (-497.579) (-500.575) [-499.284] (-500.240) -- 0:00:47
      517000 -- [-499.555] (-502.770) (-502.103) (-502.621) * (-497.100) [-501.409] (-503.016) (-502.812) -- 0:00:48
      517500 -- (-502.025) [-502.569] (-502.366) (-510.115) * (-505.215) [-500.436] (-503.337) (-502.999) -- 0:00:48
      518000 -- (-498.326) [-502.671] (-503.820) (-504.596) * (-500.974) (-504.948) [-502.571] (-502.783) -- 0:00:48
      518500 -- (-500.241) (-503.366) [-506.214] (-507.177) * (-498.869) (-506.246) [-496.855] (-502.072) -- 0:00:48
      519000 -- (-505.216) (-511.408) [-500.451] (-508.806) * (-507.467) [-500.252] (-497.276) (-502.075) -- 0:00:48
      519500 -- (-500.508) [-502.732] (-505.025) (-508.760) * (-503.626) [-507.106] (-500.330) (-501.319) -- 0:00:48
      520000 -- (-502.393) [-501.764] (-503.073) (-507.999) * (-499.257) (-500.733) [-497.572] (-507.623) -- 0:00:48

      Average standard deviation of split frequencies: 0.014486

      520500 -- (-506.404) (-501.424) [-500.107] (-505.661) * (-505.139) (-505.363) (-497.246) [-503.860] -- 0:00:47
      521000 -- (-501.704) (-500.916) (-501.567) [-503.804] * [-502.502] (-505.369) (-498.494) (-496.714) -- 0:00:47
      521500 -- (-506.833) [-501.262] (-498.407) (-504.243) * (-505.605) [-502.487] (-499.023) (-504.017) -- 0:00:47
      522000 -- (-504.800) (-499.035) [-500.588] (-507.079) * (-502.989) [-500.044] (-503.843) (-507.327) -- 0:00:47
      522500 -- [-497.931] (-498.877) (-501.537) (-510.479) * (-506.754) (-505.060) [-500.598] (-501.730) -- 0:00:47
      523000 -- (-505.142) (-503.928) (-503.970) [-498.780] * (-506.358) (-513.095) (-499.608) [-500.642] -- 0:00:47
      523500 -- (-505.574) (-500.941) [-497.772] (-500.994) * (-500.299) (-502.642) [-495.755] (-505.700) -- 0:00:47
      524000 -- (-498.014) [-502.801] (-504.548) (-508.974) * (-504.408) [-500.515] (-504.238) (-499.568) -- 0:00:47
      524500 -- (-500.642) (-499.334) (-503.877) [-497.959] * (-504.376) (-501.730) [-500.051] (-498.670) -- 0:00:47
      525000 -- (-503.430) (-504.349) (-499.813) [-502.170] * [-497.747] (-511.042) (-500.052) (-499.535) -- 0:00:47

      Average standard deviation of split frequencies: 0.014638

      525500 -- [-498.788] (-501.125) (-498.382) (-504.702) * [-495.937] (-504.238) (-504.940) (-499.636) -- 0:00:46
      526000 -- (-499.057) [-496.827] (-500.849) (-500.516) * [-498.447] (-500.673) (-498.097) (-498.616) -- 0:00:46
      526500 -- [-503.048] (-498.133) (-502.593) (-505.807) * (-512.178) (-496.843) [-498.479] (-496.892) -- 0:00:47
      527000 -- (-499.382) [-497.626] (-498.084) (-499.450) * (-499.676) [-500.857] (-498.988) (-500.369) -- 0:00:47
      527500 -- (-503.384) (-501.035) [-499.508] (-503.146) * (-503.416) [-500.108] (-499.317) (-499.478) -- 0:00:47
      528000 -- (-499.982) (-502.944) [-499.929] (-501.725) * (-503.096) (-504.307) [-499.701] (-497.634) -- 0:00:47
      528500 -- [-499.952] (-500.034) (-502.237) (-501.157) * (-500.617) (-499.927) (-499.190) [-501.058] -- 0:00:47
      529000 -- (-499.876) (-504.000) (-498.459) [-504.346] * (-503.791) (-504.046) [-499.730] (-500.825) -- 0:00:47
      529500 -- (-503.577) [-499.262] (-499.967) (-497.735) * (-505.757) (-498.750) (-503.746) [-496.951] -- 0:00:47
      530000 -- (-504.218) [-504.587] (-497.300) (-504.451) * (-508.186) (-500.177) [-499.475] (-501.860) -- 0:00:47

      Average standard deviation of split frequencies: 0.015102

      530500 -- (-505.043) [-501.819] (-500.077) (-505.207) * (-504.904) (-507.424) (-500.066) [-502.081] -- 0:00:46
      531000 -- (-502.994) (-503.264) (-504.627) [-507.590] * (-499.662) [-498.311] (-506.394) (-504.944) -- 0:00:46
      531500 -- (-501.010) [-503.221] (-500.132) (-503.432) * (-498.155) (-502.943) (-499.525) [-496.116] -- 0:00:46
      532000 -- (-496.403) (-501.183) [-499.621] (-506.330) * [-505.501] (-501.702) (-502.395) (-507.466) -- 0:00:46
      532500 -- (-500.549) [-500.911] (-501.774) (-498.332) * (-500.210) [-503.643] (-504.314) (-507.760) -- 0:00:46
      533000 -- (-502.657) [-498.917] (-498.205) (-498.270) * (-504.080) [-497.970] (-505.477) (-506.294) -- 0:00:46
      533500 -- (-506.508) (-503.444) [-498.099] (-497.612) * (-498.773) (-503.350) (-496.803) [-503.800] -- 0:00:46
      534000 -- (-502.547) (-502.205) (-499.329) [-500.622] * (-499.142) (-500.688) (-502.882) [-506.590] -- 0:00:46
      534500 -- (-503.941) (-500.433) [-499.538] (-498.025) * (-502.936) (-501.690) [-504.098] (-501.549) -- 0:00:46
      535000 -- [-500.445] (-501.427) (-502.567) (-503.933) * [-501.299] (-505.922) (-500.937) (-506.407) -- 0:00:46

      Average standard deviation of split frequencies: 0.015831

      535500 -- (-501.743) (-499.564) [-500.991] (-500.278) * [-500.990] (-505.371) (-501.719) (-506.086) -- 0:00:45
      536000 -- [-505.133] (-497.081) (-502.889) (-505.589) * (-504.889) (-499.419) (-504.485) [-499.786] -- 0:00:45
      536500 -- (-511.611) (-499.373) [-500.727] (-505.963) * (-502.629) [-499.375] (-502.213) (-505.953) -- 0:00:45
      537000 -- (-511.210) (-507.865) (-498.490) [-503.681] * (-503.529) (-502.645) [-498.364] (-502.265) -- 0:00:46
      537500 -- (-501.902) (-500.284) [-498.995] (-498.806) * (-503.519) (-501.474) (-506.851) [-497.633] -- 0:00:46
      538000 -- (-509.300) [-508.548] (-499.891) (-501.279) * (-502.147) [-501.950] (-501.597) (-503.690) -- 0:00:46
      538500 -- (-498.042) (-496.356) (-496.895) [-497.429] * [-501.048] (-498.301) (-501.085) (-502.728) -- 0:00:46
      539000 -- (-498.714) (-500.040) [-501.275] (-502.041) * (-501.502) (-502.848) [-500.985] (-501.499) -- 0:00:46
      539500 -- (-501.022) (-505.564) (-499.440) [-503.872] * [-498.376] (-504.156) (-506.593) (-499.477) -- 0:00:46
      540000 -- (-503.197) [-504.617] (-500.245) (-501.453) * (-501.920) (-502.152) (-502.245) [-494.743] -- 0:00:46

      Average standard deviation of split frequencies: 0.013369

      540500 -- [-502.345] (-499.365) (-500.033) (-499.527) * (-500.024) [-498.182] (-512.973) (-500.192) -- 0:00:45
      541000 -- [-498.948] (-496.958) (-497.864) (-503.879) * (-504.557) [-497.574] (-501.534) (-497.520) -- 0:00:45
      541500 -- (-506.639) [-499.358] (-499.731) (-501.801) * (-503.159) (-498.361) (-503.021) [-497.731] -- 0:00:45
      542000 -- (-501.749) (-501.696) (-500.909) [-504.487] * (-502.700) [-501.924] (-503.874) (-500.942) -- 0:00:45
      542500 -- (-503.473) (-498.688) [-494.838] (-503.362) * (-498.964) [-501.065] (-510.265) (-504.189) -- 0:00:45
      543000 -- (-503.578) (-508.443) [-508.139] (-504.902) * (-499.502) (-508.276) (-506.880) [-499.359] -- 0:00:45
      543500 -- (-499.408) (-504.249) [-502.544] (-502.629) * (-502.384) [-502.848] (-510.615) (-496.011) -- 0:00:45
      544000 -- (-497.046) (-505.666) [-506.450] (-500.451) * (-503.484) [-498.184] (-506.435) (-502.418) -- 0:00:45
      544500 -- (-499.676) (-502.646) [-502.686] (-502.537) * [-503.540] (-499.479) (-509.995) (-503.561) -- 0:00:45
      545000 -- [-502.408] (-506.181) (-498.861) (-498.325) * (-500.309) (-503.087) [-504.144] (-503.373) -- 0:00:45

      Average standard deviation of split frequencies: 0.012663

      545500 -- (-503.865) (-500.915) [-500.630] (-499.638) * (-503.850) (-503.150) [-503.280] (-506.229) -- 0:00:44
      546000 -- (-505.195) [-501.412] (-505.928) (-499.588) * (-499.796) [-501.278] (-511.903) (-508.380) -- 0:00:44
      546500 -- (-503.086) (-506.316) [-498.566] (-500.267) * (-500.183) (-499.553) (-504.496) [-506.147] -- 0:00:44
      547000 -- (-507.584) (-497.093) (-507.126) [-497.796] * (-498.706) (-497.146) (-502.129) [-505.078] -- 0:00:45
      547500 -- [-498.348] (-502.260) (-503.586) (-506.520) * (-499.585) [-498.225] (-512.585) (-505.775) -- 0:00:45
      548000 -- (-504.012) [-498.333] (-501.413) (-502.283) * (-501.090) (-499.321) (-507.448) [-502.487] -- 0:00:45
      548500 -- (-503.168) [-500.763] (-500.005) (-501.767) * [-499.167] (-498.635) (-511.045) (-504.825) -- 0:00:45
      549000 -- [-501.681] (-503.295) (-499.687) (-508.147) * (-509.381) [-502.531] (-500.361) (-507.745) -- 0:00:45
      549500 -- (-499.041) [-507.396] (-502.447) (-498.760) * (-501.266) [-500.738] (-499.407) (-501.766) -- 0:00:45
      550000 -- (-500.201) (-501.111) [-506.116] (-500.894) * (-496.982) (-506.439) [-498.058] (-510.276) -- 0:00:45

      Average standard deviation of split frequencies: 0.011700

      550500 -- (-500.083) (-510.380) [-504.619] (-499.918) * (-497.352) (-500.088) (-501.330) [-499.357] -- 0:00:44
      551000 -- (-498.036) (-501.088) (-494.063) [-497.512] * (-501.595) (-500.085) (-498.782) [-503.670] -- 0:00:44
      551500 -- (-500.140) (-499.087) (-499.392) [-496.461] * [-497.811] (-503.193) (-501.293) (-506.693) -- 0:00:44
      552000 -- (-504.590) (-499.935) [-501.496] (-503.055) * (-502.513) [-501.091] (-508.627) (-503.154) -- 0:00:44
      552500 -- (-498.309) (-505.069) [-500.886] (-496.228) * (-498.857) (-505.831) (-498.283) [-503.395] -- 0:00:44
      553000 -- [-506.637] (-506.012) (-502.472) (-500.931) * (-504.645) [-502.035] (-502.129) (-501.103) -- 0:00:44
      553500 -- (-501.882) (-497.192) [-505.239] (-503.332) * (-499.779) (-501.900) [-499.411] (-497.847) -- 0:00:44
      554000 -- (-498.513) (-499.417) (-503.031) [-502.019] * (-498.032) (-499.593) [-501.096] (-501.351) -- 0:00:44
      554500 -- [-504.286] (-496.880) (-500.095) (-507.241) * (-499.751) [-504.966] (-499.931) (-497.168) -- 0:00:44
      555000 -- (-505.915) (-506.677) (-507.400) [-504.212] * (-502.840) (-498.122) [-501.277] (-496.523) -- 0:00:44

      Average standard deviation of split frequencies: 0.011305

      555500 -- (-506.137) (-498.233) (-499.848) [-496.386] * (-507.990) (-498.729) (-499.678) [-503.087] -- 0:00:44
      556000 -- (-507.861) (-503.326) [-504.905] (-497.490) * (-497.230) [-502.019] (-500.067) (-496.512) -- 0:00:43
      556500 -- (-508.683) (-505.110) (-501.932) [-499.626] * (-498.552) [-496.164] (-499.346) (-500.096) -- 0:00:43
      557000 -- (-506.606) (-499.494) (-501.941) [-500.084] * (-500.822) [-505.696] (-498.944) (-502.034) -- 0:00:43
      557500 -- [-495.369] (-508.256) (-508.360) (-503.300) * (-502.894) [-501.760] (-501.856) (-507.285) -- 0:00:44
      558000 -- (-502.563) [-500.307] (-507.255) (-505.998) * (-508.982) [-502.308] (-505.368) (-497.703) -- 0:00:44
      558500 -- (-499.741) [-502.704] (-505.919) (-499.662) * (-510.260) [-499.822] (-505.112) (-496.540) -- 0:00:44
      559000 -- (-499.720) (-507.909) [-499.858] (-500.628) * (-498.569) (-496.696) [-505.066] (-499.823) -- 0:00:44
      559500 -- (-498.085) (-504.170) (-502.166) [-500.914] * (-503.012) [-498.145] (-509.455) (-502.757) -- 0:00:44
      560000 -- (-507.165) (-505.462) [-503.710] (-498.318) * (-502.139) (-503.098) [-504.895] (-499.284) -- 0:00:44

      Average standard deviation of split frequencies: 0.012051

      560500 -- (-506.336) (-507.672) (-502.135) [-509.524] * (-502.368) (-499.989) [-500.745] (-505.046) -- 0:00:43
      561000 -- (-501.167) [-497.806] (-505.372) (-502.742) * (-498.706) (-496.892) (-505.611) [-496.464] -- 0:00:43
      561500 -- (-506.901) (-501.584) (-501.733) [-497.621] * (-501.287) (-502.223) (-504.749) [-501.634] -- 0:00:43
      562000 -- (-504.195) (-499.863) (-499.202) [-505.186] * (-500.087) [-497.865] (-503.662) (-503.218) -- 0:00:43
      562500 -- (-501.779) [-497.699] (-504.940) (-504.876) * (-502.614) [-502.298] (-504.159) (-500.484) -- 0:00:43
      563000 -- (-503.621) [-498.788] (-500.763) (-505.038) * (-499.887) [-503.500] (-500.246) (-508.914) -- 0:00:43
      563500 -- (-505.200) (-503.334) [-500.952] (-500.455) * (-499.593) (-504.848) [-504.979] (-501.239) -- 0:00:43
      564000 -- (-504.699) (-497.978) (-506.971) [-501.867] * (-499.993) (-499.816) [-504.767] (-498.310) -- 0:00:43
      564500 -- (-500.304) (-497.961) [-496.864] (-503.912) * (-507.664) [-506.303] (-507.546) (-498.969) -- 0:00:43
      565000 -- (-505.515) [-498.666] (-509.655) (-498.564) * (-520.309) (-503.269) (-511.565) [-501.664] -- 0:00:43

      Average standard deviation of split frequencies: 0.012493

      565500 -- [-500.896] (-503.253) (-505.986) (-501.406) * (-501.682) (-501.878) (-504.141) [-497.401] -- 0:00:43
      566000 -- [-500.728] (-497.123) (-502.303) (-499.666) * (-507.098) (-511.415) (-499.694) [-497.228] -- 0:00:42
      566500 -- [-504.130] (-498.760) (-506.636) (-510.752) * (-503.674) (-505.757) [-502.242] (-502.780) -- 0:00:42
      567000 -- (-499.101) [-499.076] (-504.893) (-510.799) * (-504.365) (-508.129) (-498.692) [-498.111] -- 0:00:42
      567500 -- (-507.861) [-499.263] (-500.576) (-503.578) * (-503.805) (-511.954) [-498.177] (-500.956) -- 0:00:43
      568000 -- (-510.385) [-497.666] (-510.221) (-503.335) * (-509.254) (-503.893) [-503.921] (-510.448) -- 0:00:43
      568500 -- (-500.332) (-504.042) (-495.562) [-503.140] * (-505.509) (-501.421) [-503.299] (-502.572) -- 0:00:43
      569000 -- (-499.369) [-499.390] (-504.644) (-506.992) * [-501.785] (-504.180) (-502.760) (-499.295) -- 0:00:43
      569500 -- [-511.520] (-503.064) (-502.854) (-507.249) * (-503.919) (-507.923) [-498.692] (-501.490) -- 0:00:43
      570000 -- (-504.991) (-501.392) [-500.179] (-506.420) * (-500.598) (-507.184) (-502.571) [-500.516] -- 0:00:43

      Average standard deviation of split frequencies: 0.014594

      570500 -- (-510.418) [-501.854] (-503.083) (-504.936) * (-502.917) (-504.359) (-496.791) [-497.827] -- 0:00:42
      571000 -- (-503.959) (-502.119) [-500.597] (-500.257) * (-502.756) (-503.853) [-500.910] (-499.805) -- 0:00:42
      571500 -- (-511.761) (-507.016) [-500.962] (-501.803) * (-504.734) [-503.747] (-501.477) (-507.471) -- 0:00:42
      572000 -- (-504.424) (-498.752) (-513.461) [-501.678] * [-498.291] (-502.413) (-503.652) (-504.722) -- 0:00:42
      572500 -- (-500.714) (-498.210) [-501.697] (-505.975) * [-497.387] (-499.268) (-499.385) (-507.234) -- 0:00:42
      573000 -- [-500.622] (-507.849) (-502.134) (-503.013) * [-494.403] (-507.933) (-502.688) (-500.036) -- 0:00:42
      573500 -- (-503.758) [-505.370] (-505.460) (-506.081) * (-498.784) (-503.102) (-501.617) [-502.962] -- 0:00:42
      574000 -- (-502.034) (-504.818) [-501.998] (-502.567) * (-505.334) [-509.915] (-506.853) (-502.866) -- 0:00:42
      574500 -- [-496.394] (-503.290) (-497.774) (-498.256) * (-498.036) (-497.726) (-507.209) [-502.404] -- 0:00:42
      575000 -- [-504.690] (-507.531) (-500.036) (-504.083) * (-506.599) (-503.310) [-494.318] (-504.960) -- 0:00:42

      Average standard deviation of split frequencies: 0.015823

      575500 -- (-501.346) (-505.019) (-499.860) [-506.429] * (-511.877) (-503.281) (-501.136) [-497.998] -- 0:00:42
      576000 -- (-501.914) (-505.238) [-496.486] (-508.206) * [-506.346] (-504.169) (-497.342) (-502.452) -- 0:00:41
      576500 -- [-502.172] (-510.726) (-503.103) (-504.794) * (-504.108) (-501.098) [-497.888] (-502.006) -- 0:00:41
      577000 -- [-500.865] (-515.315) (-502.213) (-500.279) * (-506.295) [-498.256] (-501.426) (-500.211) -- 0:00:41
      577500 -- (-502.471) [-501.349] (-505.392) (-503.331) * (-502.839) (-497.528) (-505.582) [-504.057] -- 0:00:41
      578000 -- (-502.516) (-502.917) [-504.083] (-500.816) * (-506.540) (-500.254) (-503.991) [-499.505] -- 0:00:42
      578500 -- (-508.978) (-499.372) [-502.128] (-506.737) * [-499.022] (-510.315) (-510.079) (-498.008) -- 0:00:42
      579000 -- (-504.893) [-498.842] (-499.314) (-504.250) * [-502.710] (-500.120) (-495.276) (-506.638) -- 0:00:42
      579500 -- [-500.468] (-498.198) (-500.358) (-502.564) * (-504.346) (-503.684) (-499.862) [-505.368] -- 0:00:42
      580000 -- (-496.625) [-496.016] (-505.020) (-505.941) * [-497.087] (-504.542) (-497.393) (-501.633) -- 0:00:42

      Average standard deviation of split frequencies: 0.016237

      580500 -- (-503.788) [-500.285] (-501.327) (-506.326) * (-497.375) (-500.411) (-497.682) [-495.857] -- 0:00:41
      581000 -- [-506.034] (-497.253) (-504.203) (-511.971) * (-498.930) (-501.715) (-501.692) [-498.103] -- 0:00:41
      581500 -- [-499.394] (-502.055) (-504.585) (-507.885) * (-502.971) (-502.500) (-500.577) [-497.767] -- 0:00:41
      582000 -- (-502.350) (-510.765) [-501.066] (-504.283) * (-497.631) (-503.147) [-498.872] (-498.989) -- 0:00:41
      582500 -- (-500.580) (-499.358) (-501.891) [-510.450] * [-496.531] (-499.573) (-500.753) (-501.167) -- 0:00:41
      583000 -- (-502.173) [-505.580] (-503.672) (-500.984) * (-500.827) (-503.551) [-499.640] (-498.618) -- 0:00:41
      583500 -- [-503.376] (-498.474) (-498.904) (-500.066) * [-499.417] (-500.119) (-501.985) (-501.830) -- 0:00:41
      584000 -- (-510.347) [-501.121] (-499.079) (-498.253) * [-497.976] (-505.607) (-504.075) (-498.032) -- 0:00:41
      584500 -- (-506.559) [-498.745] (-502.678) (-498.395) * (-502.806) [-504.304] (-505.099) (-504.945) -- 0:00:41
      585000 -- [-501.930] (-498.719) (-502.803) (-501.640) * [-495.002] (-498.389) (-501.758) (-502.065) -- 0:00:41

      Average standard deviation of split frequencies: 0.013944

      585500 -- (-503.123) [-506.638] (-501.799) (-505.399) * (-502.868) (-501.633) (-509.524) [-502.155] -- 0:00:41
      586000 -- (-499.891) (-503.438) [-500.935] (-505.475) * (-499.659) [-500.549] (-500.940) (-506.945) -- 0:00:40
      586500 -- (-501.558) (-503.567) (-505.719) [-510.761] * (-502.401) (-504.995) [-503.919] (-500.019) -- 0:00:40
      587000 -- [-500.410] (-507.494) (-504.930) (-508.774) * (-503.784) (-498.802) (-503.224) [-498.337] -- 0:00:40
      587500 -- (-499.336) [-499.046] (-499.083) (-499.890) * (-505.739) (-500.831) (-501.426) [-500.094] -- 0:00:40
      588000 -- [-503.197] (-503.507) (-509.848) (-507.319) * (-507.645) (-502.086) (-502.193) [-501.081] -- 0:00:41
      588500 -- (-500.370) (-503.241) (-499.478) [-498.032] * (-504.027) (-507.373) (-502.708) [-501.778] -- 0:00:41
      589000 -- (-504.194) (-504.892) [-500.460] (-501.643) * (-503.869) (-502.641) (-501.693) [-499.208] -- 0:00:41
      589500 -- (-501.400) (-510.666) (-499.644) [-502.456] * (-506.986) (-502.643) (-513.308) [-498.626] -- 0:00:41
      590000 -- (-503.790) (-506.504) [-502.543] (-499.405) * (-505.318) (-506.375) (-500.232) [-502.220] -- 0:00:41

      Average standard deviation of split frequencies: 0.013301

      590500 -- [-497.375] (-505.372) (-501.337) (-500.474) * (-497.718) (-501.118) (-500.630) [-499.290] -- 0:00:40
      591000 -- (-499.889) (-506.727) (-499.013) [-503.372] * (-502.725) [-500.770] (-499.095) (-499.009) -- 0:00:40
      591500 -- (-499.875) [-500.974] (-502.650) (-502.847) * (-502.855) (-503.216) (-499.508) [-502.520] -- 0:00:40
      592000 -- (-502.459) (-503.720) (-503.928) [-495.623] * (-500.514) [-503.231] (-509.078) (-499.981) -- 0:00:40
      592500 -- (-502.986) (-500.650) (-505.520) [-498.967] * (-508.583) [-498.047] (-498.751) (-502.592) -- 0:00:40
      593000 -- [-504.875] (-497.077) (-501.245) (-502.072) * (-501.437) (-499.740) [-499.097] (-506.886) -- 0:00:40
      593500 -- (-503.824) [-500.148] (-503.551) (-499.860) * (-504.653) (-502.598) (-499.601) [-502.387] -- 0:00:40
      594000 -- (-505.343) [-503.053] (-505.787) (-500.887) * (-496.966) (-507.917) [-497.805] (-501.951) -- 0:00:40
      594500 -- [-502.345] (-500.627) (-502.595) (-504.774) * (-500.631) (-498.032) (-502.704) [-498.564] -- 0:00:40
      595000 -- (-499.715) (-498.304) (-504.247) [-500.901] * (-510.131) (-499.290) (-502.680) [-497.079] -- 0:00:40

      Average standard deviation of split frequencies: 0.012392

      595500 -- (-504.011) (-505.062) [-502.485] (-500.143) * [-506.693] (-499.857) (-499.455) (-501.310) -- 0:00:40
      596000 -- [-499.324] (-503.874) (-507.898) (-497.620) * (-503.719) (-505.367) (-501.481) [-501.709] -- 0:00:39
      596500 -- (-504.274) (-508.379) (-507.058) [-500.521] * (-498.002) (-502.695) [-495.604] (-501.751) -- 0:00:39
      597000 -- (-503.936) (-503.773) [-500.044] (-499.761) * (-501.902) [-502.479] (-517.941) (-502.113) -- 0:00:39
      597500 -- (-507.101) (-504.611) (-504.963) [-497.783] * (-500.386) (-505.048) (-497.671) [-498.237] -- 0:00:39
      598000 -- (-499.723) (-505.663) [-502.520] (-501.235) * [-508.712] (-504.125) (-514.053) (-498.412) -- 0:00:39
      598500 -- (-502.323) [-502.165] (-508.126) (-500.425) * [-505.944] (-500.133) (-501.640) (-504.254) -- 0:00:40
      599000 -- [-501.274] (-497.700) (-503.661) (-499.826) * (-502.690) (-502.536) [-498.888] (-496.784) -- 0:00:40
      599500 -- (-500.669) [-499.266] (-507.023) (-504.190) * (-501.761) (-507.387) (-500.648) [-498.115] -- 0:00:40
      600000 -- (-499.706) (-498.799) (-504.003) [-499.048] * (-500.878) (-506.428) (-511.263) [-496.669] -- 0:00:40

      Average standard deviation of split frequencies: 0.013342

      600500 -- (-499.992) [-498.143] (-502.440) (-507.193) * (-497.696) (-503.784) (-500.318) [-497.541] -- 0:00:39
      601000 -- (-502.112) [-505.746] (-503.748) (-502.435) * (-501.522) (-498.382) [-500.487] (-498.909) -- 0:00:39
      601500 -- (-501.371) (-503.588) [-498.454] (-502.188) * (-506.968) (-500.468) [-503.632] (-496.131) -- 0:00:39
      602000 -- (-502.453) (-498.338) [-496.933] (-502.961) * (-499.391) [-498.951] (-511.425) (-502.777) -- 0:00:39
      602500 -- [-498.723] (-501.255) (-499.177) (-505.540) * (-502.576) [-498.994] (-505.757) (-495.618) -- 0:00:39
      603000 -- (-499.427) [-504.791] (-505.108) (-506.805) * (-503.694) [-499.407] (-508.788) (-497.064) -- 0:00:39
      603500 -- (-499.498) [-502.658] (-500.329) (-513.369) * (-500.199) (-496.385) [-497.770] (-498.134) -- 0:00:39
      604000 -- [-502.797] (-504.524) (-507.754) (-507.735) * (-500.189) (-498.317) (-498.800) [-500.082] -- 0:00:39
      604500 -- [-500.644] (-504.178) (-499.132) (-498.219) * [-500.845] (-498.958) (-506.081) (-501.520) -- 0:00:39
      605000 -- (-500.336) [-502.403] (-503.518) (-500.581) * (-504.004) (-499.992) (-502.227) [-501.711] -- 0:00:39

      Average standard deviation of split frequencies: 0.013743

      605500 -- (-506.005) [-500.205] (-503.490) (-499.479) * (-503.602) (-500.290) (-498.567) [-503.711] -- 0:00:39
      606000 -- (-503.310) (-501.158) (-505.767) [-497.894] * (-503.928) (-497.546) (-500.894) [-499.387] -- 0:00:39
      606500 -- (-502.959) [-502.430] (-501.380) (-498.585) * [-500.611] (-506.274) (-501.159) (-506.737) -- 0:00:38
      607000 -- [-501.632] (-499.353) (-499.554) (-508.142) * (-502.226) [-499.102] (-500.597) (-501.529) -- 0:00:38
      607500 -- (-501.968) (-506.249) (-500.838) [-504.359] * [-502.689] (-499.788) (-498.664) (-504.644) -- 0:00:38
      608000 -- (-505.246) [-498.399] (-497.051) (-505.583) * (-503.260) (-496.496) [-496.434] (-505.463) -- 0:00:38
      608500 -- (-505.739) (-502.514) (-504.666) [-506.620] * (-502.391) [-498.317] (-502.221) (-499.783) -- 0:00:39
      609000 -- (-501.011) (-500.910) [-497.973] (-503.664) * (-511.022) [-496.995] (-501.880) (-500.760) -- 0:00:39
      609500 -- (-499.376) [-497.258] (-500.947) (-499.670) * (-502.736) (-501.938) [-501.962] (-505.633) -- 0:00:39
      610000 -- [-501.646] (-498.516) (-503.542) (-505.842) * (-508.844) [-501.264] (-500.861) (-503.252) -- 0:00:39

      Average standard deviation of split frequencies: 0.013638

      610500 -- (-504.231) (-496.475) (-504.176) [-499.302] * (-498.082) [-501.322] (-500.517) (-500.997) -- 0:00:38
      611000 -- [-499.535] (-497.162) (-514.223) (-503.479) * (-500.789) (-505.668) [-501.691] (-500.688) -- 0:00:38
      611500 -- (-500.516) [-499.243] (-509.956) (-499.138) * [-499.614] (-499.159) (-504.471) (-504.613) -- 0:00:38
      612000 -- (-498.969) [-498.833] (-505.523) (-496.125) * [-497.271] (-504.969) (-500.346) (-500.888) -- 0:00:38
      612500 -- (-503.605) (-498.613) (-501.543) [-501.371] * (-500.407) (-508.150) [-499.477] (-498.684) -- 0:00:38
      613000 -- (-501.775) (-502.279) (-502.214) [-497.187] * (-500.987) (-513.005) [-499.617] (-499.625) -- 0:00:38
      613500 -- (-504.809) (-500.016) (-505.527) [-496.170] * (-498.134) (-511.311) (-503.292) [-496.891] -- 0:00:38
      614000 -- (-504.055) [-501.380] (-505.570) (-501.094) * [-497.501] (-502.033) (-497.506) (-496.629) -- 0:00:38
      614500 -- (-499.249) (-501.274) (-509.312) [-502.625] * (-500.288) [-502.893] (-496.228) (-500.037) -- 0:00:38
      615000 -- (-502.023) [-500.338] (-497.816) (-503.246) * (-499.542) (-501.770) [-500.016] (-498.688) -- 0:00:38

      Average standard deviation of split frequencies: 0.013520

      615500 -- (-501.645) (-499.233) (-500.683) [-499.726] * (-501.898) [-505.446] (-497.030) (-500.427) -- 0:00:38
      616000 -- [-502.485] (-497.244) (-503.280) (-504.673) * (-500.582) (-500.522) [-499.681] (-508.777) -- 0:00:38
      616500 -- (-499.996) [-502.455] (-504.241) (-503.995) * (-500.575) [-498.922] (-502.419) (-502.429) -- 0:00:37
      617000 -- [-499.527] (-500.147) (-504.526) (-508.327) * (-497.040) (-503.361) (-500.142) [-500.243] -- 0:00:37
      617500 -- (-499.084) [-503.395] (-499.688) (-499.037) * [-499.678] (-501.243) (-498.481) (-503.370) -- 0:00:37
      618000 -- [-499.640] (-504.050) (-501.398) (-498.811) * (-499.094) (-503.573) [-498.038] (-504.424) -- 0:00:37
      618500 -- (-500.047) (-500.087) (-499.769) [-495.989] * (-502.693) (-500.816) (-506.127) [-506.494] -- 0:00:37
      619000 -- [-500.052] (-507.505) (-505.271) (-507.774) * (-500.952) (-501.295) (-502.422) [-503.922] -- 0:00:38
      619500 -- (-501.851) [-501.366] (-499.428) (-501.734) * (-501.698) (-500.680) (-502.004) [-497.308] -- 0:00:38
      620000 -- (-499.105) (-499.567) [-499.024] (-502.230) * [-504.582] (-501.235) (-498.635) (-504.018) -- 0:00:38

      Average standard deviation of split frequencies: 0.013671

      620500 -- (-498.178) [-501.793] (-499.722) (-506.420) * (-511.057) [-501.316] (-502.217) (-503.109) -- 0:00:37
      621000 -- (-501.890) (-507.915) [-505.925] (-503.860) * (-505.694) [-500.314] (-499.566) (-507.147) -- 0:00:37
      621500 -- (-501.771) [-501.636] (-501.245) (-501.648) * (-498.948) [-497.529] (-498.252) (-502.114) -- 0:00:37
      622000 -- (-500.768) (-499.823) (-505.072) [-499.205] * (-501.105) (-497.685) (-498.078) [-500.340] -- 0:00:37
      622500 -- (-502.325) (-500.512) (-500.314) [-505.235] * [-502.794] (-496.788) (-500.018) (-502.838) -- 0:00:37
      623000 -- [-501.048] (-511.751) (-499.814) (-499.694) * (-501.302) [-499.065] (-500.030) (-505.626) -- 0:00:37
      623500 -- [-496.094] (-507.668) (-499.834) (-502.818) * (-508.179) [-499.566] (-501.745) (-501.821) -- 0:00:37
      624000 -- (-499.665) (-497.772) [-500.852] (-500.811) * (-498.679) (-508.836) [-503.593] (-503.146) -- 0:00:37
      624500 -- [-499.211] (-504.872) (-506.820) (-497.416) * (-504.175) (-499.129) [-504.618] (-502.486) -- 0:00:37
      625000 -- (-508.735) [-497.115] (-501.217) (-497.796) * (-504.350) (-504.220) [-504.903] (-504.165) -- 0:00:37

      Average standard deviation of split frequencies: 0.014057

      625500 -- [-503.916] (-499.222) (-502.131) (-498.290) * (-505.335) [-498.651] (-500.254) (-510.332) -- 0:00:37
      626000 -- (-502.149) (-507.751) (-502.593) [-498.372] * (-504.588) (-502.020) [-499.677] (-503.121) -- 0:00:37
      626500 -- [-501.761] (-502.713) (-504.740) (-503.882) * [-501.976] (-497.403) (-501.444) (-502.829) -- 0:00:36
      627000 -- [-504.788] (-501.534) (-499.406) (-507.246) * (-498.386) (-503.375) (-499.714) [-500.375] -- 0:00:36
      627500 -- (-499.295) [-504.521] (-499.941) (-500.884) * (-502.492) (-499.130) [-502.428] (-506.191) -- 0:00:36
      628000 -- (-504.197) [-497.231] (-502.160) (-496.349) * (-502.153) (-500.255) [-499.659] (-507.961) -- 0:00:36
      628500 -- (-506.408) (-500.989) (-506.655) [-504.536] * (-500.425) (-499.515) [-501.303] (-505.005) -- 0:00:36
      629000 -- (-501.052) (-510.656) [-505.068] (-498.016) * (-498.172) (-501.462) (-501.261) [-509.160] -- 0:00:37
      629500 -- (-500.773) (-513.709) (-502.414) [-497.517] * (-501.538) [-503.850] (-504.340) (-504.344) -- 0:00:37
      630000 -- (-501.598) (-511.657) [-503.775] (-502.513) * (-502.159) (-506.005) (-497.670) [-503.761] -- 0:00:37

      Average standard deviation of split frequencies: 0.012707

      630500 -- [-496.321] (-499.490) (-500.203) (-503.908) * (-495.375) [-504.145] (-497.437) (-500.610) -- 0:00:36
      631000 -- (-498.735) (-504.516) [-503.255] (-503.799) * (-496.689) (-500.712) (-502.063) [-494.985] -- 0:00:36
      631500 -- (-496.276) (-499.523) [-499.762] (-505.378) * (-497.761) (-504.016) [-496.395] (-504.201) -- 0:00:36
      632000 -- (-501.470) [-500.706] (-498.547) (-497.651) * (-505.607) (-498.752) [-497.876] (-506.111) -- 0:00:36
      632500 -- [-502.329] (-502.072) (-502.762) (-499.763) * (-499.376) [-502.260] (-499.721) (-498.207) -- 0:00:36
      633000 -- (-500.525) (-500.809) (-501.743) [-502.180] * (-501.805) (-506.521) (-502.797) [-501.147] -- 0:00:36
      633500 -- (-497.690) (-506.393) (-502.333) [-496.752] * [-505.758] (-504.644) (-501.636) (-498.042) -- 0:00:36
      634000 -- (-499.242) (-504.482) (-503.062) [-500.152] * [-498.896] (-499.643) (-499.763) (-509.550) -- 0:00:36
      634500 -- (-505.657) (-500.446) (-500.273) [-498.805] * [-503.232] (-500.932) (-498.621) (-505.366) -- 0:00:36
      635000 -- (-500.955) (-501.601) (-499.065) [-498.003] * (-501.213) (-505.328) (-500.459) [-499.353] -- 0:00:36

      Average standard deviation of split frequencies: 0.013836

      635500 -- (-501.869) [-501.616] (-506.184) (-502.135) * (-503.772) (-499.062) [-502.986] (-498.462) -- 0:00:36
      636000 -- (-500.000) (-507.631) [-502.549] (-511.224) * (-500.930) [-501.810] (-514.372) (-505.258) -- 0:00:36
      636500 -- (-503.828) [-502.462] (-501.990) (-498.425) * (-498.157) (-500.443) (-507.084) [-500.352] -- 0:00:35
      637000 -- (-505.515) [-506.599] (-507.301) (-508.361) * [-498.935] (-499.059) (-499.998) (-498.685) -- 0:00:35
      637500 -- (-497.411) (-504.096) (-504.071) [-501.757] * (-504.704) [-500.628] (-503.837) (-499.631) -- 0:00:35
      638000 -- (-505.173) (-504.449) (-509.714) [-501.470] * (-505.679) (-502.373) (-502.591) [-505.703] -- 0:00:35
      638500 -- (-497.631) (-505.780) (-499.459) [-500.280] * [-506.381] (-501.572) (-497.320) (-502.340) -- 0:00:35
      639000 -- (-501.539) (-505.692) [-500.510] (-499.022) * (-509.437) (-506.762) [-504.053] (-505.126) -- 0:00:35
      639500 -- (-496.602) (-502.734) (-507.000) [-502.330] * [-501.523] (-500.288) (-501.400) (-507.706) -- 0:00:36
      640000 -- [-500.126] (-499.508) (-506.230) (-503.778) * [-501.854] (-506.949) (-499.252) (-505.084) -- 0:00:36

      Average standard deviation of split frequencies: 0.012999

      640500 -- (-501.501) (-502.558) [-499.439] (-501.338) * (-508.227) (-510.521) (-504.012) [-501.691] -- 0:00:35
      641000 -- [-498.885] (-503.167) (-500.463) (-499.596) * (-504.661) (-510.067) (-504.505) [-496.274] -- 0:00:35
      641500 -- (-504.818) [-501.644] (-497.660) (-497.709) * (-499.410) (-505.911) [-499.395] (-498.682) -- 0:00:35
      642000 -- (-505.152) (-503.186) [-499.098] (-501.169) * (-499.281) (-510.422) [-498.989] (-502.373) -- 0:00:35
      642500 -- (-504.605) [-502.222] (-497.370) (-504.371) * (-500.375) (-509.534) (-501.479) [-496.557] -- 0:00:35
      643000 -- (-500.722) (-499.290) (-502.057) [-497.131] * (-501.386) [-502.124] (-502.602) (-501.169) -- 0:00:35
      643500 -- [-498.541] (-510.135) (-500.009) (-497.506) * (-503.688) (-507.133) [-500.312] (-503.597) -- 0:00:35
      644000 -- (-502.250) [-502.764] (-507.576) (-496.800) * (-503.204) (-508.909) (-501.329) [-498.228] -- 0:00:35
      644500 -- [-498.620] (-503.013) (-506.865) (-501.931) * (-505.893) (-500.402) [-500.881] (-500.270) -- 0:00:35
      645000 -- (-506.572) [-499.923] (-500.395) (-499.150) * (-503.817) (-510.423) (-499.365) [-504.871] -- 0:00:35

      Average standard deviation of split frequencies: 0.013865

      645500 -- (-507.977) (-505.282) [-499.654] (-499.546) * (-498.263) [-503.460] (-499.693) (-502.439) -- 0:00:35
      646000 -- (-502.300) (-500.051) [-498.105] (-501.923) * (-500.480) (-505.234) [-498.588] (-499.549) -- 0:00:35
      646500 -- (-501.083) (-498.972) (-498.166) [-502.061] * (-496.845) (-507.171) [-497.322] (-498.296) -- 0:00:34
      647000 -- (-502.803) [-503.762] (-499.170) (-502.328) * (-503.319) (-504.940) [-501.695] (-496.699) -- 0:00:34
      647500 -- (-499.809) [-500.808] (-501.732) (-495.709) * [-498.357] (-500.032) (-499.901) (-500.121) -- 0:00:34
      648000 -- [-498.518] (-500.554) (-505.250) (-496.414) * (-500.459) (-506.769) (-501.223) [-500.777] -- 0:00:34
      648500 -- (-503.670) [-504.512] (-502.133) (-504.475) * (-507.951) [-504.086] (-501.423) (-509.528) -- 0:00:34
      649000 -- (-501.497) (-505.155) [-498.083] (-507.613) * (-501.928) (-501.571) (-506.230) [-498.694] -- 0:00:34
      649500 -- (-502.194) (-511.442) (-501.332) [-498.181] * (-499.897) [-502.962] (-503.256) (-502.238) -- 0:00:35
      650000 -- (-502.000) (-502.748) (-502.169) [-498.127] * (-506.163) [-500.881] (-510.777) (-503.310) -- 0:00:35

      Average standard deviation of split frequencies: 0.013041

      650500 -- (-496.298) [-504.704] (-499.300) (-500.372) * [-500.045] (-505.747) (-506.128) (-500.075) -- 0:00:34
      651000 -- [-498.937] (-506.464) (-513.521) (-501.773) * [-500.449] (-497.248) (-505.368) (-503.492) -- 0:00:34
      651500 -- (-501.170) [-498.664] (-503.165) (-500.854) * (-504.397) [-501.464] (-512.417) (-504.199) -- 0:00:34
      652000 -- [-500.140] (-497.885) (-502.010) (-511.027) * (-501.179) (-499.506) [-508.295] (-500.517) -- 0:00:34
      652500 -- (-501.649) [-499.605] (-505.338) (-502.740) * [-503.085] (-498.397) (-506.030) (-503.795) -- 0:00:34
      653000 -- (-497.682) (-499.789) [-504.736] (-502.409) * (-506.232) (-499.974) (-504.674) [-505.224] -- 0:00:34
      653500 -- (-504.099) (-499.410) (-504.114) [-506.946] * [-501.348] (-503.995) (-507.029) (-503.203) -- 0:00:34
      654000 -- [-500.902] (-499.449) (-502.728) (-501.580) * [-500.944] (-499.024) (-503.996) (-505.922) -- 0:00:34
      654500 -- (-506.768) (-498.338) [-503.170] (-501.937) * (-504.145) [-499.924] (-503.388) (-501.849) -- 0:00:34
      655000 -- (-500.830) (-503.987) (-498.979) [-503.321] * (-502.856) (-504.353) (-506.353) [-500.082] -- 0:00:34

      Average standard deviation of split frequencies: 0.012935

      655500 -- (-504.219) (-505.284) (-502.996) [-502.301] * (-503.670) (-496.549) (-505.826) [-499.275] -- 0:00:34
      656000 -- (-503.605) [-505.569] (-503.537) (-500.418) * (-501.652) (-498.705) (-498.123) [-500.122] -- 0:00:34
      656500 -- (-503.448) (-508.137) (-498.294) [-500.609] * [-504.024] (-494.982) (-499.977) (-501.992) -- 0:00:34
      657000 -- (-502.333) [-501.339] (-497.295) (-500.837) * (-504.168) (-501.453) [-498.501] (-504.787) -- 0:00:33
      657500 -- (-507.474) (-507.555) [-496.299] (-500.172) * (-503.691) (-495.035) [-502.762] (-501.853) -- 0:00:33
      658000 -- (-504.018) (-505.575) (-502.097) [-503.894] * (-503.812) (-502.387) (-505.470) [-503.727] -- 0:00:33
      658500 -- (-503.249) [-507.585] (-507.267) (-500.284) * (-500.754) (-503.795) [-499.356] (-502.997) -- 0:00:33
      659000 -- [-501.929] (-514.470) (-502.060) (-499.694) * (-501.337) (-502.146) (-498.734) [-506.884] -- 0:00:33
      659500 -- [-510.074] (-509.505) (-503.108) (-501.381) * (-501.240) [-497.275] (-498.117) (-500.274) -- 0:00:33
      660000 -- [-500.981] (-500.717) (-501.209) (-498.208) * (-503.105) (-504.522) (-498.406) [-498.154] -- 0:00:34

      Average standard deviation of split frequencies: 0.012368

      660500 -- (-502.349) [-504.900] (-502.199) (-499.653) * (-500.231) (-502.871) (-498.549) [-497.284] -- 0:00:33
      661000 -- (-506.966) (-506.598) [-496.568] (-501.591) * (-503.863) (-498.659) (-505.696) [-496.964] -- 0:00:33
      661500 -- (-511.417) (-507.416) (-500.522) [-500.992] * (-502.091) [-501.071] (-499.365) (-502.115) -- 0:00:33
      662000 -- (-502.485) (-507.581) (-502.251) [-499.163] * (-505.454) [-506.370] (-498.370) (-502.843) -- 0:00:33
      662500 -- (-502.166) (-508.285) (-500.060) [-499.842] * (-499.066) [-497.236] (-497.661) (-509.910) -- 0:00:33
      663000 -- (-510.437) (-504.900) [-499.901] (-504.477) * (-502.098) (-505.303) (-496.873) [-506.394] -- 0:00:33
      663500 -- (-507.343) [-503.820] (-504.963) (-502.477) * (-503.227) [-500.119] (-500.243) (-498.003) -- 0:00:33
      664000 -- (-505.110) (-506.893) (-509.160) [-502.848] * [-500.472] (-514.057) (-498.155) (-498.291) -- 0:00:33
      664500 -- (-502.370) (-511.915) [-499.086] (-500.745) * (-504.186) (-503.156) [-502.263] (-499.019) -- 0:00:33
      665000 -- (-503.450) [-508.896] (-499.980) (-503.898) * (-508.109) [-500.162] (-503.603) (-500.377) -- 0:00:33

      Average standard deviation of split frequencies: 0.012269

      665500 -- (-508.140) (-514.771) (-499.837) [-505.156] * [-505.876] (-499.087) (-506.040) (-500.698) -- 0:00:33
      666000 -- [-505.855] (-517.309) (-503.772) (-508.442) * (-510.728) (-500.389) (-498.516) [-499.860] -- 0:00:33
      666500 -- [-501.535] (-508.938) (-505.689) (-499.703) * (-506.909) (-503.749) [-498.750] (-497.941) -- 0:00:33
      667000 -- (-497.227) (-510.122) (-512.742) [-503.343] * (-509.303) (-495.108) (-499.115) [-501.302] -- 0:00:32
      667500 -- (-499.975) [-503.873] (-512.569) (-506.457) * (-504.971) [-496.126] (-506.600) (-502.877) -- 0:00:32
      668000 -- (-504.449) (-507.739) (-502.770) [-497.530] * (-509.139) [-494.342] (-501.745) (-500.449) -- 0:00:32
      668500 -- (-515.427) [-502.666] (-504.374) (-502.791) * (-503.965) [-498.859] (-502.303) (-501.269) -- 0:00:32
      669000 -- [-505.396] (-499.120) (-503.121) (-500.637) * (-506.297) [-500.810] (-496.862) (-507.406) -- 0:00:32
      669500 -- (-505.829) (-505.912) (-501.671) [-502.255] * (-504.402) (-498.366) (-499.552) [-499.439] -- 0:00:32
      670000 -- (-502.804) [-506.161] (-508.106) (-501.565) * (-506.552) (-500.660) [-498.568] (-497.088) -- 0:00:33

      Average standard deviation of split frequencies: 0.011949

      670500 -- [-501.429] (-500.260) (-506.270) (-496.554) * (-510.350) (-501.454) (-495.884) [-499.638] -- 0:00:32
      671000 -- (-503.073) (-501.860) (-512.738) [-499.167] * [-502.260] (-504.540) (-499.951) (-504.704) -- 0:00:32
      671500 -- (-505.288) (-500.327) (-519.059) [-500.724] * (-505.093) (-498.375) (-500.436) [-495.343] -- 0:00:32
      672000 -- [-503.064] (-511.282) (-508.206) (-496.851) * [-503.582] (-505.471) (-496.625) (-499.341) -- 0:00:32
      672500 -- [-500.872] (-504.381) (-501.933) (-500.198) * (-503.605) (-503.325) [-497.683] (-508.245) -- 0:00:32
      673000 -- (-500.897) (-500.813) (-499.692) [-501.399] * (-503.764) [-499.998] (-503.070) (-498.810) -- 0:00:32
      673500 -- (-501.476) [-496.850] (-509.714) (-499.293) * (-504.930) [-496.544] (-502.771) (-500.851) -- 0:00:32
      674000 -- (-499.902) (-504.749) (-499.989) [-497.262] * [-507.685] (-501.183) (-511.522) (-498.902) -- 0:00:32
      674500 -- (-507.967) (-499.646) [-498.900] (-499.826) * [-499.568] (-501.288) (-499.179) (-507.027) -- 0:00:32
      675000 -- (-503.304) [-504.649] (-501.928) (-497.876) * (-511.839) (-496.356) (-505.476) [-500.267] -- 0:00:32

      Average standard deviation of split frequencies: 0.011158

      675500 -- (-502.112) (-497.368) [-499.310] (-500.180) * (-498.972) (-504.892) [-506.924] (-505.915) -- 0:00:32
      676000 -- (-501.052) (-501.802) (-497.891) [-500.588] * [-505.126] (-502.845) (-503.080) (-502.431) -- 0:00:32
      676500 -- (-505.410) (-505.279) [-498.880] (-507.810) * (-502.545) [-498.580] (-509.892) (-504.269) -- 0:00:32
      677000 -- [-496.404] (-506.119) (-500.785) (-501.827) * (-499.376) [-495.925] (-509.101) (-505.160) -- 0:00:31
      677500 -- (-503.522) [-500.274] (-501.241) (-503.332) * (-500.272) (-502.418) [-504.780] (-501.724) -- 0:00:31
      678000 -- (-505.226) [-500.238] (-497.155) (-499.435) * (-501.920) [-501.484] (-500.706) (-513.321) -- 0:00:31
      678500 -- [-506.913] (-501.342) (-499.934) (-498.186) * (-500.683) (-504.942) (-504.985) [-502.140] -- 0:00:31
      679000 -- (-496.814) (-497.668) [-499.168] (-506.303) * (-509.384) [-503.606] (-507.678) (-496.856) -- 0:00:31
      679500 -- (-500.840) (-503.219) [-497.923] (-499.438) * (-504.915) (-504.014) [-500.131] (-500.489) -- 0:00:31
      680000 -- (-504.893) (-503.466) [-496.734] (-502.548) * (-497.580) (-503.187) (-506.599) [-499.152] -- 0:00:31

      Average standard deviation of split frequencies: 0.011081

      680500 -- (-497.767) [-498.653] (-500.869) (-499.717) * (-506.030) (-499.501) (-504.925) [-502.159] -- 0:00:31
      681000 -- (-506.271) (-504.779) (-503.716) [-500.092] * [-494.680] (-499.720) (-501.012) (-498.429) -- 0:00:31
      681500 -- (-500.971) (-498.772) (-499.901) [-496.896] * (-498.108) [-505.767] (-500.531) (-503.522) -- 0:00:31
      682000 -- (-502.437) (-505.492) [-500.451] (-500.225) * (-499.783) (-501.855) (-507.510) [-502.547] -- 0:00:31
      682500 -- (-503.473) [-505.092] (-501.806) (-498.031) * [-499.640] (-502.105) (-503.093) (-498.571) -- 0:00:31
      683000 -- (-503.751) (-500.085) (-509.114) [-502.108] * (-503.381) (-502.979) [-500.260] (-499.580) -- 0:00:31
      683500 -- [-499.902] (-500.878) (-501.159) (-501.026) * [-499.214] (-503.901) (-507.223) (-501.546) -- 0:00:31
      684000 -- [-500.678] (-504.152) (-497.882) (-498.476) * (-507.051) [-501.716] (-498.704) (-498.047) -- 0:00:31
      684500 -- (-504.115) (-501.647) [-502.832] (-497.812) * [-501.035] (-498.472) (-500.618) (-503.643) -- 0:00:31
      685000 -- (-500.303) (-505.518) (-505.041) [-499.046] * (-499.025) (-501.385) [-498.868] (-503.062) -- 0:00:31

      Average standard deviation of split frequencies: 0.012369

      685500 -- (-507.524) [-497.866] (-496.848) (-502.302) * (-502.001) [-498.562] (-504.823) (-504.173) -- 0:00:31
      686000 -- (-504.150) (-497.327) (-502.650) [-508.929] * (-500.361) [-500.498] (-504.941) (-500.321) -- 0:00:31
      686500 -- (-514.470) (-503.358) (-498.138) [-496.252] * (-502.335) (-501.947) (-502.532) [-500.453] -- 0:00:31
      687000 -- (-506.297) (-504.604) [-509.012] (-496.116) * [-497.990] (-501.250) (-506.039) (-501.091) -- 0:00:30
      687500 -- (-502.340) (-503.286) (-505.459) [-497.511] * (-499.209) (-501.658) (-502.696) [-495.301] -- 0:00:30
      688000 -- [-498.453] (-504.022) (-501.075) (-497.401) * (-502.633) [-500.498] (-504.554) (-497.072) -- 0:00:30
      688500 -- [-497.553] (-506.293) (-498.859) (-495.096) * (-500.238) (-503.342) (-506.794) [-501.146] -- 0:00:30
      689000 -- (-501.331) [-505.498] (-499.366) (-503.414) * (-497.220) (-502.723) [-510.605] (-498.442) -- 0:00:30
      689500 -- [-500.479] (-505.304) (-504.665) (-502.513) * (-508.229) (-496.817) (-499.035) [-499.510] -- 0:00:30
      690000 -- (-500.490) (-506.399) [-497.479] (-497.922) * (-503.106) [-501.721] (-501.746) (-500.508) -- 0:00:30

      Average standard deviation of split frequencies: 0.012286

      690500 -- (-498.903) (-505.394) (-499.156) [-498.375] * (-502.431) (-501.673) [-501.125] (-499.981) -- 0:00:30
      691000 -- (-504.061) [-501.278] (-496.342) (-501.806) * (-503.501) [-502.071] (-502.607) (-503.593) -- 0:00:30
      691500 -- (-497.951) (-504.082) [-501.497] (-501.751) * (-499.870) [-498.447] (-498.827) (-510.488) -- 0:00:30
      692000 -- [-498.991] (-504.925) (-498.881) (-501.927) * (-505.506) [-506.219] (-499.638) (-508.473) -- 0:00:30
      692500 -- (-502.281) (-510.231) [-498.914] (-506.431) * (-505.823) (-500.092) [-501.632] (-507.610) -- 0:00:30
      693000 -- (-501.599) (-513.684) [-496.883] (-501.797) * (-499.116) (-500.621) [-499.673] (-502.436) -- 0:00:30
      693500 -- (-509.458) (-509.096) [-500.560] (-498.752) * (-497.319) (-499.663) (-501.264) [-503.621] -- 0:00:30
      694000 -- (-506.721) (-502.699) [-501.732] (-498.117) * (-499.963) (-500.319) [-500.593] (-501.941) -- 0:00:30
      694500 -- (-504.071) (-502.270) (-503.195) [-499.916] * [-500.565] (-500.354) (-504.498) (-502.215) -- 0:00:30
      695000 -- (-509.046) [-500.948] (-504.065) (-497.026) * [-498.611] (-512.502) (-502.437) (-502.354) -- 0:00:30

      Average standard deviation of split frequencies: 0.014449

      695500 -- (-505.792) [-502.802] (-504.239) (-500.049) * (-500.269) (-502.448) [-503.475] (-502.249) -- 0:00:30
      696000 -- (-502.173) (-501.817) [-500.547] (-504.819) * (-509.969) (-501.163) [-499.691] (-503.814) -- 0:00:30
      696500 -- (-503.628) (-505.745) [-497.749] (-500.494) * (-502.892) [-505.139] (-508.434) (-504.081) -- 0:00:30
      697000 -- (-511.178) (-498.330) (-509.124) [-501.595] * [-497.561] (-502.359) (-506.620) (-502.031) -- 0:00:29
      697500 -- (-508.610) (-498.734) [-503.201] (-501.876) * (-500.409) (-504.471) [-504.195] (-508.233) -- 0:00:29
      698000 -- (-509.993) (-499.345) (-507.455) [-497.997] * (-500.892) (-503.840) (-501.057) [-498.986] -- 0:00:29
      698500 -- (-503.128) (-499.143) (-506.136) [-501.012] * (-503.890) (-502.131) (-501.793) [-498.563] -- 0:00:29
      699000 -- (-505.762) (-501.300) (-505.300) [-498.405] * [-504.037] (-503.786) (-504.934) (-500.144) -- 0:00:29
      699500 -- (-503.080) (-495.731) (-496.772) [-497.741] * (-497.177) (-505.893) (-501.687) [-496.463] -- 0:00:29
      700000 -- [-501.045] (-502.784) (-498.564) (-505.015) * [-498.817] (-508.339) (-500.388) (-501.696) -- 0:00:29

      Average standard deviation of split frequencies: 0.015699

      700500 -- (-497.728) (-499.864) [-496.013] (-507.225) * (-506.761) [-498.382] (-502.120) (-499.484) -- 0:00:29
      701000 -- (-499.819) (-496.442) [-501.363] (-497.375) * (-498.930) [-503.150] (-496.959) (-498.678) -- 0:00:29
      701500 -- [-500.251] (-501.739) (-502.319) (-501.369) * (-496.506) (-501.601) [-500.053] (-503.317) -- 0:00:29
      702000 -- (-497.093) (-502.794) (-500.699) [-508.374] * (-501.441) (-504.635) (-495.828) [-498.592] -- 0:00:29
      702500 -- (-498.449) (-505.712) (-498.420) [-506.840] * (-499.043) [-506.689] (-499.263) (-505.070) -- 0:00:29
      703000 -- (-503.531) [-499.009] (-503.291) (-504.336) * (-500.047) (-498.970) (-509.142) [-501.694] -- 0:00:29
      703500 -- [-500.254] (-499.092) (-500.815) (-497.764) * (-503.098) [-497.423] (-501.010) (-499.631) -- 0:00:29
      704000 -- (-498.694) (-501.198) (-497.553) [-498.036] * (-501.199) [-502.055] (-503.996) (-500.738) -- 0:00:29
      704500 -- (-505.544) (-503.349) (-499.095) [-497.522] * (-507.246) (-504.868) (-498.756) [-499.662] -- 0:00:29
      705000 -- (-504.816) (-499.182) [-497.461] (-503.846) * (-500.563) [-498.567] (-498.391) (-504.591) -- 0:00:29

      Average standard deviation of split frequencies: 0.015357

      705500 -- (-496.613) [-495.646] (-499.454) (-504.015) * (-499.262) [-498.667] (-511.453) (-503.986) -- 0:00:29
      706000 -- (-502.548) [-499.773] (-496.083) (-494.683) * [-502.874] (-504.412) (-500.337) (-502.265) -- 0:00:29
      706500 -- [-497.150] (-501.913) (-501.403) (-500.091) * (-504.102) (-499.462) (-502.160) [-506.003] -- 0:00:29
      707000 -- [-498.332] (-496.945) (-501.083) (-500.965) * (-506.712) [-498.233] (-500.379) (-500.774) -- 0:00:29
      707500 -- (-506.258) (-502.983) [-501.244] (-504.605) * (-506.565) [-498.879] (-503.642) (-499.753) -- 0:00:28
      708000 -- (-499.358) (-498.131) [-499.663] (-503.066) * (-505.264) [-500.097] (-504.240) (-504.015) -- 0:00:28
      708500 -- [-500.385] (-500.660) (-503.562) (-501.208) * (-496.588) (-508.592) [-503.899] (-499.206) -- 0:00:28
      709000 -- [-498.887] (-501.432) (-504.827) (-503.252) * [-498.322] (-499.938) (-504.800) (-502.645) -- 0:00:28
      709500 -- [-502.158] (-501.669) (-497.772) (-502.837) * (-506.689) (-506.374) [-502.605] (-503.401) -- 0:00:28
      710000 -- (-503.032) [-501.202] (-501.219) (-500.181) * [-503.251] (-497.873) (-499.497) (-504.668) -- 0:00:28

      Average standard deviation of split frequencies: 0.016804

      710500 -- (-504.055) (-502.216) (-503.119) [-499.535] * (-501.011) [-501.744] (-500.808) (-501.275) -- 0:00:28
      711000 -- (-500.031) (-502.728) (-500.012) [-501.641] * (-500.125) (-502.110) (-498.922) [-496.553] -- 0:00:28
      711500 -- (-498.361) [-502.700] (-504.671) (-496.500) * (-501.531) (-500.353) (-502.257) [-503.587] -- 0:00:28
      712000 -- (-499.533) [-498.896] (-508.198) (-501.718) * [-495.247] (-504.917) (-503.376) (-500.412) -- 0:00:28
      712500 -- [-503.230] (-503.351) (-504.387) (-504.654) * (-501.187) (-501.891) [-497.441] (-502.426) -- 0:00:28
      713000 -- (-501.563) (-501.567) [-501.022] (-499.138) * (-504.798) [-500.720] (-500.648) (-506.194) -- 0:00:28
      713500 -- (-503.380) (-506.694) (-506.706) [-499.722] * (-498.045) (-500.799) [-500.214] (-508.910) -- 0:00:28
      714000 -- (-502.670) [-501.575] (-500.598) (-498.877) * [-502.629] (-503.690) (-502.042) (-506.223) -- 0:00:28
      714500 -- (-507.504) (-497.203) [-503.162] (-500.473) * [-498.726] (-499.068) (-508.064) (-503.020) -- 0:00:28
      715000 -- (-502.018) (-502.161) (-498.092) [-503.124] * (-500.487) [-500.161] (-502.789) (-502.834) -- 0:00:28

      Average standard deviation of split frequencies: 0.017338

      715500 -- [-498.227] (-499.263) (-503.884) (-504.891) * (-502.209) [-499.562] (-499.609) (-500.491) -- 0:00:28
      716000 -- (-499.308) (-503.913) (-507.129) [-499.149] * (-496.590) (-505.234) (-505.450) [-500.342] -- 0:00:28
      716500 -- [-507.474] (-509.382) (-504.265) (-499.787) * (-498.484) (-501.952) (-497.102) [-502.534] -- 0:00:28
      717000 -- (-507.367) (-500.473) (-499.067) [-507.541] * (-507.412) [-499.643] (-501.665) (-505.186) -- 0:00:28
      717500 -- (-499.872) (-505.718) [-497.866] (-497.671) * (-502.749) (-498.094) (-498.982) [-501.060] -- 0:00:27
      718000 -- (-503.661) (-504.115) (-499.823) [-499.889] * (-503.067) (-496.143) [-499.700] (-501.085) -- 0:00:27
      718500 -- (-502.357) (-501.625) (-502.340) [-498.554] * (-501.502) (-497.305) (-499.973) [-495.930] -- 0:00:27
      719000 -- (-505.855) (-498.924) (-505.415) [-498.914] * (-497.621) (-503.031) [-497.122] (-502.538) -- 0:00:27
      719500 -- (-504.821) [-501.344] (-496.286) (-501.558) * [-499.047] (-499.968) (-506.076) (-502.346) -- 0:00:27
      720000 -- (-508.502) [-496.877] (-496.417) (-505.886) * (-502.786) [-500.035] (-507.371) (-500.418) -- 0:00:27

      Average standard deviation of split frequencies: 0.017007

      720500 -- (-510.577) (-502.244) [-498.990] (-497.244) * (-495.395) (-503.471) (-506.855) [-501.108] -- 0:00:27
      721000 -- (-509.907) (-502.315) (-495.586) [-498.162] * (-500.141) (-504.725) (-505.286) [-503.078] -- 0:00:27
      721500 -- (-502.726) [-499.794] (-501.774) (-496.329) * (-499.471) (-502.410) [-499.059] (-504.890) -- 0:00:27
      722000 -- (-500.262) (-500.683) (-502.232) [-499.726] * [-498.127] (-508.562) (-500.280) (-509.050) -- 0:00:27
      722500 -- (-508.670) [-500.059] (-503.849) (-499.188) * (-503.795) (-503.559) (-500.399) [-501.231] -- 0:00:27
      723000 -- (-506.744) (-500.588) (-502.107) [-500.812] * (-500.301) [-501.542] (-506.734) (-504.164) -- 0:00:27
      723500 -- (-499.793) [-504.377] (-503.276) (-501.803) * (-500.143) (-502.347) [-497.850] (-509.615) -- 0:00:27
      724000 -- (-502.960) (-501.112) [-499.406] (-501.540) * (-504.817) [-504.531] (-508.756) (-496.239) -- 0:00:27
      724500 -- (-500.155) (-497.125) (-501.235) [-503.494] * [-504.835] (-511.609) (-505.481) (-497.455) -- 0:00:27
      725000 -- [-500.140] (-500.086) (-506.828) (-503.048) * (-506.401) (-505.673) (-498.311) [-498.896] -- 0:00:27

      Average standard deviation of split frequencies: 0.016882

      725500 -- (-498.433) [-496.093] (-500.717) (-498.840) * (-502.790) (-503.038) (-500.796) [-499.664] -- 0:00:27
      726000 -- (-501.170) (-504.589) (-497.652) [-501.133] * (-497.009) [-507.603] (-507.039) (-495.867) -- 0:00:27
      726500 -- (-498.270) [-502.504] (-500.729) (-503.603) * (-503.260) (-510.678) (-504.417) [-496.525] -- 0:00:27
      727000 -- (-501.770) (-507.142) [-500.518] (-500.354) * (-501.232) (-501.216) (-499.070) [-503.381] -- 0:00:27
      727500 -- (-499.967) (-503.613) [-497.655] (-498.247) * (-500.652) [-504.345] (-499.481) (-501.013) -- 0:00:26
      728000 -- (-498.867) (-501.469) [-495.652] (-501.150) * (-506.605) (-505.799) (-504.552) [-503.083] -- 0:00:26
      728500 -- (-501.515) (-500.788) [-499.650] (-502.252) * (-502.109) (-499.339) (-500.588) [-495.678] -- 0:00:26
      729000 -- (-499.430) (-507.472) [-500.888] (-507.569) * (-507.321) [-500.489] (-502.154) (-496.884) -- 0:00:26
      729500 -- [-505.591] (-503.961) (-496.469) (-499.980) * (-502.452) [-499.694] (-503.958) (-504.360) -- 0:00:26
      730000 -- (-502.155) (-503.421) [-498.478] (-499.486) * [-499.266] (-498.597) (-499.010) (-499.938) -- 0:00:26

      Average standard deviation of split frequencies: 0.016989

      730500 -- [-501.306] (-516.246) (-501.995) (-500.108) * (-507.145) [-498.988] (-503.961) (-502.308) -- 0:00:26
      731000 -- [-500.601] (-506.753) (-500.240) (-497.916) * (-504.429) (-500.090) (-506.159) [-507.454] -- 0:00:26
      731500 -- (-499.926) (-504.503) (-499.584) [-496.817] * [-500.485] (-501.218) (-500.149) (-507.658) -- 0:00:26
      732000 -- (-514.612) (-496.918) (-497.618) [-500.939] * (-502.860) (-500.786) [-503.332] (-498.553) -- 0:00:26
      732500 -- (-499.648) [-503.931] (-500.712) (-497.118) * [-499.143] (-498.437) (-505.699) (-501.455) -- 0:00:26
      733000 -- (-500.268) (-502.011) [-499.936] (-501.818) * (-504.651) (-503.141) [-505.572] (-501.519) -- 0:00:26
      733500 -- (-506.158) (-499.593) (-502.892) [-499.341] * [-503.831] (-506.353) (-509.863) (-504.809) -- 0:00:26
      734000 -- (-504.831) (-513.876) [-508.125] (-502.612) * (-506.300) (-507.851) (-500.365) [-503.039] -- 0:00:26
      734500 -- (-502.571) (-500.447) (-501.132) [-499.969] * (-503.527) [-500.393] (-502.761) (-494.104) -- 0:00:26
      735000 -- [-506.871] (-505.351) (-504.768) (-498.064) * (-504.470) (-505.254) (-508.755) [-498.760] -- 0:00:26

      Average standard deviation of split frequencies: 0.016226

      735500 -- (-502.025) [-498.030] (-503.184) (-499.661) * [-503.609] (-498.827) (-508.253) (-499.253) -- 0:00:26
      736000 -- (-504.355) [-501.088] (-506.819) (-499.552) * (-499.852) (-499.027) [-501.539] (-501.184) -- 0:00:26
      736500 -- [-505.612] (-503.447) (-505.296) (-499.913) * (-504.928) (-502.744) [-502.751] (-501.781) -- 0:00:26
      737000 -- (-500.149) [-501.013] (-501.041) (-501.567) * (-505.813) (-506.774) (-499.822) [-498.906] -- 0:00:26
      737500 -- (-503.349) (-498.641) (-504.181) [-497.898] * [-500.508] (-503.896) (-500.501) (-505.519) -- 0:00:25
      738000 -- (-502.055) (-501.457) [-498.581] (-497.979) * (-503.067) (-507.225) (-502.956) [-497.319] -- 0:00:25
      738500 -- (-513.340) (-503.516) [-499.602] (-498.942) * [-499.877] (-507.213) (-504.707) (-502.155) -- 0:00:25
      739000 -- (-502.933) (-502.155) [-500.458] (-502.473) * (-500.519) (-505.056) (-503.151) [-500.828] -- 0:00:25
      739500 -- (-502.385) (-501.619) (-499.892) [-499.653] * (-497.434) [-501.802] (-503.394) (-503.046) -- 0:00:25
      740000 -- (-497.681) (-508.484) (-501.249) [-496.520] * (-497.278) (-505.581) [-498.370] (-501.330) -- 0:00:25

      Average standard deviation of split frequencies: 0.015275

      740500 -- (-500.997) (-496.999) [-501.868] (-500.806) * (-501.907) (-502.319) [-499.175] (-502.243) -- 0:00:25
      741000 -- (-504.242) (-497.961) (-498.968) [-496.750] * (-500.411) (-499.824) [-499.426] (-495.846) -- 0:00:25
      741500 -- (-497.582) (-499.829) (-500.215) [-500.427] * (-497.927) (-501.254) [-502.297] (-502.890) -- 0:00:25
      742000 -- (-504.393) [-499.252] (-500.828) (-496.153) * [-501.377] (-507.594) (-503.397) (-499.496) -- 0:00:25
      742500 -- (-501.919) (-507.102) (-499.461) [-498.464] * (-504.006) [-501.891] (-500.706) (-498.719) -- 0:00:25
      743000 -- (-502.900) (-499.597) (-500.455) [-497.052] * (-500.239) (-505.565) [-501.054] (-501.120) -- 0:00:25
      743500 -- (-502.287) [-499.541] (-506.372) (-501.224) * (-498.793) (-510.696) (-502.873) [-498.879] -- 0:00:25
      744000 -- (-503.425) (-503.417) (-505.497) [-504.080] * (-498.134) (-499.058) (-501.443) [-502.526] -- 0:00:25
      744500 -- (-499.707) (-507.625) [-497.791] (-501.573) * (-506.425) (-499.670) [-501.042] (-505.315) -- 0:00:25
      745000 -- (-501.437) (-501.017) (-500.912) [-501.364] * (-497.263) (-509.280) [-498.123] (-502.562) -- 0:00:25

      Average standard deviation of split frequencies: 0.013691

      745500 -- (-501.071) [-499.768] (-500.380) (-501.988) * (-501.014) (-500.232) (-504.657) [-505.577] -- 0:00:25
      746000 -- [-496.080] (-504.956) (-498.490) (-499.961) * (-499.461) [-509.544] (-502.355) (-497.068) -- 0:00:25
      746500 -- (-508.311) (-503.583) (-499.791) [-497.922] * (-499.431) (-503.655) [-506.831] (-505.671) -- 0:00:25
      747000 -- (-499.705) (-501.890) [-500.526] (-500.322) * (-497.305) [-500.161] (-499.938) (-500.308) -- 0:00:25
      747500 -- (-505.145) [-499.733] (-506.019) (-503.183) * [-498.439] (-503.371) (-501.154) (-503.449) -- 0:00:24
      748000 -- (-508.288) [-496.878] (-501.687) (-499.192) * (-502.884) [-501.589] (-503.882) (-503.079) -- 0:00:24
      748500 -- (-506.394) [-500.876] (-497.205) (-499.220) * [-499.579] (-501.000) (-499.141) (-503.228) -- 0:00:24
      749000 -- [-500.519] (-505.907) (-497.313) (-501.628) * (-503.839) (-500.139) (-506.237) [-499.595] -- 0:00:24
      749500 -- (-510.132) (-509.411) (-503.741) [-498.417] * (-504.219) (-504.141) (-500.389) [-500.169] -- 0:00:24
      750000 -- [-498.847] (-505.143) (-498.907) (-496.319) * (-504.796) [-501.742] (-503.348) (-503.703) -- 0:00:24

      Average standard deviation of split frequencies: 0.013606

      750500 -- (-498.443) [-505.285] (-499.623) (-509.008) * (-505.479) (-501.309) (-497.677) [-496.043] -- 0:00:24
      751000 -- [-499.962] (-517.172) (-500.799) (-506.354) * (-505.962) (-498.266) (-495.476) [-497.321] -- 0:00:24
      751500 -- (-498.085) [-506.201] (-500.896) (-503.220) * (-500.640) [-505.056] (-505.021) (-501.277) -- 0:00:24
      752000 -- (-504.465) (-511.282) (-505.784) [-503.230] * [-499.648] (-512.990) (-501.129) (-498.114) -- 0:00:24
      752500 -- (-503.679) (-505.684) (-505.465) [-501.579] * [-499.831] (-498.265) (-502.260) (-498.671) -- 0:00:24
      753000 -- [-501.288] (-506.397) (-505.923) (-502.316) * (-502.327) [-501.996] (-500.264) (-497.923) -- 0:00:24
      753500 -- (-502.068) (-516.920) (-504.637) [-498.500] * (-496.707) (-507.978) (-498.110) [-495.781] -- 0:00:24
      754000 -- [-502.971] (-513.541) (-503.576) (-502.477) * (-499.060) (-501.011) [-499.992] (-502.104) -- 0:00:24
      754500 -- (-502.146) [-508.896] (-500.706) (-500.836) * (-502.854) [-496.097] (-508.232) (-502.144) -- 0:00:24
      755000 -- (-499.901) (-507.432) (-498.384) [-499.464] * (-502.592) [-500.509] (-500.798) (-505.748) -- 0:00:24

      Average standard deviation of split frequencies: 0.013302

      755500 -- [-499.406] (-504.579) (-503.422) (-496.628) * (-502.809) [-499.351] (-502.528) (-502.252) -- 0:00:24
      756000 -- (-499.934) [-501.119] (-502.020) (-496.541) * (-500.970) (-501.006) [-501.842] (-505.222) -- 0:00:24
      756500 -- (-497.751) (-507.131) (-498.897) [-499.777] * (-501.093) [-498.291] (-509.078) (-498.324) -- 0:00:24
      757000 -- (-497.393) (-505.545) (-506.637) [-495.436] * [-500.008] (-501.191) (-508.065) (-505.669) -- 0:00:24
      757500 -- (-496.694) [-505.082] (-508.268) (-500.788) * [-502.531] (-500.067) (-511.183) (-508.581) -- 0:00:24
      758000 -- (-498.013) (-500.906) (-503.670) [-496.793] * [-500.474] (-505.755) (-502.198) (-502.450) -- 0:00:23
      758500 -- (-497.337) (-497.965) [-498.400] (-501.182) * (-509.042) [-504.110] (-502.330) (-500.049) -- 0:00:23
      759000 -- [-503.598] (-501.216) (-499.740) (-501.927) * (-501.491) (-507.546) [-503.378] (-500.144) -- 0:00:23
      759500 -- [-499.586] (-500.408) (-506.411) (-511.534) * (-498.643) [-494.561] (-505.187) (-500.447) -- 0:00:23
      760000 -- (-499.819) [-505.372] (-504.069) (-500.556) * [-498.984] (-500.237) (-511.924) (-501.101) -- 0:00:23

      Average standard deviation of split frequencies: 0.012808

      760500 -- [-499.556] (-509.745) (-499.738) (-499.703) * (-503.365) (-502.973) (-506.009) [-496.880] -- 0:00:23
      761000 -- (-508.447) (-501.774) [-506.736] (-497.994) * (-502.215) (-497.616) [-513.543] (-496.973) -- 0:00:23
      761500 -- (-503.941) (-498.667) (-501.232) [-499.088] * [-502.753] (-504.899) (-505.931) (-504.815) -- 0:00:23
      762000 -- (-501.447) (-497.648) (-503.313) [-500.384] * (-503.974) [-500.602] (-507.249) (-499.663) -- 0:00:23
      762500 -- (-502.273) (-501.846) (-501.863) [-504.262] * (-504.865) (-496.686) (-510.564) [-499.437] -- 0:00:23
      763000 -- (-502.989) (-500.454) [-500.853] (-505.036) * (-507.168) (-499.687) [-505.226] (-505.751) -- 0:00:23
      763500 -- (-506.990) (-499.373) [-498.523] (-506.068) * (-500.880) (-500.342) [-505.633] (-503.565) -- 0:00:23
      764000 -- (-498.932) (-500.769) (-502.656) [-499.884] * [-497.258] (-500.683) (-507.237) (-499.930) -- 0:00:23
      764500 -- (-500.034) [-500.598] (-504.600) (-510.458) * (-500.352) [-498.552] (-503.534) (-502.233) -- 0:00:23
      765000 -- [-501.124] (-507.102) (-502.643) (-507.837) * (-504.793) [-504.720] (-511.517) (-510.128) -- 0:00:23

      Average standard deviation of split frequencies: 0.013334

      765500 -- (-503.437) (-497.492) [-499.029] (-504.794) * [-502.218] (-498.737) (-499.474) (-505.046) -- 0:00:23
      766000 -- (-505.389) (-500.334) (-498.948) [-506.699] * (-499.568) (-509.761) [-499.754] (-499.595) -- 0:00:23
      766500 -- (-511.804) [-499.829] (-497.709) (-504.560) * (-501.159) (-503.881) (-499.163) [-499.048] -- 0:00:23
      767000 -- [-504.857] (-503.967) (-504.570) (-503.653) * (-502.117) (-497.707) (-509.268) [-502.471] -- 0:00:23
      767500 -- (-500.365) [-501.316] (-504.714) (-503.369) * [-501.351] (-501.939) (-507.382) (-509.436) -- 0:00:23
      768000 -- (-505.630) (-500.928) [-497.577] (-502.930) * (-503.061) (-505.418) [-498.029] (-504.563) -- 0:00:22
      768500 -- (-503.413) (-505.685) (-500.626) [-500.842] * (-498.892) (-507.966) [-500.759] (-506.171) -- 0:00:22
      769000 -- (-498.384) (-498.343) (-498.602) [-498.218] * [-495.568] (-508.839) (-499.419) (-495.869) -- 0:00:22
      769500 -- (-502.843) [-500.990] (-499.633) (-501.036) * (-497.955) (-503.339) [-503.699] (-501.509) -- 0:00:22
      770000 -- (-499.838) [-499.993] (-500.110) (-499.956) * (-506.698) (-506.635) (-509.246) [-500.691] -- 0:00:22

      Average standard deviation of split frequencies: 0.013049

      770500 -- (-505.982) (-500.127) [-501.251] (-499.804) * (-498.418) (-504.293) [-498.574] (-503.413) -- 0:00:22
      771000 -- (-503.591) (-496.810) (-504.846) [-501.663] * (-505.724) (-509.650) [-499.473] (-500.457) -- 0:00:22
      771500 -- (-499.505) (-503.104) [-498.708] (-502.893) * [-499.242] (-501.249) (-496.754) (-497.297) -- 0:00:22
      772000 -- [-500.272] (-500.103) (-504.249) (-495.628) * (-499.623) (-505.723) [-503.456] (-500.831) -- 0:00:22
      772500 -- (-503.880) (-500.655) (-503.267) [-499.391] * (-501.900) (-504.303) [-503.579] (-501.839) -- 0:00:22
      773000 -- [-501.592] (-505.147) (-501.164) (-504.937) * (-501.710) (-505.606) (-495.996) [-498.924] -- 0:00:22
      773500 -- (-499.999) (-502.931) (-498.356) [-499.521] * (-504.208) (-500.489) [-499.494] (-502.011) -- 0:00:22
      774000 -- (-505.359) (-505.790) [-496.551] (-510.378) * (-504.125) [-500.974] (-508.825) (-499.575) -- 0:00:22
      774500 -- [-501.077] (-498.050) (-501.757) (-503.279) * (-499.722) (-506.187) [-498.004] (-501.277) -- 0:00:22
      775000 -- (-499.128) [-503.373] (-500.876) (-505.566) * (-506.107) [-508.167] (-499.405) (-504.547) -- 0:00:22

      Average standard deviation of split frequencies: 0.011745

      775500 -- [-498.754] (-498.068) (-503.345) (-507.028) * [-502.483] (-503.243) (-501.801) (-506.471) -- 0:00:22
      776000 -- (-497.204) [-499.733] (-514.823) (-505.769) * (-506.185) (-499.109) (-496.527) [-499.881] -- 0:00:22
      776500 -- [-497.201] (-503.740) (-498.508) (-506.716) * (-502.982) [-499.921] (-498.659) (-501.035) -- 0:00:22
      777000 -- (-501.563) (-500.382) [-500.865] (-500.958) * (-503.425) (-496.545) [-500.885] (-504.728) -- 0:00:22
      777500 -- (-501.149) [-498.344] (-499.799) (-499.876) * (-507.630) (-506.108) [-502.924] (-503.359) -- 0:00:22
      778000 -- [-501.809] (-500.769) (-499.038) (-498.480) * [-500.462] (-504.310) (-500.426) (-502.742) -- 0:00:21
      778500 -- (-502.801) (-506.635) (-500.102) [-500.426] * (-502.647) (-497.356) (-500.879) [-500.171] -- 0:00:21
      779000 -- (-498.049) (-499.839) (-503.119) [-503.344] * (-506.714) (-503.245) (-500.588) [-497.641] -- 0:00:21
      779500 -- (-501.787) (-499.274) (-499.594) [-501.503] * (-509.291) (-506.316) [-499.492] (-496.441) -- 0:00:21
      780000 -- (-501.699) (-497.762) [-499.964] (-497.050) * (-502.702) [-502.610] (-503.470) (-501.821) -- 0:00:21

      Average standard deviation of split frequencies: 0.010265

      780500 -- [-502.011] (-500.129) (-503.654) (-503.342) * (-503.073) (-502.288) [-501.699] (-501.191) -- 0:00:21
      781000 -- (-504.014) (-507.935) [-499.050] (-498.701) * (-499.657) (-506.399) (-496.673) [-497.808] -- 0:00:21
      781500 -- (-499.663) (-511.229) (-502.990) [-495.827] * [-501.139] (-500.737) (-503.248) (-498.205) -- 0:00:21
      782000 -- (-500.647) (-504.929) [-503.890] (-497.641) * (-501.723) [-505.333] (-500.183) (-501.017) -- 0:00:21
      782500 -- [-505.593] (-513.252) (-498.105) (-499.623) * (-499.399) [-501.695] (-499.867) (-499.251) -- 0:00:21
      783000 -- (-504.450) (-504.180) (-504.039) [-500.497] * (-503.579) [-500.364] (-498.682) (-499.922) -- 0:00:21
      783500 -- (-501.314) (-507.667) (-501.700) [-498.333] * (-505.482) (-509.324) (-499.499) [-510.271] -- 0:00:21
      784000 -- (-503.219) (-500.129) [-502.742] (-504.439) * (-505.758) (-501.862) [-497.267] (-504.440) -- 0:00:21
      784500 -- (-506.308) (-502.747) [-498.307] (-504.579) * (-495.245) (-502.874) [-502.950] (-498.930) -- 0:00:21
      785000 -- (-502.292) (-506.469) [-500.878] (-504.526) * (-502.687) (-506.225) (-501.634) [-498.528] -- 0:00:21

      Average standard deviation of split frequencies: 0.009196

      785500 -- (-503.884) (-514.274) (-496.339) [-501.149] * (-502.808) [-499.442] (-505.642) (-506.107) -- 0:00:21
      786000 -- (-501.498) (-504.726) [-501.075] (-505.308) * (-507.472) (-506.513) (-497.388) [-498.524] -- 0:00:21
      786500 -- (-502.827) (-504.017) [-498.088] (-502.140) * (-503.912) (-500.679) [-502.781] (-500.472) -- 0:00:21
      787000 -- (-504.273) (-507.999) [-497.329] (-499.676) * (-502.933) (-503.520) (-504.161) [-499.444] -- 0:00:21
      787500 -- [-502.293] (-500.600) (-504.996) (-500.259) * [-500.761] (-503.260) (-497.624) (-496.656) -- 0:00:21
      788000 -- [-497.431] (-505.757) (-502.410) (-504.173) * (-512.266) (-508.298) [-502.031] (-504.052) -- 0:00:20
      788500 -- (-505.969) [-499.672] (-505.060) (-501.530) * (-500.045) (-502.806) [-504.431] (-498.207) -- 0:00:20
      789000 -- (-500.517) (-500.697) (-505.224) [-500.321] * (-505.730) [-501.410] (-500.597) (-503.685) -- 0:00:20
      789500 -- [-506.396] (-500.083) (-506.307) (-502.893) * (-505.684) [-495.102] (-498.160) (-505.238) -- 0:00:20
      790000 -- (-505.588) (-503.760) (-503.646) [-502.577] * [-502.377] (-499.875) (-502.091) (-506.932) -- 0:00:20

      Average standard deviation of split frequencies: 0.009539

      790500 -- (-499.859) [-500.267] (-498.790) (-501.643) * (-499.504) (-509.510) [-503.217] (-503.162) -- 0:00:20
      791000 -- [-502.278] (-505.115) (-500.947) (-498.990) * [-500.396] (-501.757) (-502.653) (-505.394) -- 0:00:20
      791500 -- (-503.815) (-503.600) [-500.824] (-500.244) * (-499.760) (-500.713) (-499.650) [-502.400] -- 0:00:20
      792000 -- (-501.215) (-504.946) [-504.215] (-498.579) * (-503.816) [-498.226] (-501.175) (-512.938) -- 0:00:20
      792500 -- (-499.526) [-498.670] (-500.399) (-507.203) * [-503.958] (-503.200) (-510.320) (-508.711) -- 0:00:20
      793000 -- (-508.563) (-498.931) [-497.123] (-502.722) * (-503.029) [-500.336] (-508.350) (-508.776) -- 0:00:20
      793500 -- (-501.551) (-505.071) (-501.738) [-501.632] * (-503.065) [-506.324] (-511.209) (-498.821) -- 0:00:20
      794000 -- (-505.645) (-498.069) [-502.935] (-498.943) * (-499.551) [-500.097] (-503.377) (-500.545) -- 0:00:20
      794500 -- (-497.052) [-498.804] (-505.980) (-498.808) * (-502.103) [-500.258] (-508.782) (-502.151) -- 0:00:20
      795000 -- (-498.627) (-503.132) (-506.459) [-497.663] * (-504.282) (-502.060) (-505.746) [-503.852] -- 0:00:20

      Average standard deviation of split frequencies: 0.009081

      795500 -- [-504.969] (-497.652) (-505.408) (-502.790) * (-499.992) [-497.388] (-505.318) (-500.010) -- 0:00:20
      796000 -- (-506.094) [-500.363] (-498.756) (-502.531) * (-503.858) (-504.670) (-501.675) [-502.189] -- 0:00:20
      796500 -- (-507.342) (-497.646) (-497.948) [-498.512] * (-498.223) [-509.727] (-504.795) (-501.581) -- 0:00:20
      797000 -- (-501.700) [-498.047] (-505.595) (-506.217) * [-498.948] (-506.581) (-501.767) (-507.739) -- 0:00:20
      797500 -- (-504.705) [-498.086] (-503.054) (-505.981) * [-498.511] (-499.995) (-513.000) (-500.006) -- 0:00:20
      798000 -- (-502.113) [-498.101] (-502.424) (-501.275) * (-508.709) [-501.782] (-503.222) (-502.783) -- 0:00:19
      798500 -- (-502.848) (-500.083) [-507.818] (-503.712) * [-502.758] (-497.531) (-505.159) (-500.701) -- 0:00:19
      799000 -- [-499.915] (-499.750) (-497.468) (-504.426) * (-500.499) [-499.810] (-503.325) (-501.248) -- 0:00:19
      799500 -- (-501.973) (-499.601) (-501.465) [-502.395] * (-507.886) [-499.693] (-499.471) (-505.343) -- 0:00:19
      800000 -- [-497.936] (-500.180) (-502.389) (-500.668) * (-506.593) (-504.908) [-500.539] (-499.163) -- 0:00:19

      Average standard deviation of split frequencies: 0.007654

      800500 -- [-501.281] (-504.201) (-504.810) (-500.790) * (-511.868) [-503.424] (-499.154) (-500.813) -- 0:00:19
      801000 -- (-502.614) (-505.134) [-502.862] (-505.382) * (-502.873) [-500.820] (-497.109) (-497.375) -- 0:00:19
      801500 -- (-503.440) (-507.748) [-504.128] (-498.429) * (-506.105) (-505.969) [-498.712] (-502.277) -- 0:00:19
      802000 -- (-503.573) [-498.625] (-501.120) (-506.237) * [-499.700] (-512.138) (-499.444) (-501.068) -- 0:00:19
      802500 -- (-503.510) (-499.285) [-503.205] (-505.438) * (-500.573) (-504.591) [-503.583] (-504.840) -- 0:00:19
      803000 -- (-501.204) (-502.279) (-506.090) [-504.819] * (-505.365) (-498.800) (-500.759) [-506.841] -- 0:00:19
      803500 -- (-503.892) (-500.665) [-497.340] (-504.423) * [-498.923] (-498.502) (-498.218) (-503.841) -- 0:00:19
      804000 -- (-506.057) [-502.107] (-499.798) (-500.457) * (-499.555) (-502.644) [-496.957] (-503.118) -- 0:00:19
      804500 -- (-495.098) (-504.196) [-500.142] (-506.055) * (-508.832) (-501.216) (-502.086) [-503.402] -- 0:00:19
      805000 -- (-500.282) [-499.097] (-498.610) (-504.938) * (-504.078) (-506.163) (-496.295) [-503.726] -- 0:00:19

      Average standard deviation of split frequencies: 0.007213

      805500 -- (-500.293) [-498.068] (-498.311) (-504.628) * (-502.931) [-501.468] (-502.214) (-509.648) -- 0:00:19
      806000 -- (-501.101) (-505.798) [-497.735] (-508.384) * (-506.418) [-499.504] (-502.747) (-504.156) -- 0:00:19
      806500 -- [-495.458] (-505.920) (-498.860) (-505.254) * (-503.308) [-500.466] (-498.726) (-508.661) -- 0:00:19
      807000 -- [-501.651] (-500.715) (-500.329) (-504.665) * (-500.009) (-499.390) (-500.291) [-505.148] -- 0:00:19
      807500 -- (-501.699) (-504.564) [-498.773] (-513.885) * (-502.266) [-500.734] (-497.918) (-508.058) -- 0:00:19
      808000 -- (-502.610) (-502.866) [-497.339] (-511.004) * [-504.305] (-499.169) (-500.290) (-507.346) -- 0:00:19
      808500 -- (-507.284) (-500.389) [-500.819] (-511.996) * (-501.724) (-504.774) [-495.497] (-504.808) -- 0:00:18
      809000 -- (-503.354) [-498.883] (-505.910) (-514.837) * (-499.823) [-496.910] (-505.589) (-509.800) -- 0:00:18
      809500 -- (-501.356) (-506.804) [-507.046] (-507.828) * (-497.867) (-498.960) (-502.012) [-504.345] -- 0:00:18
      810000 -- [-497.301] (-503.857) (-508.659) (-510.191) * (-500.301) (-503.455) (-500.650) [-505.934] -- 0:00:18

      Average standard deviation of split frequencies: 0.007560

      810500 -- [-498.288] (-500.342) (-506.021) (-508.393) * [-495.417] (-502.915) (-509.714) (-504.851) -- 0:00:18
      811000 -- [-499.845] (-501.873) (-504.771) (-515.218) * [-500.162] (-502.417) (-498.629) (-503.086) -- 0:00:18
      811500 -- (-506.187) [-497.530] (-508.787) (-507.770) * (-503.046) (-504.112) (-495.993) [-499.252] -- 0:00:18
      812000 -- (-504.907) (-500.499) [-500.993] (-504.506) * (-503.833) [-503.351] (-502.132) (-508.525) -- 0:00:18
      812500 -- (-499.122) [-502.556] (-507.023) (-503.013) * (-507.063) (-504.159) (-502.645) [-504.975] -- 0:00:18
      813000 -- (-504.732) [-499.414] (-504.081) (-505.051) * [-499.073] (-506.357) (-497.467) (-507.151) -- 0:00:18
      813500 -- (-503.834) (-500.777) (-500.494) [-504.194] * (-495.436) (-503.339) [-497.804] (-499.776) -- 0:00:18
      814000 -- (-496.472) [-503.156] (-503.986) (-505.348) * (-504.348) (-504.989) [-498.765] (-499.627) -- 0:00:18
      814500 -- (-501.783) (-501.791) (-500.701) [-506.744] * (-499.708) [-502.145] (-499.493) (-500.303) -- 0:00:18
      815000 -- [-497.822] (-499.005) (-504.128) (-499.622) * [-501.424] (-507.578) (-507.168) (-504.351) -- 0:00:18

      Average standard deviation of split frequencies: 0.008280

      815500 -- (-508.593) [-506.840] (-504.853) (-497.629) * (-501.192) (-504.353) (-504.994) [-499.779] -- 0:00:18
      816000 -- (-502.660) (-511.436) (-507.249) [-497.813] * [-501.303] (-504.808) (-502.228) (-508.143) -- 0:00:18
      816500 -- (-498.902) (-506.276) (-502.925) [-496.319] * (-497.015) [-498.760] (-499.370) (-506.734) -- 0:00:18
      817000 -- (-501.587) (-500.018) [-502.562] (-504.499) * (-509.505) [-500.909] (-502.083) (-501.898) -- 0:00:18
      817500 -- (-505.487) [-500.569] (-502.189) (-498.245) * [-503.715] (-499.209) (-502.059) (-501.048) -- 0:00:18
      818000 -- (-501.951) [-502.058] (-505.244) (-503.652) * (-506.342) (-505.919) [-498.843] (-500.684) -- 0:00:18
      818500 -- (-503.187) (-498.307) (-506.059) [-498.971] * (-506.883) [-504.997] (-500.918) (-503.272) -- 0:00:17
      819000 -- (-506.709) (-500.034) [-500.885] (-502.409) * (-498.754) [-498.461] (-503.572) (-498.372) -- 0:00:17
      819500 -- (-498.315) (-499.100) (-501.509) [-497.163] * [-502.555] (-495.747) (-497.250) (-504.522) -- 0:00:17
      820000 -- (-499.237) [-505.679] (-498.668) (-499.959) * [-496.490] (-501.208) (-494.831) (-501.047) -- 0:00:17

      Average standard deviation of split frequencies: 0.008233

      820500 -- [-498.298] (-501.701) (-495.751) (-503.329) * (-500.391) (-503.866) [-497.346] (-499.455) -- 0:00:17
      821000 -- (-504.907) (-502.777) [-495.767] (-504.651) * [-507.011] (-504.847) (-502.020) (-497.931) -- 0:00:17
      821500 -- (-498.514) (-499.671) (-501.060) [-496.897] * [-497.335] (-500.088) (-504.194) (-504.319) -- 0:00:17
      822000 -- (-506.388) (-500.512) [-500.373] (-501.078) * [-499.261] (-504.956) (-500.589) (-505.518) -- 0:00:17
      822500 -- (-505.796) [-503.437] (-505.836) (-500.010) * (-499.681) [-501.704] (-501.804) (-499.353) -- 0:00:17
      823000 -- (-499.775) [-499.872] (-498.450) (-506.938) * (-505.058) (-505.502) [-501.211] (-504.726) -- 0:00:17
      823500 -- (-501.054) (-499.861) (-502.291) [-501.266] * (-507.926) (-498.443) [-499.257] (-502.185) -- 0:00:17
      824000 -- (-502.658) [-506.775] (-502.585) (-501.450) * (-505.357) (-505.085) (-501.322) [-504.488] -- 0:00:17
      824500 -- (-500.601) [-499.877] (-499.482) (-505.138) * (-502.980) (-504.642) [-500.247] (-502.627) -- 0:00:17
      825000 -- [-499.758] (-500.343) (-497.051) (-505.970) * (-506.913) (-504.936) [-497.854] (-504.807) -- 0:00:17

      Average standard deviation of split frequencies: 0.007800

      825500 -- (-496.124) (-497.894) [-495.767] (-509.249) * (-501.837) (-503.962) (-502.061) [-504.258] -- 0:00:17
      826000 -- (-504.229) [-498.740] (-499.391) (-505.455) * [-502.084] (-504.838) (-500.999) (-503.282) -- 0:00:17
      826500 -- (-508.290) (-500.797) (-501.150) [-508.620] * (-505.399) [-501.218] (-499.159) (-506.529) -- 0:00:17
      827000 -- (-506.379) (-498.194) [-501.283] (-500.100) * [-502.093] (-508.320) (-500.348) (-501.401) -- 0:00:17
      827500 -- (-502.882) [-508.421] (-503.206) (-505.690) * (-504.649) (-501.624) [-497.430] (-500.217) -- 0:00:17
      828000 -- (-510.117) (-502.393) [-497.453] (-503.777) * (-504.845) (-499.098) [-497.882] (-505.116) -- 0:00:17
      828500 -- [-504.005] (-499.627) (-501.599) (-505.489) * (-501.748) [-504.205] (-499.573) (-503.663) -- 0:00:16
      829000 -- (-512.224) [-499.542] (-498.335) (-502.522) * (-499.796) (-501.676) [-500.383] (-502.399) -- 0:00:16
      829500 -- (-509.370) (-505.074) (-507.904) [-506.743] * [-498.393] (-503.311) (-499.588) (-512.351) -- 0:00:16
      830000 -- (-504.992) (-502.811) (-497.095) [-497.406] * [-496.487] (-512.250) (-498.032) (-521.754) -- 0:00:16

      Average standard deviation of split frequencies: 0.007756

      830500 -- (-509.063) [-500.282] (-505.288) (-499.541) * (-498.777) (-508.863) [-500.764] (-507.854) -- 0:00:16
      831000 -- (-510.720) (-498.284) (-504.134) [-496.255] * (-500.668) (-504.221) [-501.935] (-506.121) -- 0:00:16
      831500 -- (-501.013) [-499.267] (-502.207) (-502.577) * [-500.129] (-502.378) (-497.680) (-505.554) -- 0:00:16
      832000 -- (-499.449) [-501.881] (-503.075) (-497.039) * [-497.207] (-503.943) (-496.602) (-511.343) -- 0:00:16
      832500 -- (-500.724) (-500.504) (-512.217) [-501.573] * (-498.782) (-505.750) [-497.257] (-500.215) -- 0:00:16
      833000 -- (-504.291) [-499.529] (-505.650) (-497.277) * (-499.729) (-502.622) [-499.946] (-499.423) -- 0:00:16
      833500 -- (-505.355) (-501.428) (-501.266) [-497.617] * (-498.630) (-505.312) [-499.308] (-512.015) -- 0:00:16
      834000 -- (-504.643) (-501.300) [-500.400] (-504.870) * (-506.338) (-507.258) [-496.747] (-509.154) -- 0:00:16
      834500 -- (-505.020) [-503.440] (-501.429) (-503.082) * (-509.143) (-505.010) (-499.870) [-502.031] -- 0:00:16
      835000 -- (-510.641) (-501.029) [-499.176] (-506.263) * (-502.547) (-501.636) [-503.471] (-499.542) -- 0:00:16

      Average standard deviation of split frequencies: 0.006767

      835500 -- [-502.388] (-499.148) (-498.548) (-503.588) * (-499.971) [-501.287] (-504.255) (-502.382) -- 0:00:16
      836000 -- (-508.334) [-498.085] (-503.280) (-512.601) * (-502.535) (-506.620) (-499.958) [-500.078] -- 0:00:16
      836500 -- (-507.721) [-499.016] (-500.456) (-498.890) * (-499.057) (-497.999) (-502.355) [-498.499] -- 0:00:16
      837000 -- (-501.321) (-496.652) [-498.143] (-499.194) * (-502.025) [-498.981] (-502.346) (-497.557) -- 0:00:16
      837500 -- (-507.372) (-499.347) (-505.731) [-499.551] * (-503.763) (-500.248) [-496.496] (-499.863) -- 0:00:16
      838000 -- (-508.773) (-504.114) [-503.919] (-504.265) * (-504.160) (-500.450) [-501.030] (-497.105) -- 0:00:16
      838500 -- (-507.373) [-503.072] (-507.836) (-498.565) * (-498.614) (-501.988) (-500.897) [-495.416] -- 0:00:15
      839000 -- (-510.440) (-498.355) (-503.252) [-502.059] * (-507.091) [-496.490] (-506.707) (-499.893) -- 0:00:15
      839500 -- (-505.694) (-498.074) [-501.027] (-504.661) * [-497.622] (-507.616) (-500.199) (-501.718) -- 0:00:15
      840000 -- (-508.980) (-500.086) (-503.254) [-498.778] * (-503.244) (-497.354) [-497.636] (-503.922) -- 0:00:15

      Average standard deviation of split frequencies: 0.007851

      840500 -- (-514.451) (-499.582) (-502.368) [-506.744] * [-495.862] (-497.762) (-496.867) (-508.199) -- 0:00:15
      841000 -- (-500.562) (-504.102) (-500.533) [-495.578] * [-498.548] (-498.702) (-499.973) (-513.648) -- 0:00:15
      841500 -- [-498.135] (-499.775) (-500.932) (-501.661) * (-497.644) (-498.861) [-495.490] (-507.764) -- 0:00:15
      842000 -- (-504.265) [-499.805] (-510.312) (-505.008) * (-502.176) (-498.909) [-498.035] (-506.242) -- 0:00:15
      842500 -- (-498.824) (-508.297) [-500.470] (-502.682) * (-499.022) (-501.165) (-505.186) [-503.351] -- 0:00:15
      843000 -- (-501.680) [-499.799] (-502.695) (-496.621) * [-500.757] (-503.177) (-502.958) (-502.992) -- 0:00:15
      843500 -- [-497.393] (-499.731) (-502.901) (-498.401) * (-499.822) [-502.601] (-499.382) (-507.140) -- 0:00:15
      844000 -- (-500.417) (-497.327) (-501.170) [-501.685] * [-497.715] (-503.976) (-503.194) (-510.367) -- 0:00:15
      844500 -- [-497.929] (-502.224) (-498.520) (-502.245) * (-497.082) [-506.483] (-504.170) (-508.580) -- 0:00:15
      845000 -- (-503.455) (-502.512) (-506.651) [-500.766] * (-495.154) [-499.096] (-504.370) (-500.911) -- 0:00:15

      Average standard deviation of split frequencies: 0.007987

      845500 -- (-505.994) (-506.201) (-507.194) [-497.892] * (-498.388) [-500.712] (-504.964) (-511.428) -- 0:00:15
      846000 -- [-501.094] (-504.702) (-508.926) (-502.379) * [-501.642] (-502.074) (-497.878) (-505.447) -- 0:00:15
      846500 -- (-500.246) [-505.597] (-500.840) (-497.285) * (-504.601) [-502.981] (-500.439) (-498.442) -- 0:00:15
      847000 -- (-498.804) (-502.636) (-505.521) [-499.052] * [-500.194] (-502.655) (-504.032) (-522.389) -- 0:00:15
      847500 -- (-499.369) (-503.962) (-502.412) [-497.459] * (-500.785) (-510.703) [-508.977] (-497.278) -- 0:00:15
      848000 -- [-497.788] (-505.444) (-499.719) (-500.410) * (-502.001) [-503.097] (-499.648) (-499.166) -- 0:00:15
      848500 -- (-502.163) (-505.449) [-500.534] (-502.165) * [-502.908] (-503.452) (-507.344) (-505.522) -- 0:00:14
      849000 -- (-498.803) [-501.060] (-502.233) (-508.211) * (-498.863) [-505.051] (-499.961) (-504.806) -- 0:00:14
      849500 -- (-499.232) (-503.749) [-500.107] (-503.050) * [-498.353] (-503.788) (-507.320) (-502.226) -- 0:00:14
      850000 -- (-502.860) (-510.875) (-500.002) [-501.753] * [-503.021] (-501.457) (-501.371) (-502.662) -- 0:00:14

      Average standard deviation of split frequencies: 0.007204

      850500 -- (-502.075) (-502.824) (-507.784) [-502.230] * (-501.781) (-503.933) [-503.833] (-504.197) -- 0:00:14
      851000 -- (-503.916) (-507.313) [-500.413] (-501.280) * [-499.736] (-506.568) (-509.673) (-504.211) -- 0:00:14
      851500 -- (-504.021) [-499.914] (-502.101) (-496.856) * (-501.329) [-503.068] (-500.921) (-503.107) -- 0:00:14
      852000 -- (-502.261) [-506.418] (-502.018) (-497.657) * [-498.664] (-502.755) (-510.532) (-506.194) -- 0:00:14
      852500 -- (-497.787) [-495.559] (-500.499) (-501.050) * (-501.855) (-502.012) (-507.785) [-502.094] -- 0:00:14
      853000 -- (-501.416) [-499.992] (-505.141) (-510.719) * (-499.122) [-506.320] (-502.361) (-502.739) -- 0:00:14
      853500 -- (-503.624) (-499.077) [-500.342] (-507.106) * [-505.421] (-511.190) (-500.194) (-505.545) -- 0:00:14
      854000 -- (-509.647) [-497.977] (-502.632) (-502.855) * (-502.893) (-500.961) [-503.336] (-505.041) -- 0:00:14
      854500 -- (-506.981) [-498.596] (-502.918) (-502.049) * (-500.029) (-499.696) (-503.925) [-503.444] -- 0:00:14
      855000 -- (-505.029) [-496.725] (-504.650) (-504.901) * (-502.513) (-508.459) [-496.993] (-500.891) -- 0:00:14

      Average standard deviation of split frequencies: 0.008077

      855500 -- [-500.612] (-503.164) (-508.503) (-510.481) * (-506.595) (-499.435) [-495.987] (-502.020) -- 0:00:14
      856000 -- (-502.170) (-499.007) (-508.546) [-505.011] * (-502.628) [-499.958] (-499.838) (-501.200) -- 0:00:14
      856500 -- (-503.515) [-497.932] (-509.215) (-508.591) * (-510.266) (-503.071) (-502.416) [-497.424] -- 0:00:14
      857000 -- [-501.102] (-511.589) (-508.385) (-512.809) * [-500.251] (-501.643) (-500.210) (-