--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Mon Oct 31 19:46:03 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/128/CG34136-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -754.58 -770.94
2 -755.00 -768.95
--------------------------------------
TOTAL -754.77 -770.38
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.307742 0.047509 0.915263 1.745533 1.290413 1256.47 1378.73 1.000
r(A<->C){all} 0.155407 0.002582 0.065043 0.256972 0.151876 573.62 664.92 1.003
r(A<->G){all} 0.237986 0.004746 0.117070 0.375971 0.230027 527.79 663.48 1.001
r(A<->T){all} 0.101513 0.002006 0.021453 0.187784 0.096931 838.97 844.86 1.003
r(C<->G){all} 0.025833 0.000314 0.000015 0.059717 0.022725 967.44 994.91 1.000
r(C<->T){all} 0.450892 0.006478 0.282467 0.595929 0.451552 551.36 554.72 1.001
r(G<->T){all} 0.028368 0.000342 0.000009 0.064008 0.024809 668.99 879.63 1.002
pi(A){all} 0.226339 0.000622 0.176831 0.273778 0.225487 896.00 1106.35 1.000
pi(C){all} 0.266336 0.000708 0.210521 0.315732 0.265825 732.94 845.64 1.000
pi(G){all} 0.250408 0.000721 0.199227 0.304458 0.250191 908.79 1204.89 1.000
pi(T){all} 0.256916 0.000688 0.204267 0.306279 0.256460 1094.34 1116.63 1.000
alpha{1,2} 0.107439 0.000545 0.069203 0.156872 0.104910 1354.59 1362.35 1.000
alpha{3} 1.831512 0.450959 0.721324 3.178297 1.717340 1342.80 1421.90 1.000
pinvar{all} 0.379773 0.007002 0.207156 0.534650 0.384286 1170.89 1228.97 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -703.835402
Model 2: PositiveSelection -703.835402
Model 0: one-ratio -704.164499
Model 3: discrete -702.971495
Model 7: beta -703.021233
Model 8: beta&w>1 -703.021493
Model 0 vs 1 0.6581939999998667
Model 2 vs 1 0.0
Model 8 vs 7 5.199999998239946E-4
>C1
MWPNFLAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C2
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C3
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C4
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C5
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C6
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C7
MWPNFVAVISLLCLAFFAWANAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C8
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C9
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C10
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C11
MWPNFVAVFSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C12
MWPNFVAVISMLCLAFFTWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=77
C1 MWPNFLAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
C2 MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
C3 MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
C4 MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
C5 MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
C6 MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
C7 MWPNFVAVISLLCLAFFAWANAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
C8 MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
C9 MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
C10 MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
C11 MWPNFVAVFSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
C12 MWPNFVAVISMLCLAFFTWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
*****:**.*:******:**:*****************************
C1 VLMMRRCRHLRVPTAPRLGDVLKRKKK
C2 VLMMRRCRHLRVPTAPRLGDVLKRKKK
C3 VLMMRRCRHLRVPTAPRLGDVLKRKKK
C4 VLMMRRCRHLRVPTAPRLGDVLKRKKK
C5 VLMMRRCRHLRVPTAPRLGDVLKRKKK
C6 VLMMRRCRHLRVPTAPRLGDVLKRKKK
C7 VLMMRRCRHLRVPTAPRLGDVLKRKKK
C8 VLMMRRCRHLRVPTAPRLGDVLKRKKK
C9 VLMMRRCRHLRVPTAPRLGDVLKRKKK
C10 VLMMRRCRHLRVPTAPRLGDVLKRKKK
C11 VLMMRRCRHLRVPTAPRLGDVLKRKKK
C12 VLMMRRCRHLRVPTAPRLGDVLKRKKK
***************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10164]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [10164]--->[10164]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/128/CG34136-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.586 Mb, Max= 30.834 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MWPNFLAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C2
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C3
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C4
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C5
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C6
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C7
MWPNFVAVISLLCLAFFAWANAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C8
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C9
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C10
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C11
MWPNFVAVFSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C12
MWPNFVAVISMLCLAFFTWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
FORMAT of file /tmp/tmp304245188064102558aln Not Supported[FATAL:T-COFFEE]
>C1
MWPNFLAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C2
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C3
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C4
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C5
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C6
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C7
MWPNFVAVISLLCLAFFAWANAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C8
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C9
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C10
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C11
MWPNFVAVFSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C12
MWPNFVAVISMLCLAFFTWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:77 S:100 BS:77
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# PW_SEQ_DISTANCES
BOT 0 1 98.70 C1 C2 98.70
TOP 1 0 98.70 C2 C1 98.70
BOT 0 2 98.70 C1 C3 98.70
TOP 2 0 98.70 C3 C1 98.70
BOT 0 3 98.70 C1 C4 98.70
TOP 3 0 98.70 C4 C1 98.70
BOT 0 4 98.70 C1 C5 98.70
TOP 4 0 98.70 C5 C1 98.70
BOT 0 5 97.40 C1 C6 97.40
TOP 5 0 97.40 C6 C1 97.40
BOT 0 6 96.10 C1 C7 96.10
TOP 6 0 96.10 C7 C1 96.10
BOT 0 7 97.40 C1 C8 97.40
TOP 7 0 97.40 C8 C1 97.40
BOT 0 8 97.40 C1 C9 97.40
TOP 8 0 97.40 C9 C1 97.40
BOT 0 9 97.40 C1 C10 97.40
TOP 9 0 97.40 C10 C1 97.40
BOT 0 10 97.40 C1 C11 97.40
TOP 10 0 97.40 C11 C1 97.40
BOT 0 11 94.81 C1 C12 94.81
TOP 11 0 94.81 C12 C1 94.81
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 98.70 C2 C6 98.70
TOP 5 1 98.70 C6 C2 98.70
BOT 1 6 97.40 C2 C7 97.40
TOP 6 1 97.40 C7 C2 97.40
BOT 1 7 98.70 C2 C8 98.70
TOP 7 1 98.70 C8 C2 98.70
BOT 1 8 98.70 C2 C9 98.70
TOP 8 1 98.70 C9 C2 98.70
BOT 1 9 98.70 C2 C10 98.70
TOP 9 1 98.70 C10 C2 98.70
BOT 1 10 98.70 C2 C11 98.70
TOP 10 1 98.70 C11 C2 98.70
BOT 1 11 96.10 C2 C12 96.10
TOP 11 1 96.10 C12 C2 96.10
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 98.70 C3 C6 98.70
TOP 5 2 98.70 C6 C3 98.70
BOT 2 6 97.40 C3 C7 97.40
TOP 6 2 97.40 C7 C3 97.40
BOT 2 7 98.70 C3 C8 98.70
TOP 7 2 98.70 C8 C3 98.70
BOT 2 8 98.70 C3 C9 98.70
TOP 8 2 98.70 C9 C3 98.70
BOT 2 9 98.70 C3 C10 98.70
TOP 9 2 98.70 C10 C3 98.70
BOT 2 10 98.70 C3 C11 98.70
TOP 10 2 98.70 C11 C3 98.70
BOT 2 11 96.10 C3 C12 96.10
TOP 11 2 96.10 C12 C3 96.10
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 98.70 C4 C6 98.70
TOP 5 3 98.70 C6 C4 98.70
BOT 3 6 97.40 C4 C7 97.40
TOP 6 3 97.40 C7 C4 97.40
BOT 3 7 98.70 C4 C8 98.70
TOP 7 3 98.70 C8 C4 98.70
BOT 3 8 98.70 C4 C9 98.70
TOP 8 3 98.70 C9 C4 98.70
BOT 3 9 98.70 C4 C10 98.70
TOP 9 3 98.70 C10 C4 98.70
BOT 3 10 98.70 C4 C11 98.70
TOP 10 3 98.70 C11 C4 98.70
BOT 3 11 96.10 C4 C12 96.10
TOP 11 3 96.10 C12 C4 96.10
BOT 4 5 98.70 C5 C6 98.70
TOP 5 4 98.70 C6 C5 98.70
BOT 4 6 97.40 C5 C7 97.40
TOP 6 4 97.40 C7 C5 97.40
BOT 4 7 98.70 C5 C8 98.70
TOP 7 4 98.70 C8 C5 98.70
BOT 4 8 98.70 C5 C9 98.70
TOP 8 4 98.70 C9 C5 98.70
BOT 4 9 98.70 C5 C10 98.70
TOP 9 4 98.70 C10 C5 98.70
BOT 4 10 98.70 C5 C11 98.70
TOP 10 4 98.70 C11 C5 98.70
BOT 4 11 96.10 C5 C12 96.10
TOP 11 4 96.10 C12 C5 96.10
BOT 5 6 98.70 C6 C7 98.70
TOP 6 5 98.70 C7 C6 98.70
BOT 5 7 100.00 C6 C8 100.00
TOP 7 5 100.00 C8 C6 100.00
BOT 5 8 100.00 C6 C9 100.00
TOP 8 5 100.00 C9 C6 100.00
BOT 5 9 100.00 C6 C10 100.00
TOP 9 5 100.00 C10 C6 100.00
BOT 5 10 98.70 C6 C11 98.70
TOP 10 5 98.70 C11 C6 98.70
BOT 5 11 97.40 C6 C12 97.40
TOP 11 5 97.40 C12 C6 97.40
BOT 6 7 98.70 C7 C8 98.70
TOP 7 6 98.70 C8 C7 98.70
BOT 6 8 98.70 C7 C9 98.70
TOP 8 6 98.70 C9 C7 98.70
BOT 6 9 98.70 C7 C10 98.70
TOP 9 6 98.70 C10 C7 98.70
BOT 6 10 97.40 C7 C11 97.40
TOP 10 6 97.40 C11 C7 97.40
BOT 6 11 96.10 C7 C12 96.10
TOP 11 6 96.10 C12 C7 96.10
BOT 7 8 100.00 C8 C9 100.00
TOP 8 7 100.00 C9 C8 100.00
BOT 7 9 100.00 C8 C10 100.00
TOP 9 7 100.00 C10 C8 100.00
BOT 7 10 98.70 C8 C11 98.70
TOP 10 7 98.70 C11 C8 98.70
BOT 7 11 97.40 C8 C12 97.40
TOP 11 7 97.40 C12 C8 97.40
BOT 8 9 100.00 C9 C10 100.00
TOP 9 8 100.00 C10 C9 100.00
BOT 8 10 98.70 C9 C11 98.70
TOP 10 8 98.70 C11 C9 98.70
BOT 8 11 97.40 C9 C12 97.40
TOP 11 8 97.40 C12 C9 97.40
BOT 9 10 98.70 C10 C11 98.70
TOP 10 9 98.70 C11 C10 98.70
BOT 9 11 97.40 C10 C12 97.40
TOP 11 9 97.40 C12 C10 97.40
BOT 10 11 96.10 C11 C12 96.10
TOP 11 10 96.10 C12 C11 96.10
AVG 0 C1 * 97.52
AVG 1 C2 * 98.70
AVG 2 C3 * 98.70
AVG 3 C4 * 98.70
AVG 4 C5 * 98.70
AVG 5 C6 * 98.82
AVG 6 C7 * 97.64
AVG 7 C8 * 98.82
AVG 8 C9 * 98.82
AVG 9 C10 * 98.82
AVG 10 C11 * 98.23
AVG 11 C12 * 96.46
TOT TOT * 98.33
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTGGCCCAACTTTTTGGCTGTCGTTTCCCTACTGTGCCTTGCATTCTT
C2 ATGTGGCCCAACTTTGTAGCTGTCGTTTCCCTACTGTGCCTTGCATTCTT
C3 ATGTGGCCCAACTTTGTAGCTGTCGTTTCCCTACTGTGCCTTGCATTCTT
C4 ATGTGGCCCAACTTTGTAGCTGTCGTTTCCCTACTGTGTCTTGCATTCTT
C5 ATGTGGCCCAACTTTGTAGCTGTCGTTTCCCTACTGTGCCTTGCATTCTT
C6 ATGTGGCCCAACTTTGTAGCCGTCATTTCACTGCTGTGCCTTGCATTCTT
C7 ATGTGGCCCAACTTCGTGGCAGTCATTTCCCTGCTGTGCCTTGCATTCTT
C8 ATGTGGCCCAACTTCGTGGCAGTCATTTCCCTGCTGTGCCTTGCATTCTT
C9 ATGTGGCCCAACTTTGTAGCCGTCATTTCCCTGCTATGCCTTGCATTCTT
C10 ATGTGGCCCAACTTTGTAGCCGTCATTTCCCTGCTGTGCCTTGCATTCTT
C11 ATGTGGCCCAACTTTGTTGCCGTCTTTTCCCTGCTGTGCCTTGCATTCTT
C12 ATGTGGCCCAACTTTGTTGCCGTCATTTCCATGCTATGCCTTGCATTCTT
************** * ** *** ****..*.**.** ***********
C1 CGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAT
C2 CGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAT
C3 CGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAT
C4 CGCATGGGCAAAAGCTGGACCAGTGCCAATTGTGAATGAGCACCAACAAT
C5 CGCCTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAT
C6 CGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAC
C7 TGCTTGGGCGAACGCTGGACCCGTGCCAATTGTGAATGAGCACCAACAAC
C8 TGCTTGGGCAAAAGCTGGACCTGTGCCAATAGTGAATGAGCACCAACAAC
C9 CGCTTGGGCAAAAGCTGGACCCGTGCCAATTGTGAATGAGCACCAACAAC
C10 TGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAC
C11 TGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAC
C12 TACTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAC
.* *****.**.******** ********:******************
C1 TGATGCCGAAAGTGCCTCAATGGCACTGCCTGCGCTACTTTAAGCATGAT
C2 TGATGCCGAAAGTGCCTCAATGGCACTGCCTGCGCTACTTTAAGCATGAT
C3 TGATGCCGAAAGTGCCTCAATGGCACTGCCTGCGCTACTTTAAGCATGAT
C4 TGATGCCAAAAGTGCCTCAATGGCACTGTCTGCGATACTTTAAACATGAT
C5 TGATGCCGAAAGTGCCTCAATGGCACTGTCTGCGCTACTTTAAGCACGAT
C6 TGATGCCCAAGGTCCCCCAATGGCACTGTCTGCGCTACTTTAAACATGAT
C7 TGATGCCCAAGGTACCCCAATGGCACTGTCTGCGCTACTTTAAGCATGAC
C8 TGATGCCCAAGGTACCCCAATGGCATTGTCTGCGCTACTTTAAGCATGAC
C9 TAATGCCGAAAGTTCCTCAATGGCATTGTCTACGCTACTTTAAGCACGAT
C10 TGATGCCCAAGGTTCCCCAATGGCACTGTCTACGCTACTTTAAGCACGAT
C11 TGATGCCCAAAGTCCCTCAATGGCATTGCCTGCGCTACTTCAAGCATGAT
C12 TGATGCCCAAAGTCCCTCAATGGCATTGTCTGCGCTACTTCAAGCACGAT
*.***** **.** ** ******** ** **.**.***** **.** **
C1 GTCCTGATGATGCGCCGCTGTCGCCACTTGCGAGTCCCTACAGCGCCACG
C2 GTCCTGATGATGCGTCGCTGTCGCCACTTGCGAGTCCCTACAGCGCCACG
C3 GTCCTGATGATGCGTCGCTGTCGCCACTTGCGAGTCCCTACAGCGCCACG
C4 GTCCTGATGATGCGTCGCTGTCGCCATTTGCGAGTTCCTACGGCGCCGCG
C5 GTCCTGATGATGCGTCGCTGTCGCCATTTGCGAGTTCCTACGGCGCCGCG
C6 GTCCTGATGATGCGCCGCTGTCGCCACTTGCGAGTCCCTACGGCACCGCG
C7 GTCCTGATGATGCGCCGCTGTCGCCATTTGCGAGTCCCTACTGCACCTCG
C8 GTCCTGATGATGCGCCGCTGTCGCCATTTGCGAGTCCCAACGGCGCCTCG
C9 GTCCTGATGATGCGACGTTGTCGCCATTTAAGAGTCCCTACGGCGCCGCG
C10 GTCCTGATGATGCGTCGCTGTCGCCATCTGCGAGTCCCTACGGCGCCGCG
C11 GTCCTGATGATGCGACGTTGCCGGCATTTGCGAGTCCCTACGGCGCCGCG
C12 GTCCTGATGATGCGACGTTGTCGCCATTTGCGAGTCCCTACGGCGCCGCG
************** ** ** ** ** *..**** **:** **.** **
C1 ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA
C2 ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA
C3 ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA
C4 ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA
C5 ACTGGGCGATGTCCTTAAGCGAAAGAAGAAA
C6 ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA
C7 ACTGGGCGATGTCCTTAAGCGTAAGAAGAAA
C8 ACTAGGAGATGTCCTTAAGCGTAAGAAGAAA
C9 ACTGGGAGATGTCCTTAAGCGCAAGAAGAAA
C10 ACTGGGCGATGTCCTCAAGCGCAAGAAGAAA
C11 TCTGGGGGATGTTCTTAAGCGAAAGAAGAAA
C12 TTTGGGCGATGTCCTCAAGCGAAAGAAGAAA
: *.** ***** ** ***** *********
>C1
ATGTGGCCCAACTTTTTGGCTGTCGTTTCCCTACTGTGCCTTGCATTCTT
CGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAT
TGATGCCGAAAGTGCCTCAATGGCACTGCCTGCGCTACTTTAAGCATGAT
GTCCTGATGATGCGCCGCTGTCGCCACTTGCGAGTCCCTACAGCGCCACG
ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA
>C2
ATGTGGCCCAACTTTGTAGCTGTCGTTTCCCTACTGTGCCTTGCATTCTT
CGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAT
TGATGCCGAAAGTGCCTCAATGGCACTGCCTGCGCTACTTTAAGCATGAT
GTCCTGATGATGCGTCGCTGTCGCCACTTGCGAGTCCCTACAGCGCCACG
ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA
>C3
ATGTGGCCCAACTTTGTAGCTGTCGTTTCCCTACTGTGCCTTGCATTCTT
CGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAT
TGATGCCGAAAGTGCCTCAATGGCACTGCCTGCGCTACTTTAAGCATGAT
GTCCTGATGATGCGTCGCTGTCGCCACTTGCGAGTCCCTACAGCGCCACG
ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA
>C4
ATGTGGCCCAACTTTGTAGCTGTCGTTTCCCTACTGTGTCTTGCATTCTT
CGCATGGGCAAAAGCTGGACCAGTGCCAATTGTGAATGAGCACCAACAAT
TGATGCCAAAAGTGCCTCAATGGCACTGTCTGCGATACTTTAAACATGAT
GTCCTGATGATGCGTCGCTGTCGCCATTTGCGAGTTCCTACGGCGCCGCG
ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA
>C5
ATGTGGCCCAACTTTGTAGCTGTCGTTTCCCTACTGTGCCTTGCATTCTT
CGCCTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAT
TGATGCCGAAAGTGCCTCAATGGCACTGTCTGCGCTACTTTAAGCACGAT
GTCCTGATGATGCGTCGCTGTCGCCATTTGCGAGTTCCTACGGCGCCGCG
ACTGGGCGATGTCCTTAAGCGAAAGAAGAAA
>C6
ATGTGGCCCAACTTTGTAGCCGTCATTTCACTGCTGTGCCTTGCATTCTT
CGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAC
TGATGCCCAAGGTCCCCCAATGGCACTGTCTGCGCTACTTTAAACATGAT
GTCCTGATGATGCGCCGCTGTCGCCACTTGCGAGTCCCTACGGCACCGCG
ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA
>C7
ATGTGGCCCAACTTCGTGGCAGTCATTTCCCTGCTGTGCCTTGCATTCTT
TGCTTGGGCGAACGCTGGACCCGTGCCAATTGTGAATGAGCACCAACAAC
TGATGCCCAAGGTACCCCAATGGCACTGTCTGCGCTACTTTAAGCATGAC
GTCCTGATGATGCGCCGCTGTCGCCATTTGCGAGTCCCTACTGCACCTCG
ACTGGGCGATGTCCTTAAGCGTAAGAAGAAA
>C8
ATGTGGCCCAACTTCGTGGCAGTCATTTCCCTGCTGTGCCTTGCATTCTT
TGCTTGGGCAAAAGCTGGACCTGTGCCAATAGTGAATGAGCACCAACAAC
TGATGCCCAAGGTACCCCAATGGCATTGTCTGCGCTACTTTAAGCATGAC
GTCCTGATGATGCGCCGCTGTCGCCATTTGCGAGTCCCAACGGCGCCTCG
ACTAGGAGATGTCCTTAAGCGTAAGAAGAAA
>C9
ATGTGGCCCAACTTTGTAGCCGTCATTTCCCTGCTATGCCTTGCATTCTT
CGCTTGGGCAAAAGCTGGACCCGTGCCAATTGTGAATGAGCACCAACAAC
TAATGCCGAAAGTTCCTCAATGGCATTGTCTACGCTACTTTAAGCACGAT
GTCCTGATGATGCGACGTTGTCGCCATTTAAGAGTCCCTACGGCGCCGCG
ACTGGGAGATGTCCTTAAGCGCAAGAAGAAA
>C10
ATGTGGCCCAACTTTGTAGCCGTCATTTCCCTGCTGTGCCTTGCATTCTT
TGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAC
TGATGCCCAAGGTTCCCCAATGGCACTGTCTACGCTACTTTAAGCACGAT
GTCCTGATGATGCGTCGCTGTCGCCATCTGCGAGTCCCTACGGCGCCGCG
ACTGGGCGATGTCCTCAAGCGCAAGAAGAAA
>C11
ATGTGGCCCAACTTTGTTGCCGTCTTTTCCCTGCTGTGCCTTGCATTCTT
TGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAC
TGATGCCCAAAGTCCCTCAATGGCATTGCCTGCGCTACTTCAAGCATGAT
GTCCTGATGATGCGACGTTGCCGGCATTTGCGAGTCCCTACGGCGCCGCG
TCTGGGGGATGTTCTTAAGCGAAAGAAGAAA
>C12
ATGTGGCCCAACTTTGTTGCCGTCATTTCCATGCTATGCCTTGCATTCTT
TACTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAC
TGATGCCCAAAGTCCCTCAATGGCATTGTCTGCGCTACTTCAAGCACGAT
GTCCTGATGATGCGACGTTGTCGCCATTTGCGAGTCCCTACGGCGCCGCG
TTTGGGCGATGTCCTCAAGCGAAAGAAGAAA
>C1
MWPNFLAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C2
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C3
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C4
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C5
MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C6
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C7
MWPNFVAVISLLCLAFFAWANAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C8
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C9
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C10
MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C11
MWPNFVAVFSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
>C12
MWPNFVAVISMLCLAFFTWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 12 taxa and 231 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Taxon 12 -> C12
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1477942649
Setting output file names to "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1803250908
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9049187946
Seed = 2063494805
Swapseed = 1477942649
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 12 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 44 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1148.231274 -- -24.979900
Chain 2 -- -1167.456085 -- -24.979900
Chain 3 -- -1167.599081 -- -24.979900
Chain 4 -- -1162.179949 -- -24.979900
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1216.098106 -- -24.979900
Chain 2 -- -1194.949398 -- -24.979900
Chain 3 -- -1190.733389 -- -24.979900
Chain 4 -- -1198.248919 -- -24.979900
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1148.231] (-1167.456) (-1167.599) (-1162.180) * [-1216.098] (-1194.949) (-1190.733) (-1198.249)
500 -- (-846.244) (-806.692) (-819.212) [-813.864] * (-838.552) (-820.105) [-810.193] (-818.133) -- 0:00:00
1000 -- (-823.691) (-798.442) [-802.422] (-801.814) * [-813.274] (-803.482) (-800.431) (-804.460) -- 0:00:00
1500 -- (-805.703) (-788.431) [-786.822] (-782.963) * (-815.687) [-787.038] (-787.005) (-795.452) -- 0:00:00
2000 -- (-801.201) (-779.029) (-772.338) [-771.329] * (-803.054) (-775.266) (-766.109) [-779.819] -- 0:00:00
2500 -- (-792.404) (-772.921) [-754.250] (-763.531) * (-789.192) [-766.363] (-767.641) (-775.099) -- 0:00:00
3000 -- (-780.715) (-767.542) [-756.631] (-765.650) * (-778.124) (-772.650) [-761.372] (-774.114) -- 0:00:00
3500 -- (-770.051) (-778.438) (-765.723) [-764.396] * (-780.319) (-768.719) (-766.407) [-766.927] -- 0:00:00
4000 -- (-776.722) (-768.271) (-755.882) [-761.840] * (-772.987) (-768.076) (-759.866) [-766.195] -- 0:04:09
4500 -- (-774.668) [-758.723] (-765.493) (-767.279) * (-767.913) [-768.932] (-761.597) (-761.018) -- 0:03:41
5000 -- [-765.088] (-760.403) (-763.473) (-763.586) * (-765.467) (-760.931) [-763.172] (-761.413) -- 0:03:19
Average standard deviation of split frequencies: 0.075151
5500 -- (-766.506) [-757.641] (-759.386) (-767.516) * [-767.037] (-763.144) (-780.117) (-768.731) -- 0:03:00
6000 -- [-762.417] (-764.291) (-757.763) (-761.287) * (-761.603) [-770.734] (-768.228) (-768.538) -- 0:02:45
6500 -- (-764.915) [-755.628] (-759.483) (-766.546) * (-763.547) (-774.985) (-761.771) [-757.803] -- 0:02:32
7000 -- (-763.502) (-765.323) [-764.698] (-768.585) * (-766.269) (-778.880) (-763.210) [-755.037] -- 0:02:21
7500 -- [-754.172] (-781.129) (-768.124) (-772.887) * [-759.688] (-772.954) (-763.758) (-756.123) -- 0:04:24
8000 -- (-761.802) [-766.953] (-767.817) (-770.647) * (-764.448) [-762.527] (-765.079) (-762.686) -- 0:04:08
8500 -- [-754.929] (-771.218) (-764.966) (-764.212) * (-765.738) [-766.959] (-763.940) (-769.218) -- 0:03:53
9000 -- [-760.684] (-767.314) (-763.125) (-763.532) * [-763.367] (-766.062) (-767.377) (-758.809) -- 0:03:40
9500 -- (-774.826) (-760.342) (-771.577) [-761.060] * [-765.723] (-769.142) (-765.618) (-759.042) -- 0:03:28
10000 -- [-769.851] (-770.524) (-765.606) (-764.695) * (-761.510) (-764.151) (-773.105) [-764.979] -- 0:03:18
Average standard deviation of split frequencies: 0.048037
10500 -- [-752.957] (-765.468) (-769.361) (-757.327) * (-757.445) [-761.646] (-762.216) (-766.020) -- 0:03:08
11000 -- [-766.494] (-765.431) (-779.282) (-773.226) * (-761.054) (-768.118) [-757.111] (-767.623) -- 0:02:59
11500 -- (-763.002) [-767.797] (-757.300) (-759.148) * [-761.827] (-760.865) (-761.472) (-763.184) -- 0:04:17
12000 -- (-765.524) [-762.885] (-756.855) (-763.961) * [-761.214] (-768.415) (-761.319) (-762.170) -- 0:04:07
12500 -- (-757.285) (-756.282) (-758.311) [-761.118] * (-765.083) (-766.136) (-764.003) [-765.344] -- 0:03:57
13000 -- (-776.638) (-762.895) [-759.680] (-771.275) * (-766.347) (-761.740) (-780.112) [-761.410] -- 0:03:47
13500 -- (-757.175) [-759.655] (-760.778) (-763.217) * (-765.823) [-764.824] (-770.523) (-761.269) -- 0:03:39
14000 -- [-758.823] (-760.742) (-765.191) (-767.646) * (-772.757) (-761.526) [-758.941] (-761.631) -- 0:03:31
14500 -- [-752.159] (-763.922) (-765.305) (-765.591) * (-771.295) [-763.352] (-757.891) (-757.142) -- 0:03:23
15000 -- (-768.707) (-755.227) (-762.608) [-755.540] * (-762.175) (-767.013) (-762.463) [-757.972] -- 0:04:22
Average standard deviation of split frequencies: 0.040177
15500 -- (-764.705) [-762.017] (-769.490) (-765.362) * (-766.707) (-762.725) (-766.325) [-756.440] -- 0:04:14
16000 -- (-765.960) (-769.469) [-762.268] (-763.835) * (-760.849) (-767.285) [-757.419] (-765.958) -- 0:04:06
16500 -- (-761.561) [-763.710] (-769.714) (-759.357) * [-755.400] (-756.618) (-761.852) (-760.677) -- 0:03:58
17000 -- (-757.834) (-769.080) (-767.015) [-755.892] * (-757.170) (-766.083) [-758.101] (-760.191) -- 0:03:51
17500 -- (-765.421) (-764.083) (-759.308) [-759.473] * (-767.052) (-760.724) (-759.882) [-756.749] -- 0:03:44
18000 -- [-760.571] (-767.722) (-757.049) (-756.521) * (-763.494) [-755.771] (-772.239) (-756.843) -- 0:03:38
18500 -- [-756.452] (-755.695) (-768.898) (-756.655) * (-771.959) (-766.950) (-761.063) [-752.464] -- 0:03:32
19000 -- (-766.421) (-771.246) (-767.991) [-756.367] * (-767.225) (-757.196) (-763.182) [-758.336] -- 0:04:18
19500 -- (-771.771) (-762.078) (-765.607) [-761.232] * (-769.535) [-765.817] (-761.131) (-764.802) -- 0:04:11
20000 -- (-767.244) (-759.232) (-767.526) [-756.782] * (-776.569) [-755.430] (-760.283) (-763.724) -- 0:04:05
Average standard deviation of split frequencies: 0.031934
20500 -- (-767.386) (-759.416) (-769.575) [-758.900] * (-769.711) [-761.004] (-760.053) (-763.823) -- 0:03:58
21000 -- (-768.449) (-765.715) [-761.492] (-756.631) * (-760.179) [-756.130] (-768.290) (-759.949) -- 0:03:53
21500 -- (-766.262) (-762.144) [-758.907] (-765.390) * (-764.531) (-757.547) (-755.655) [-751.791] -- 0:03:47
22000 -- (-762.112) (-778.303) [-753.316] (-761.236) * (-766.323) (-757.331) [-757.413] (-765.675) -- 0:03:42
22500 -- (-777.666) (-760.240) [-755.681] (-762.041) * (-762.786) (-762.089) [-760.122] (-772.939) -- 0:04:20
23000 -- (-785.913) (-758.842) [-756.915] (-762.968) * [-757.827] (-778.120) (-756.930) (-768.440) -- 0:04:14
23500 -- [-765.022] (-759.680) (-763.372) (-764.485) * (-761.473) (-762.450) [-757.484] (-764.640) -- 0:04:09
24000 -- (-767.161) [-760.757] (-764.972) (-761.167) * (-763.660) (-762.219) (-768.647) [-761.281] -- 0:04:04
24500 -- (-766.171) [-756.377] (-772.411) (-764.871) * (-769.638) [-767.936] (-776.612) (-768.714) -- 0:03:58
25000 -- [-760.953] (-762.262) (-765.564) (-763.532) * [-764.101] (-768.004) (-761.099) (-756.082) -- 0:03:54
Average standard deviation of split frequencies: 0.046234
25500 -- (-757.236) [-759.169] (-762.552) (-761.429) * (-763.614) (-775.813) [-755.784] (-761.596) -- 0:03:49
26000 -- (-764.040) (-771.371) (-764.592) [-758.839] * (-767.542) [-763.970] (-757.536) (-764.241) -- 0:03:44
26500 -- (-776.777) (-765.956) [-758.210] (-766.917) * (-762.370) (-768.338) [-752.409] (-758.594) -- 0:04:17
27000 -- (-758.123) [-761.320] (-760.176) (-772.538) * [-762.395] (-776.002) (-762.852) (-757.813) -- 0:04:12
27500 -- (-764.801) (-770.319) [-764.008] (-766.063) * (-768.986) (-762.496) (-771.862) [-758.002] -- 0:04:07
28000 -- [-759.306] (-771.819) (-757.217) (-771.843) * (-769.174) (-767.618) (-777.235) [-758.917] -- 0:04:03
28500 -- (-758.814) [-758.725] (-759.920) (-766.467) * [-762.096] (-771.550) (-765.300) (-765.112) -- 0:03:58
29000 -- (-765.279) [-756.673] (-769.102) (-765.635) * (-763.996) (-762.798) (-767.216) [-762.034] -- 0:03:54
29500 -- (-762.604) (-760.478) [-755.709] (-771.274) * (-776.420) (-754.023) [-759.714] (-763.677) -- 0:03:50
30000 -- (-754.428) [-757.884] (-758.925) (-771.397) * (-773.232) (-767.689) (-768.232) [-764.654] -- 0:04:18
Average standard deviation of split frequencies: 0.041595
30500 -- (-771.249) (-759.866) (-763.822) [-761.967] * (-781.877) [-760.259] (-764.291) (-769.984) -- 0:04:14
31000 -- (-759.967) (-762.865) (-764.715) [-757.092] * (-771.389) (-758.449) [-759.912] (-766.009) -- 0:04:10
31500 -- (-765.855) (-768.024) [-770.857] (-764.508) * (-772.712) [-759.791] (-765.510) (-764.695) -- 0:04:05
32000 -- (-765.090) (-759.155) [-761.075] (-765.474) * [-763.511] (-760.423) (-762.097) (-769.200) -- 0:04:02
32500 -- (-756.621) (-763.899) (-774.779) [-760.453] * (-769.473) (-768.526) (-770.370) [-758.172] -- 0:03:58
33000 -- (-763.113) (-755.922) (-757.406) [-760.944] * [-761.313] (-769.334) (-766.728) (-760.489) -- 0:03:54
33500 -- (-764.077) (-762.494) [-764.195] (-763.999) * [-759.543] (-766.109) (-777.887) (-770.655) -- 0:03:50
34000 -- [-757.805] (-761.266) (-757.527) (-769.857) * (-767.099) (-769.492) [-761.597] (-760.661) -- 0:04:15
34500 -- [-757.294] (-758.303) (-763.879) (-766.953) * (-762.931) (-763.552) [-755.625] (-761.390) -- 0:04:11
35000 -- (-759.296) [-764.998] (-763.812) (-764.317) * (-766.413) (-758.791) (-765.066) [-764.426] -- 0:04:08
Average standard deviation of split frequencies: 0.037101
35500 -- (-761.143) (-765.716) (-764.153) [-759.372] * (-771.778) (-771.871) [-772.553] (-772.718) -- 0:04:04
36000 -- (-763.077) (-766.138) (-767.857) [-759.578] * (-783.034) (-760.058) (-768.128) [-766.759] -- 0:04:01
36500 -- (-770.083) (-761.541) [-761.264] (-765.177) * [-759.318] (-763.259) (-758.715) (-761.541) -- 0:03:57
37000 -- (-765.079) [-759.303] (-771.481) (-770.091) * [-763.047] (-760.627) (-770.733) (-761.812) -- 0:03:54
37500 -- (-760.816) (-764.720) [-752.353] (-768.507) * (-761.380) (-761.552) (-763.067) [-757.682] -- 0:04:16
38000 -- (-768.960) (-761.150) (-760.437) [-762.240] * (-767.761) [-761.723] (-757.991) (-763.071) -- 0:04:13
38500 -- [-761.718] (-764.465) (-768.210) (-763.805) * (-768.848) (-754.429) [-760.982] (-768.613) -- 0:04:09
39000 -- (-761.934) (-772.059) (-761.757) [-764.627] * [-752.574] (-752.918) (-759.070) (-763.460) -- 0:04:06
39500 -- (-768.290) (-764.164) (-762.866) [-757.804] * (-763.936) [-757.570] (-764.247) (-760.020) -- 0:04:03
40000 -- [-757.844] (-763.093) (-767.938) (-761.409) * (-759.423) (-763.112) [-757.230] (-775.087) -- 0:04:00
Average standard deviation of split frequencies: 0.037503
40500 -- (-767.303) (-763.737) (-761.487) [-767.172] * (-758.650) (-762.464) [-759.182] (-766.559) -- 0:03:56
41000 -- (-769.635) [-766.037] (-765.667) (-762.569) * [-753.622] (-764.296) (-768.130) (-771.528) -- 0:03:53
41500 -- (-760.196) (-761.013) [-766.367] (-754.527) * (-763.369) (-760.079) [-766.438] (-764.127) -- 0:04:14
42000 -- (-763.855) (-768.000) [-763.595] (-768.682) * (-775.733) [-758.945] (-762.890) (-762.503) -- 0:04:10
42500 -- [-762.956] (-754.000) (-762.248) (-760.853) * (-764.154) (-768.753) [-758.966] (-765.830) -- 0:04:07
43000 -- (-764.633) [-758.326] (-757.930) (-762.898) * (-754.092) (-768.901) [-769.997] (-758.170) -- 0:04:04
43500 -- (-764.745) (-773.918) (-761.986) [-762.207] * (-767.090) [-759.365] (-762.890) (-767.557) -- 0:04:01
44000 -- [-755.383] (-768.292) (-759.430) (-774.519) * (-759.154) [-758.980] (-765.036) (-769.199) -- 0:03:59
44500 -- [-760.945] (-766.372) (-760.394) (-758.475) * (-762.405) (-757.469) (-763.683) [-763.258] -- 0:03:56
45000 -- [-758.446] (-767.381) (-755.757) (-766.005) * (-758.667) (-769.589) [-759.155] (-773.287) -- 0:04:14
Average standard deviation of split frequencies: 0.040452
45500 -- [-756.847] (-768.143) (-760.665) (-766.243) * (-759.369) (-765.926) [-758.446] (-770.787) -- 0:04:11
46000 -- (-768.023) (-771.171) [-756.593] (-757.725) * [-763.080] (-761.517) (-757.815) (-761.349) -- 0:04:08
46500 -- (-763.781) (-766.359) (-762.209) [-757.546] * (-761.730) (-763.816) (-771.056) [-767.445] -- 0:04:06
47000 -- (-767.472) (-771.329) [-750.071] (-764.739) * (-763.821) [-757.805] (-765.498) (-767.915) -- 0:04:03
47500 -- (-757.864) (-765.069) (-768.164) [-763.226] * (-763.688) [-763.899] (-765.680) (-759.990) -- 0:04:00
48000 -- (-768.790) (-775.969) (-755.597) [-759.664] * (-763.195) (-758.429) (-752.953) [-755.291] -- 0:03:58
48500 -- (-765.502) [-754.458] (-764.453) (-762.291) * (-757.449) [-763.540] (-758.741) (-769.956) -- 0:03:55
49000 -- (-771.731) [-760.473] (-766.404) (-766.313) * [-761.708] (-773.921) (-761.524) (-763.954) -- 0:04:12
49500 -- (-760.240) (-764.786) (-772.816) [-759.824] * [-755.659] (-774.007) (-760.462) (-764.774) -- 0:04:09
50000 -- [-765.196] (-762.491) (-759.080) (-764.272) * (-774.491) (-762.293) (-770.526) [-765.177] -- 0:04:06
Average standard deviation of split frequencies: 0.035027
50500 -- (-754.177) [-751.665] (-769.980) (-766.651) * [-771.936] (-762.791) (-754.927) (-767.139) -- 0:04:04
51000 -- [-765.160] (-759.183) (-758.982) (-765.898) * (-755.471) (-760.474) (-756.935) [-765.494] -- 0:04:01
51500 -- [-759.304] (-763.356) (-765.845) (-765.744) * (-773.856) (-760.346) (-775.366) [-760.995] -- 0:03:59
52000 -- (-765.603) [-756.663] (-760.035) (-765.081) * (-763.011) (-763.923) (-764.364) [-758.469] -- 0:03:57
52500 -- (-765.744) [-753.508] (-780.697) (-763.887) * (-759.398) (-769.218) (-763.704) [-763.168] -- 0:04:12
53000 -- (-760.098) [-760.564] (-769.902) (-761.469) * [-761.225] (-764.908) (-765.454) (-754.525) -- 0:04:10
53500 -- (-776.851) (-758.736) (-768.110) [-756.953] * [-758.647] (-761.005) (-764.289) (-761.723) -- 0:04:07
54000 -- (-758.105) (-763.725) (-765.015) [-758.902] * (-765.982) (-768.608) [-755.189] (-767.073) -- 0:04:05
54500 -- [-769.485] (-761.912) (-768.971) (-759.747) * (-767.529) [-761.993] (-764.849) (-759.549) -- 0:04:02
55000 -- (-769.020) (-771.900) (-764.127) [-765.135] * (-762.356) [-760.007] (-760.708) (-762.063) -- 0:04:00
Average standard deviation of split frequencies: 0.031196
55500 -- (-759.270) (-768.332) (-767.034) [-762.814] * (-759.976) [-754.852] (-765.897) (-760.167) -- 0:03:58
56000 -- (-763.948) (-758.521) (-775.338) [-761.127] * (-764.502) [-755.784] (-759.527) (-761.220) -- 0:03:56
56500 -- (-756.447) [-759.602] (-766.556) (-772.055) * (-760.681) (-766.676) (-774.444) [-765.271] -- 0:04:10
57000 -- [-757.086] (-765.250) (-761.260) (-765.130) * (-771.925) [-766.600] (-765.810) (-769.121) -- 0:04:08
57500 -- (-771.143) (-767.463) [-762.135] (-766.336) * (-769.015) (-763.569) [-760.414] (-770.757) -- 0:04:05
58000 -- (-776.638) (-769.311) (-768.691) [-761.930] * (-760.283) (-770.091) [-766.111] (-768.939) -- 0:04:03
58500 -- [-762.421] (-785.787) (-769.791) (-760.383) * (-767.358) [-765.103] (-773.931) (-752.869) -- 0:04:01
59000 -- (-758.471) [-759.129] (-760.917) (-765.517) * (-774.231) (-775.339) [-756.024] (-763.671) -- 0:03:59
59500 -- (-771.878) (-757.195) (-760.878) [-763.162] * (-767.910) (-775.792) (-762.161) [-768.770] -- 0:03:57
60000 -- (-760.495) [-760.572] (-775.769) (-767.860) * (-763.027) (-762.835) [-758.616] (-772.861) -- 0:03:55
Average standard deviation of split frequencies: 0.036567
60500 -- (-762.594) [-757.232] (-764.561) (-767.396) * [-760.761] (-762.023) (-763.373) (-764.987) -- 0:04:08
61000 -- (-766.685) [-755.418] (-763.605) (-759.699) * (-767.233) (-762.019) (-763.792) [-766.962] -- 0:04:06
61500 -- (-760.861) [-757.253] (-766.780) (-767.230) * (-764.042) [-761.515] (-764.881) (-756.399) -- 0:04:04
62000 -- (-761.638) (-762.644) (-764.784) [-759.384] * [-759.961] (-755.246) (-773.745) (-763.000) -- 0:04:02
62500 -- (-759.029) [-762.097] (-765.507) (-772.277) * (-754.575) (-765.704) (-766.337) [-756.573] -- 0:04:00
63000 -- [-762.664] (-755.553) (-770.780) (-756.985) * [-767.426] (-758.872) (-764.337) (-759.805) -- 0:03:57
63500 -- [-754.814] (-768.895) (-764.213) (-766.579) * (-762.475) [-758.852] (-770.592) (-758.033) -- 0:03:55
64000 -- [-765.263] (-761.226) (-766.039) (-757.562) * (-770.120) (-760.254) (-763.708) [-769.659] -- 0:04:08
64500 -- (-765.284) (-762.703) [-758.196] (-764.182) * (-767.622) (-760.594) (-778.872) [-762.934] -- 0:04:06
65000 -- (-770.155) [-765.009] (-766.454) (-770.724) * [-756.010] (-758.059) (-752.653) (-767.926) -- 0:04:04
Average standard deviation of split frequencies: 0.034032
65500 -- [-764.103] (-764.612) (-767.659) (-764.162) * (-756.649) (-758.530) [-755.281] (-770.748) -- 0:04:02
66000 -- [-759.539] (-771.214) (-768.395) (-761.609) * [-758.550] (-767.458) (-756.166) (-763.862) -- 0:04:00
66500 -- [-760.213] (-766.830) (-777.334) (-762.263) * (-762.985) [-756.121] (-759.066) (-765.004) -- 0:03:58
67000 -- (-766.453) [-762.814] (-762.704) (-758.415) * (-765.799) [-754.907] (-760.633) (-767.650) -- 0:03:56
67500 -- (-762.509) (-776.840) [-760.195] (-764.349) * (-765.588) [-756.018] (-756.634) (-762.311) -- 0:04:08
68000 -- [-761.367] (-758.984) (-770.761) (-769.962) * (-768.256) [-757.312] (-766.783) (-767.205) -- 0:04:06
68500 -- (-764.288) (-761.815) [-769.319] (-767.882) * (-766.616) [-752.226] (-768.275) (-772.590) -- 0:04:04
69000 -- [-756.891] (-765.440) (-758.255) (-766.260) * [-758.419] (-772.017) (-761.236) (-765.388) -- 0:04:02
69500 -- (-755.908) (-758.491) (-764.886) [-765.941] * [-756.549] (-773.327) (-758.643) (-762.060) -- 0:04:00
70000 -- (-766.605) [-764.200] (-756.752) (-762.642) * (-763.140) (-762.506) [-759.653] (-766.731) -- 0:03:59
Average standard deviation of split frequencies: 0.029038
70500 -- (-766.612) [-754.018] (-768.343) (-768.582) * (-760.839) [-758.258] (-768.353) (-772.044) -- 0:03:57
71000 -- (-758.179) [-765.799] (-762.653) (-760.062) * (-762.743) (-758.891) [-758.858] (-767.461) -- 0:03:55
71500 -- (-773.068) (-764.184) (-763.785) [-760.684] * (-757.514) (-773.577) [-759.381] (-765.896) -- 0:04:06
72000 -- (-776.451) (-758.719) [-763.047] (-761.783) * [-762.332] (-775.916) (-755.679) (-769.236) -- 0:04:04
72500 -- (-770.581) [-762.149] (-762.538) (-763.056) * (-764.666) (-770.754) (-757.347) [-763.536] -- 0:04:03
73000 -- (-770.360) (-767.608) (-765.946) [-755.474] * (-761.101) (-773.530) (-756.128) [-760.983] -- 0:04:01
73500 -- (-761.566) (-764.959) (-766.348) [-762.893] * (-763.954) (-766.073) [-757.798] (-769.859) -- 0:03:59
74000 -- (-763.749) (-768.388) [-761.752] (-765.644) * (-765.041) [-759.879] (-762.405) (-763.536) -- 0:03:57
74500 -- (-763.578) [-760.833] (-761.907) (-769.632) * (-756.685) [-759.373] (-766.645) (-757.884) -- 0:03:56
75000 -- (-771.740) (-759.523) [-758.564] (-768.407) * (-754.011) (-758.436) (-756.757) [-767.074] -- 0:03:54
Average standard deviation of split frequencies: 0.028459
75500 -- (-768.337) (-755.094) (-761.024) [-762.172] * [-755.630] (-756.394) (-761.346) (-764.315) -- 0:04:04
76000 -- (-769.689) (-767.959) [-757.572] (-770.744) * [-761.614] (-757.246) (-761.472) (-760.945) -- 0:04:03
76500 -- (-773.084) (-766.477) (-769.557) [-762.221] * (-771.721) (-760.941) (-760.007) [-762.562] -- 0:04:01
77000 -- (-760.765) (-756.896) [-761.746] (-769.682) * [-757.087] (-766.986) (-763.630) (-761.214) -- 0:03:59
77500 -- (-763.336) (-758.074) [-761.098] (-757.630) * (-755.358) [-771.457] (-765.621) (-756.376) -- 0:03:58
78000 -- (-759.735) [-763.330] (-768.978) (-763.692) * (-761.882) [-767.478] (-764.833) (-772.736) -- 0:03:56
78500 -- (-759.483) (-758.529) [-755.982] (-773.597) * [-765.422] (-764.122) (-768.569) (-773.013) -- 0:03:54
79000 -- (-760.625) (-759.034) (-757.100) [-758.148] * (-764.080) (-768.936) [-759.133] (-760.648) -- 0:04:04
79500 -- (-770.092) [-759.766] (-757.267) (-761.266) * (-775.143) (-763.322) (-775.641) [-759.488] -- 0:04:03
80000 -- [-755.525] (-754.171) (-762.873) (-765.936) * (-772.579) [-762.448] (-771.688) (-756.087) -- 0:04:01
Average standard deviation of split frequencies: 0.030251
80500 -- (-759.672) [-769.170] (-760.587) (-769.357) * (-770.371) (-757.201) [-762.625] (-763.228) -- 0:03:59
81000 -- (-760.494) [-759.881] (-757.415) (-767.405) * (-761.306) [-760.546] (-762.516) (-763.997) -- 0:03:58
81500 -- [-755.217] (-769.961) (-755.862) (-770.073) * (-765.283) (-764.804) [-768.759] (-759.956) -- 0:03:56
82000 -- (-767.504) [-762.662] (-766.450) (-760.148) * (-758.716) (-766.578) [-761.582] (-760.244) -- 0:03:55
82500 -- (-780.069) [-763.113] (-761.085) (-758.293) * [-762.542] (-765.009) (-760.212) (-761.316) -- 0:03:53
83000 -- (-767.998) [-756.335] (-763.396) (-758.726) * (-764.033) (-759.554) (-760.974) [-757.470] -- 0:04:03
83500 -- [-760.134] (-772.106) (-769.228) (-764.817) * (-766.372) (-766.353) [-756.429] (-769.926) -- 0:04:01
84000 -- (-765.378) [-765.422] (-762.203) (-766.672) * (-765.943) (-767.103) [-760.451] (-766.052) -- 0:03:59
84500 -- (-761.447) (-765.003) [-762.600] (-770.174) * (-765.662) [-761.001] (-771.436) (-760.315) -- 0:03:58
85000 -- (-759.268) (-762.883) [-756.703] (-760.308) * (-764.899) (-765.304) (-771.254) [-767.382] -- 0:03:56
Average standard deviation of split frequencies: 0.031671
85500 -- [-764.746] (-773.931) (-769.668) (-759.963) * (-770.045) [-761.864] (-774.636) (-763.045) -- 0:03:55
86000 -- (-760.743) (-759.519) (-756.420) [-760.449] * [-754.356] (-761.361) (-760.702) (-770.630) -- 0:04:04
86500 -- (-760.507) (-759.020) (-761.190) [-761.922] * (-764.678) (-764.412) [-763.552] (-768.647) -- 0:04:02
87000 -- (-753.941) (-778.976) [-759.764] (-762.689) * (-769.943) (-764.344) (-773.771) [-764.779] -- 0:04:01
87500 -- (-765.516) (-763.803) [-757.644] (-770.850) * (-759.372) [-767.765] (-767.126) (-769.193) -- 0:03:59
88000 -- (-767.258) [-762.206] (-760.585) (-763.093) * (-762.652) (-766.080) [-771.812] (-767.392) -- 0:03:58
88500 -- (-765.910) (-761.739) [-774.703] (-770.429) * (-760.834) [-761.531] (-768.782) (-761.405) -- 0:03:56
89000 -- (-767.779) [-766.011] (-777.013) (-755.514) * (-771.773) (-771.102) [-766.395] (-762.918) -- 0:03:55
89500 -- (-762.672) (-765.023) (-777.129) [-755.788] * (-762.668) (-760.896) [-768.405] (-762.932) -- 0:04:04
90000 -- (-769.214) (-766.951) (-771.901) [-765.462] * (-760.668) (-763.243) [-760.980] (-768.301) -- 0:04:02
Average standard deviation of split frequencies: 0.029174
90500 -- (-764.988) (-764.680) (-781.243) [-765.076] * (-765.873) (-762.441) [-764.245] (-770.106) -- 0:04:01
91000 -- [-767.503] (-765.238) (-771.388) (-761.925) * (-760.724) (-757.414) [-763.231] (-764.677) -- 0:03:59
91500 -- (-766.552) (-770.660) (-775.188) [-758.874] * (-763.636) (-760.235) [-760.614] (-761.532) -- 0:03:58
92000 -- [-759.904] (-761.824) (-785.726) (-763.058) * (-756.462) (-766.343) (-767.708) [-761.445] -- 0:03:56
92500 -- (-769.168) (-765.424) (-779.422) [-756.959] * (-762.083) (-773.142) [-760.461] (-760.135) -- 0:03:55
93000 -- [-763.747] (-768.812) (-764.776) (-757.806) * (-762.685) (-761.766) (-769.013) [-761.814] -- 0:04:03
93500 -- (-766.421) (-755.035) (-769.913) [-756.196] * [-754.197] (-760.875) (-761.565) (-762.979) -- 0:04:02
94000 -- [-759.900] (-766.480) (-768.236) (-759.107) * (-767.926) (-758.620) (-770.004) [-762.660] -- 0:04:00
94500 -- (-758.489) (-769.329) (-768.366) [-753.051] * (-765.280) [-760.118] (-769.949) (-763.822) -- 0:03:59
95000 -- [-755.055] (-773.604) (-763.769) (-764.599) * (-769.072) (-759.369) [-765.732] (-762.310) -- 0:03:58
Average standard deviation of split frequencies: 0.029752
95500 -- (-764.531) (-772.345) [-760.720] (-763.976) * (-758.657) [-761.950] (-768.208) (-761.904) -- 0:03:56
96000 -- (-763.244) (-762.509) (-774.789) [-768.583] * (-760.674) (-764.855) [-759.157] (-761.282) -- 0:03:55
96500 -- (-760.948) (-769.318) [-757.212] (-771.685) * (-759.546) [-764.956] (-761.400) (-763.180) -- 0:03:54
97000 -- (-761.819) (-767.962) [-758.061] (-764.608) * (-759.156) (-772.259) [-759.555] (-765.904) -- 0:04:02
97500 -- (-763.820) (-771.641) (-770.011) [-762.904] * (-765.332) (-766.051) (-758.734) [-763.976] -- 0:04:00
98000 -- (-767.041) (-771.168) (-760.220) [-770.030] * [-760.135] (-763.758) (-757.707) (-761.846) -- 0:03:59
98500 -- [-764.258] (-774.449) (-760.270) (-767.609) * (-765.335) [-759.336] (-761.056) (-776.472) -- 0:03:57
99000 -- [-761.074] (-774.819) (-761.441) (-769.023) * (-769.344) [-757.738] (-765.744) (-769.383) -- 0:03:56
99500 -- (-766.276) (-765.629) (-762.021) [-752.738] * (-760.591) [-752.504] (-763.415) (-763.069) -- 0:03:55
100000 -- (-760.488) (-761.129) [-755.872] (-766.018) * (-765.001) [-758.780] (-758.794) (-764.159) -- 0:03:53
Average standard deviation of split frequencies: 0.025893
100500 -- (-764.145) (-775.228) [-767.619] (-767.971) * [-762.551] (-759.219) (-761.946) (-767.738) -- 0:04:01
101000 -- [-762.526] (-764.070) (-763.132) (-756.420) * (-763.176) (-766.243) (-759.866) [-764.064] -- 0:04:00
101500 -- (-766.432) [-757.378] (-758.434) (-763.329) * [-754.963] (-767.517) (-759.012) (-769.523) -- 0:03:59
102000 -- [-767.027] (-759.540) (-757.763) (-768.264) * [-763.185] (-769.880) (-760.839) (-763.787) -- 0:03:57
102500 -- (-771.507) [-758.109] (-755.086) (-756.762) * [-755.567] (-760.708) (-766.074) (-765.137) -- 0:03:56
103000 -- (-757.903) [-758.820] (-767.381) (-784.010) * (-756.876) (-766.508) (-766.938) [-758.078] -- 0:03:55
103500 -- (-761.986) [-767.780] (-770.174) (-766.936) * [-756.664] (-761.478) (-761.554) (-761.786) -- 0:03:53
104000 -- [-753.717] (-761.758) (-764.525) (-763.056) * (-762.041) (-766.675) (-762.325) [-758.513] -- 0:03:52
104500 -- [-753.808] (-768.309) (-763.441) (-762.851) * [-757.644] (-766.035) (-755.935) (-765.684) -- 0:03:59
105000 -- (-761.757) (-774.097) (-764.047) [-751.314] * [-762.600] (-768.790) (-759.395) (-760.084) -- 0:03:58
Average standard deviation of split frequencies: 0.027730
105500 -- (-761.383) (-769.641) (-765.630) [-762.504] * (-760.398) [-761.221] (-769.892) (-772.117) -- 0:03:57
106000 -- (-766.472) [-762.633] (-765.356) (-763.138) * [-759.018] (-765.313) (-769.418) (-769.179) -- 0:03:56
106500 -- (-767.495) (-759.230) (-768.772) [-768.733] * (-769.067) [-760.970] (-766.198) (-764.987) -- 0:03:54
107000 -- (-763.423) (-760.680) [-772.150] (-763.182) * (-765.866) (-763.862) (-777.415) [-762.428] -- 0:03:53
107500 -- [-764.975] (-768.403) (-773.163) (-760.608) * (-764.288) (-774.172) (-766.465) [-763.414] -- 0:03:52
108000 -- (-764.156) (-767.147) (-765.338) [-766.413] * (-762.883) (-763.395) (-780.746) [-764.993] -- 0:03:59
108500 -- [-759.175] (-772.873) (-759.899) (-762.398) * [-760.817] (-764.046) (-769.034) (-763.385) -- 0:03:58
109000 -- (-764.508) (-765.333) [-761.442] (-768.138) * [-760.601] (-764.714) (-769.918) (-767.535) -- 0:03:57
109500 -- [-767.611] (-762.673) (-771.648) (-755.864) * [-761.246] (-775.379) (-769.874) (-771.663) -- 0:03:55
110000 -- (-756.450) [-758.010] (-777.934) (-764.417) * (-766.856) (-770.987) (-761.588) [-759.071] -- 0:03:54
Average standard deviation of split frequencies: 0.032073
110500 -- (-762.786) (-778.148) [-761.555] (-765.930) * [-766.226] (-768.951) (-759.018) (-766.859) -- 0:03:53
111000 -- [-763.340] (-771.130) (-762.827) (-768.317) * (-759.141) (-769.414) (-760.237) [-760.124] -- 0:03:52
111500 -- (-761.728) [-757.291] (-760.609) (-774.874) * (-760.560) [-767.973] (-759.675) (-759.737) -- 0:03:51
112000 -- (-770.115) (-760.132) [-764.631] (-773.028) * (-764.325) (-765.442) (-757.814) [-761.892] -- 0:03:57
112500 -- (-761.920) (-756.984) (-768.936) [-763.202] * (-765.319) (-775.234) (-756.694) [-755.792] -- 0:03:56
113000 -- (-762.974) (-769.698) [-757.772] (-765.082) * (-770.225) [-760.105] (-761.816) (-757.603) -- 0:03:55
113500 -- (-761.955) (-773.914) (-762.931) [-756.795] * [-769.226] (-768.748) (-762.311) (-760.236) -- 0:03:54
114000 -- (-755.410) (-758.356) (-770.895) [-765.172] * (-770.288) [-760.577] (-759.267) (-772.631) -- 0:03:53
114500 -- [-758.242] (-757.889) (-768.365) (-762.653) * (-760.182) (-760.284) [-757.902] (-770.721) -- 0:03:52
115000 -- [-755.041] (-760.348) (-771.176) (-768.044) * (-768.058) [-754.882] (-758.972) (-769.647) -- 0:03:50
Average standard deviation of split frequencies: 0.026295
115500 -- [-753.379] (-766.522) (-767.266) (-765.743) * [-749.687] (-759.700) (-762.034) (-763.622) -- 0:03:57
116000 -- [-766.683] (-764.264) (-769.182) (-759.034) * (-757.271) [-755.426] (-755.433) (-769.905) -- 0:03:56
116500 -- [-758.237] (-756.678) (-756.850) (-757.660) * (-762.020) [-757.484] (-756.980) (-756.008) -- 0:03:55
117000 -- (-757.312) (-754.941) [-760.913] (-765.603) * (-769.431) [-754.438] (-760.804) (-760.251) -- 0:03:53
117500 -- (-767.339) (-751.361) (-772.002) [-762.484] * [-768.770] (-775.333) (-764.964) (-766.540) -- 0:03:52
118000 -- (-765.430) (-760.938) (-762.519) [-758.237] * (-763.669) (-765.392) (-755.437) [-758.332] -- 0:03:51
118500 -- (-765.538) (-767.180) (-758.334) [-756.244] * (-777.143) (-768.061) (-766.678) [-764.767] -- 0:03:50
119000 -- [-759.402] (-761.605) (-769.471) (-760.060) * [-759.300] (-766.964) (-758.039) (-770.675) -- 0:03:49
119500 -- (-757.801) (-758.444) (-760.203) [-758.107] * (-766.700) (-770.668) [-766.481] (-764.575) -- 0:03:55
120000 -- (-753.883) [-760.031] (-761.693) (-775.254) * (-766.304) (-768.324) [-758.619] (-769.712) -- 0:03:54
Average standard deviation of split frequencies: 0.025968
120500 -- (-754.954) (-764.278) (-767.419) [-753.194] * [-755.005] (-767.096) (-757.491) (-762.378) -- 0:03:53
121000 -- (-773.207) (-770.867) (-761.381) [-762.527] * (-762.675) [-762.666] (-759.370) (-768.114) -- 0:03:52
121500 -- [-762.026] (-770.284) (-768.242) (-768.055) * (-766.411) (-773.397) (-758.726) [-764.309] -- 0:03:51
122000 -- (-767.842) (-776.219) (-756.299) [-760.809] * (-763.974) (-764.666) [-761.467] (-767.173) -- 0:03:50
122500 -- (-767.791) (-772.848) [-759.009] (-770.340) * (-770.353) [-760.941] (-769.621) (-759.444) -- 0:03:49
123000 -- (-767.864) [-759.752] (-754.819) (-772.782) * (-766.427) (-763.375) [-766.865] (-767.543) -- 0:03:55
123500 -- (-770.405) [-763.904] (-776.814) (-771.032) * (-766.405) (-760.947) (-767.176) [-759.936] -- 0:03:54
124000 -- (-770.227) [-763.286] (-774.559) (-756.910) * (-760.015) (-760.117) (-765.181) [-762.561] -- 0:03:53
124500 -- (-767.612) (-759.751) (-771.854) [-764.924] * (-766.388) [-756.906] (-760.279) (-768.568) -- 0:03:52
125000 -- (-762.522) (-767.622) (-763.389) [-764.141] * (-768.117) [-758.658] (-766.150) (-765.601) -- 0:03:51
Average standard deviation of split frequencies: 0.026189
125500 -- [-753.258] (-761.590) (-759.285) (-768.114) * (-767.134) (-758.192) (-770.061) [-759.575] -- 0:03:49
126000 -- [-762.943] (-760.655) (-758.341) (-763.308) * (-767.137) (-760.957) (-758.446) [-757.659] -- 0:03:48
126500 -- (-767.506) [-757.249] (-765.951) (-763.669) * [-763.107] (-760.916) (-767.949) (-761.877) -- 0:03:47
127000 -- [-755.681] (-755.425) (-763.525) (-758.089) * (-756.538) [-760.174] (-760.048) (-764.348) -- 0:03:53
127500 -- (-758.538) [-759.992] (-757.851) (-757.918) * (-771.921) [-772.894] (-760.015) (-763.541) -- 0:03:52
128000 -- (-758.512) [-763.982] (-763.640) (-758.970) * [-761.919] (-759.573) (-765.506) (-760.261) -- 0:03:51
128500 -- [-756.353] (-771.087) (-764.103) (-766.395) * (-763.830) [-760.840] (-755.175) (-757.237) -- 0:03:50
129000 -- [-764.385] (-763.893) (-767.064) (-759.318) * [-768.542] (-758.854) (-762.936) (-764.940) -- 0:03:49
129500 -- (-764.169) [-760.884] (-764.259) (-763.202) * (-760.419) (-765.573) [-762.260] (-764.548) -- 0:03:48
130000 -- [-765.060] (-770.893) (-755.557) (-759.188) * (-772.192) [-762.138] (-766.811) (-766.654) -- 0:03:47
Average standard deviation of split frequencies: 0.025254
130500 -- [-762.814] (-770.664) (-757.920) (-762.443) * (-766.761) (-761.357) [-759.947] (-763.058) -- 0:03:53
131000 -- (-759.599) [-762.037] (-764.777) (-778.779) * [-763.740] (-764.346) (-766.970) (-761.237) -- 0:03:52
131500 -- (-768.722) (-774.099) [-762.271] (-753.632) * (-761.839) [-757.691] (-770.871) (-758.662) -- 0:03:51
132000 -- (-758.450) (-764.726) [-766.434] (-761.013) * (-762.368) [-756.582] (-765.101) (-753.225) -- 0:03:50
132500 -- (-767.053) [-766.044] (-773.680) (-759.312) * [-756.624] (-759.162) (-776.198) (-762.130) -- 0:03:49
133000 -- (-760.994) (-767.006) [-761.296] (-765.892) * (-759.496) (-762.239) (-773.028) [-761.603] -- 0:03:48
133500 -- (-766.819) (-775.833) (-775.458) [-753.212] * (-774.905) [-760.403] (-760.009) (-757.010) -- 0:03:47
134000 -- (-758.508) (-764.207) (-771.632) [-755.024] * [-764.333] (-766.744) (-764.711) (-768.281) -- 0:03:46
134500 -- (-769.046) (-764.115) (-763.932) [-769.111] * (-759.666) [-761.175] (-775.679) (-761.157) -- 0:03:51
135000 -- (-765.205) (-765.188) (-765.905) [-761.551] * (-758.150) (-762.852) (-778.175) [-763.273] -- 0:03:50
Average standard deviation of split frequencies: 0.026099
135500 -- (-755.638) (-766.458) (-766.456) [-757.157] * (-755.371) [-756.756] (-770.920) (-756.463) -- 0:03:49
136000 -- [-753.591] (-766.374) (-775.934) (-764.456) * (-760.531) [-759.589] (-777.349) (-774.245) -- 0:03:48
136500 -- [-766.642] (-767.561) (-771.752) (-766.153) * [-753.595] (-759.876) (-781.689) (-769.428) -- 0:03:47
137000 -- (-761.522) (-769.527) [-762.358] (-764.640) * (-756.673) (-760.879) (-765.924) [-754.963] -- 0:03:46
137500 -- (-763.930) (-766.913) [-765.292] (-773.130) * (-762.308) (-765.318) [-766.984] (-769.591) -- 0:03:45
138000 -- (-766.165) (-765.808) (-758.078) [-760.328] * [-760.552] (-765.782) (-763.159) (-756.601) -- 0:03:51
138500 -- (-761.175) (-769.714) [-752.552] (-765.905) * (-755.430) [-759.436] (-774.758) (-763.895) -- 0:03:50
139000 -- (-754.805) (-770.427) [-764.223] (-772.442) * (-767.087) (-767.408) [-757.824] (-762.471) -- 0:03:49
139500 -- (-761.660) (-761.820) [-758.519] (-760.329) * (-767.090) [-763.601] (-767.159) (-758.474) -- 0:03:48
140000 -- (-762.769) [-757.502] (-774.371) (-764.709) * (-761.672) (-768.792) (-768.220) [-764.457] -- 0:03:47
Average standard deviation of split frequencies: 0.022867
140500 -- (-764.750) (-763.500) (-763.732) [-759.276] * (-761.917) (-756.978) (-760.959) [-766.153] -- 0:03:46
141000 -- (-756.240) (-775.351) (-768.018) [-762.382] * (-765.347) [-758.081] (-764.945) (-764.341) -- 0:03:45
141500 -- [-763.510] (-765.381) (-765.976) (-770.620) * (-767.494) (-761.614) (-758.288) [-760.948] -- 0:03:44
142000 -- [-756.174] (-760.937) (-761.845) (-764.528) * (-755.983) (-759.234) (-768.149) [-759.871] -- 0:03:49
142500 -- (-760.986) [-758.719] (-761.345) (-761.393) * (-764.580) [-754.975] (-763.545) (-761.443) -- 0:03:48
143000 -- (-759.672) (-759.354) (-764.843) [-764.713] * [-757.372] (-760.751) (-768.657) (-766.115) -- 0:03:47
143500 -- (-761.704) (-768.064) (-756.024) [-759.792] * [-761.898] (-759.320) (-760.940) (-765.651) -- 0:03:46
144000 -- [-763.859] (-763.028) (-754.053) (-765.778) * (-757.641) [-757.133] (-764.148) (-759.714) -- 0:03:45
144500 -- (-764.575) (-770.595) [-756.019] (-764.938) * [-755.177] (-766.074) (-763.199) (-762.430) -- 0:03:44
145000 -- (-761.043) (-763.597) [-767.356] (-769.643) * [-757.516] (-769.450) (-757.305) (-766.828) -- 0:03:44
Average standard deviation of split frequencies: 0.023171
145500 -- (-767.328) (-757.297) [-756.251] (-764.254) * [-763.189] (-765.307) (-769.326) (-775.825) -- 0:03:49
146000 -- (-771.625) [-761.967] (-761.989) (-770.137) * (-755.424) (-766.020) (-761.368) [-764.269] -- 0:03:48
146500 -- (-769.775) [-762.799] (-759.965) (-766.857) * [-763.205] (-762.448) (-755.635) (-765.944) -- 0:03:47
147000 -- (-761.393) (-762.048) (-760.381) [-765.410] * (-768.444) (-768.452) [-758.394] (-767.289) -- 0:03:46
147500 -- [-768.475] (-763.785) (-768.917) (-759.274) * (-770.087) (-768.083) [-757.036] (-768.718) -- 0:03:45
148000 -- (-762.918) (-758.766) (-766.108) [-757.006] * (-759.871) [-763.592] (-772.286) (-770.968) -- 0:03:44
148500 -- (-759.331) (-762.393) (-763.792) [-762.658] * (-764.272) (-759.691) (-765.126) [-755.095] -- 0:03:43
149000 -- (-766.926) (-761.458) [-755.205] (-763.412) * (-774.136) [-762.368] (-771.352) (-762.518) -- 0:03:42
149500 -- [-770.637] (-759.143) (-758.603) (-763.881) * [-758.526] (-762.121) (-766.292) (-767.570) -- 0:03:47
150000 -- (-767.627) (-763.393) [-759.252] (-770.019) * [-759.538] (-771.592) (-764.111) (-760.854) -- 0:03:46
Average standard deviation of split frequencies: 0.022638
150500 -- (-758.966) (-754.640) [-757.216] (-760.462) * (-763.262) (-767.431) (-758.562) [-755.334] -- 0:03:45
151000 -- [-761.476] (-769.472) (-764.972) (-762.853) * (-768.710) (-762.252) [-754.953] (-758.180) -- 0:03:44
151500 -- (-760.518) (-762.055) [-759.162] (-754.411) * (-767.695) [-757.810] (-768.497) (-758.777) -- 0:03:44
152000 -- (-775.028) (-762.569) (-766.657) [-761.002] * (-760.783) [-759.314] (-768.464) (-760.015) -- 0:03:43
152500 -- [-758.051] (-755.859) (-763.556) (-761.951) * [-758.338] (-766.875) (-767.605) (-759.155) -- 0:03:42
153000 -- (-764.254) [-754.281] (-776.202) (-768.288) * (-756.762) [-762.036] (-761.153) (-761.248) -- 0:03:46
153500 -- [-768.907] (-768.838) (-771.822) (-761.858) * (-754.386) [-766.779] (-767.418) (-761.528) -- 0:03:46
154000 -- (-762.500) (-761.814) (-766.454) [-758.387] * (-754.382) (-765.414) (-773.882) [-762.008] -- 0:03:45
154500 -- (-759.924) [-760.396] (-764.355) (-762.885) * (-760.106) [-757.903] (-760.013) (-759.797) -- 0:03:44
155000 -- (-766.497) [-756.157] (-766.785) (-758.823) * [-765.192] (-757.823) (-769.043) (-758.848) -- 0:03:43
Average standard deviation of split frequencies: 0.022042
155500 -- (-764.763) [-763.073] (-767.008) (-767.797) * (-759.983) (-762.436) [-758.794] (-759.670) -- 0:03:42
156000 -- [-753.683] (-759.552) (-753.943) (-763.842) * (-754.335) (-768.060) (-758.197) [-760.620] -- 0:03:41
156500 -- (-767.630) (-766.534) [-760.043] (-764.731) * (-760.464) [-766.705] (-763.954) (-775.630) -- 0:03:40
157000 -- (-768.224) (-760.045) [-765.066] (-760.402) * (-752.337) (-760.479) (-759.859) [-759.996] -- 0:03:45
157500 -- (-763.112) (-762.315) [-753.191] (-763.358) * (-768.998) [-755.877] (-757.919) (-757.616) -- 0:03:44
158000 -- (-757.810) (-763.517) [-760.313] (-760.101) * (-755.404) [-758.648] (-764.799) (-761.302) -- 0:03:43
158500 -- [-760.773] (-761.252) (-758.563) (-755.892) * (-763.046) (-753.823) [-758.331] (-764.528) -- 0:03:42
159000 -- [-763.475] (-759.609) (-764.012) (-770.058) * (-773.036) [-759.569] (-760.243) (-758.929) -- 0:03:42
159500 -- [-756.500] (-768.503) (-768.939) (-764.134) * (-760.813) (-766.517) [-761.117] (-759.047) -- 0:03:41
160000 -- (-760.000) (-760.713) [-762.598] (-758.133) * (-762.593) (-771.260) [-758.337] (-767.045) -- 0:03:40
Average standard deviation of split frequencies: 0.021919
160500 -- (-766.601) (-770.100) [-758.267] (-761.118) * (-757.103) (-762.162) (-763.519) [-761.255] -- 0:03:44
161000 -- [-755.916] (-765.361) (-763.653) (-756.693) * (-763.692) (-752.845) (-768.198) [-762.911] -- 0:03:44
161500 -- (-772.637) [-759.406] (-760.413) (-774.954) * [-759.201] (-762.671) (-757.696) (-766.734) -- 0:03:43
162000 -- (-759.724) (-759.483) (-773.973) [-757.256] * [-762.822] (-763.219) (-762.471) (-764.313) -- 0:03:42
162500 -- (-766.889) (-763.421) (-762.659) [-753.265] * [-763.794] (-768.756) (-764.833) (-756.244) -- 0:03:41
163000 -- [-760.534] (-762.564) (-763.011) (-767.239) * (-775.205) (-761.523) (-770.371) [-759.853] -- 0:03:40
163500 -- (-762.871) [-758.850] (-769.888) (-765.839) * (-764.493) [-759.178] (-771.460) (-758.304) -- 0:03:39
164000 -- (-767.200) [-756.498] (-761.166) (-761.683) * (-764.917) (-763.877) [-760.168] (-761.691) -- 0:03:39
164500 -- (-775.560) (-770.207) (-757.894) [-756.244] * (-776.380) (-769.484) [-758.577] (-758.259) -- 0:03:43
165000 -- (-772.304) (-769.262) (-754.810) [-758.721] * [-759.966] (-754.758) (-769.964) (-758.007) -- 0:03:42
Average standard deviation of split frequencies: 0.020714
165500 -- [-761.433] (-768.752) (-767.876) (-758.898) * [-758.869] (-764.872) (-765.976) (-761.406) -- 0:03:41
166000 -- (-764.501) (-760.121) [-760.444] (-761.968) * (-761.894) [-765.114] (-761.443) (-764.065) -- 0:03:41
166500 -- (-765.792) (-775.685) (-754.405) [-764.544] * (-761.398) [-759.400] (-764.939) (-760.735) -- 0:03:40
167000 -- [-770.709] (-762.583) (-760.537) (-772.231) * (-758.852) [-758.896] (-762.107) (-762.234) -- 0:03:39
167500 -- (-780.160) (-766.535) [-765.128] (-764.114) * [-755.095] (-761.776) (-769.751) (-777.170) -- 0:03:38
168000 -- [-756.258] (-763.054) (-756.572) (-765.485) * [-758.238] (-757.796) (-765.157) (-770.193) -- 0:03:37
168500 -- (-768.379) (-764.701) [-759.899] (-761.431) * (-766.699) (-761.305) [-762.079] (-773.985) -- 0:03:42
169000 -- (-773.185) (-761.269) [-751.038] (-756.872) * (-756.182) [-756.168] (-756.503) (-763.861) -- 0:03:41
169500 -- (-757.445) [-770.882] (-785.529) (-759.738) * [-757.923] (-758.813) (-759.886) (-772.311) -- 0:03:40
170000 -- (-763.891) (-763.175) [-759.271] (-762.332) * (-758.185) (-767.633) (-766.633) [-762.658] -- 0:03:39
Average standard deviation of split frequencies: 0.021122
170500 -- (-777.942) (-769.864) (-767.525) [-758.227] * (-760.430) [-763.814] (-765.644) (-759.648) -- 0:03:38
171000 -- (-760.985) (-767.691) (-760.999) [-762.689] * (-765.554) (-761.361) [-758.693] (-768.873) -- 0:03:38
171500 -- (-764.444) (-766.961) (-762.878) [-759.505] * (-768.756) (-771.673) (-758.458) [-761.058] -- 0:03:37
172000 -- (-760.400) [-762.807] (-763.060) (-766.615) * (-757.779) (-767.972) [-765.138] (-760.805) -- 0:03:41
172500 -- (-764.744) (-759.767) [-760.392] (-765.438) * (-765.028) (-765.015) (-764.034) [-755.569] -- 0:03:40
173000 -- (-763.855) (-757.821) [-763.441] (-774.023) * (-764.102) (-759.565) [-764.411] (-757.366) -- 0:03:39
173500 -- [-759.719] (-770.774) (-754.317) (-762.885) * (-767.586) (-764.226) [-761.487] (-761.203) -- 0:03:39
174000 -- [-762.168] (-764.049) (-761.210) (-768.615) * (-763.201) (-766.211) [-759.939] (-778.339) -- 0:03:38
174500 -- [-757.771] (-761.216) (-766.338) (-767.615) * (-760.951) [-763.974] (-773.400) (-767.825) -- 0:03:37
175000 -- (-760.994) (-754.223) (-774.564) [-760.161] * [-772.519] (-756.132) (-763.723) (-762.402) -- 0:03:36
Average standard deviation of split frequencies: 0.021427
175500 -- (-766.501) (-767.170) [-757.389] (-766.422) * (-762.315) [-763.049] (-775.933) (-759.324) -- 0:03:36
176000 -- (-773.391) (-774.058) [-756.879] (-772.360) * (-759.718) (-759.435) [-758.724] (-767.069) -- 0:03:40
176500 -- [-763.352] (-762.396) (-773.899) (-761.449) * (-760.099) [-760.299] (-760.271) (-760.357) -- 0:03:39
177000 -- [-766.149] (-762.188) (-760.210) (-758.691) * (-770.021) (-757.716) [-761.378] (-764.069) -- 0:03:38
177500 -- (-766.951) (-755.812) (-760.274) [-760.260] * (-765.273) [-764.000] (-757.287) (-762.285) -- 0:03:37
178000 -- [-767.398] (-759.619) (-761.729) (-766.045) * (-770.929) (-762.977) [-757.576] (-761.298) -- 0:03:37
178500 -- (-772.382) [-761.761] (-762.833) (-761.345) * [-761.122] (-763.345) (-758.233) (-759.290) -- 0:03:36
179000 -- [-755.395] (-766.102) (-766.316) (-763.530) * (-770.523) (-758.251) [-755.770] (-759.426) -- 0:03:35
179500 -- (-769.169) (-765.213) [-759.180] (-764.491) * [-761.011] (-763.756) (-769.408) (-756.710) -- 0:03:39
180000 -- (-769.383) [-755.924] (-760.497) (-755.025) * [-757.126] (-776.841) (-765.850) (-765.047) -- 0:03:38
Average standard deviation of split frequencies: 0.019186
180500 -- (-762.473) [-758.576] (-756.912) (-761.532) * [-756.177] (-766.309) (-769.423) (-768.787) -- 0:03:37
181000 -- (-766.559) [-756.290] (-763.929) (-758.996) * [-754.425] (-762.388) (-770.584) (-764.480) -- 0:03:37
181500 -- (-762.740) [-755.486] (-757.128) (-759.281) * [-754.908] (-775.308) (-761.070) (-763.349) -- 0:03:36
182000 -- (-765.437) [-755.653] (-765.496) (-764.834) * [-755.414] (-769.315) (-759.292) (-770.283) -- 0:03:35
182500 -- [-763.600] (-762.500) (-765.474) (-759.210) * [-766.707] (-762.356) (-757.652) (-764.983) -- 0:03:35
183000 -- (-758.041) (-760.941) [-757.173] (-772.700) * (-759.042) (-751.423) (-766.235) [-764.493] -- 0:03:34
183500 -- (-764.574) (-774.312) (-762.812) [-759.159] * (-763.149) [-758.363] (-766.889) (-778.363) -- 0:03:38
184000 -- (-769.467) (-763.524) [-760.564] (-757.672) * (-760.677) [-756.140] (-757.144) (-773.482) -- 0:03:37
184500 -- [-761.312] (-761.198) (-755.729) (-754.357) * (-766.415) [-763.798] (-755.173) (-763.585) -- 0:03:36
185000 -- (-764.274) [-765.187] (-760.351) (-753.843) * (-765.853) (-760.766) (-772.843) [-759.345] -- 0:03:35
Average standard deviation of split frequencies: 0.018867
185500 -- (-767.427) (-765.657) [-757.156] (-757.460) * (-766.318) (-774.256) (-773.720) [-761.188] -- 0:03:35
186000 -- (-767.840) (-771.763) [-759.602] (-762.302) * (-757.707) (-764.892) (-764.447) [-753.933] -- 0:03:34
186500 -- (-766.905) (-768.541) [-749.132] (-754.424) * (-769.332) (-780.714) [-756.039] (-754.187) -- 0:03:33
187000 -- (-772.999) (-766.385) [-759.826] (-764.939) * [-759.718] (-764.445) (-767.734) (-773.355) -- 0:03:37
187500 -- (-762.249) (-772.550) (-754.953) [-763.143] * (-760.392) (-762.896) [-766.527] (-761.080) -- 0:03:36
188000 -- (-759.312) (-760.350) [-756.494] (-773.037) * (-759.998) (-766.000) [-757.605] (-756.314) -- 0:03:35
188500 -- [-760.866] (-753.508) (-760.302) (-754.225) * [-762.212] (-763.917) (-762.572) (-765.226) -- 0:03:35
189000 -- (-758.397) [-753.769] (-757.676) (-755.648) * (-761.213) (-758.347) (-760.576) [-755.572] -- 0:03:34
189500 -- (-760.257) (-754.882) [-761.886] (-757.436) * (-762.948) [-765.845] (-765.575) (-761.303) -- 0:03:33
190000 -- [-760.875] (-763.706) (-768.631) (-766.663) * (-764.943) (-760.979) (-764.679) [-760.969] -- 0:03:33
Average standard deviation of split frequencies: 0.019634
190500 -- (-758.564) (-753.033) (-769.466) [-756.555] * [-762.732] (-768.717) (-765.546) (-760.964) -- 0:03:32
191000 -- (-763.918) (-761.917) (-764.575) [-759.216] * [-756.464] (-772.127) (-756.448) (-764.603) -- 0:03:36
191500 -- (-756.023) [-764.633] (-764.622) (-762.571) * [-760.516] (-757.250) (-764.621) (-767.648) -- 0:03:35
192000 -- (-763.241) (-764.224) (-765.564) [-754.217] * (-761.115) (-767.243) (-770.120) [-762.348] -- 0:03:34
192500 -- (-766.015) [-760.944] (-764.590) (-760.189) * [-761.853] (-767.900) (-759.551) (-766.463) -- 0:03:33
193000 -- [-761.776] (-758.762) (-758.123) (-769.274) * (-761.739) [-755.116] (-759.097) (-777.900) -- 0:03:33
193500 -- (-762.709) (-763.159) (-768.629) [-759.537] * (-765.493) (-763.414) (-759.819) [-760.409] -- 0:03:32
194000 -- (-764.463) [-757.371] (-765.340) (-753.402) * (-766.255) [-766.951] (-771.002) (-756.375) -- 0:03:31
194500 -- (-765.588) [-759.989] (-760.801) (-755.376) * [-760.006] (-758.554) (-768.663) (-767.973) -- 0:03:35
195000 -- (-761.300) [-766.419] (-768.223) (-753.074) * [-762.037] (-762.387) (-766.582) (-762.266) -- 0:03:34
Average standard deviation of split frequencies: 0.021222
195500 -- (-760.644) (-766.662) [-762.395] (-762.926) * [-760.424] (-780.405) (-779.451) (-766.278) -- 0:03:33
196000 -- (-768.140) (-764.942) [-763.128] (-771.345) * [-763.152] (-765.968) (-766.656) (-769.759) -- 0:03:33
196500 -- (-765.110) [-757.551] (-767.593) (-758.304) * (-764.015) (-773.686) (-770.909) [-759.501] -- 0:03:32
197000 -- [-762.740] (-757.959) (-759.601) (-760.560) * (-763.216) (-760.544) (-764.815) [-758.019] -- 0:03:31
197500 -- [-760.802] (-758.697) (-764.330) (-766.149) * (-761.450) (-760.406) (-763.754) [-755.807] -- 0:03:31
198000 -- [-753.751] (-771.420) (-768.486) (-759.580) * (-758.548) (-761.561) [-762.063] (-759.910) -- 0:03:30
198500 -- (-762.940) [-762.946] (-769.495) (-757.756) * (-758.572) [-763.409] (-756.657) (-765.568) -- 0:03:34
199000 -- [-757.852] (-767.479) (-755.228) (-773.360) * (-765.991) (-756.016) (-774.263) [-761.016] -- 0:03:33
199500 -- [-757.388] (-757.259) (-769.316) (-774.879) * (-773.797) (-760.182) [-758.262] (-758.851) -- 0:03:32
200000 -- [-753.684] (-770.291) (-767.668) (-780.108) * (-764.629) [-757.202] (-770.360) (-759.534) -- 0:03:32
Average standard deviation of split frequencies: 0.021419
200500 -- [-757.203] (-753.586) (-767.390) (-768.727) * [-756.858] (-762.158) (-760.879) (-763.843) -- 0:03:31
201000 -- (-767.103) (-759.507) [-759.029] (-765.131) * [-762.927] (-763.355) (-768.344) (-764.404) -- 0:03:30
201500 -- [-759.844] (-764.286) (-766.762) (-765.553) * [-755.406] (-760.443) (-770.674) (-767.192) -- 0:03:30
202000 -- (-762.196) [-763.920] (-764.720) (-766.864) * (-758.957) [-756.783] (-762.554) (-767.383) -- 0:03:33
202500 -- (-769.952) [-757.970] (-762.019) (-758.328) * (-769.395) [-764.301] (-768.664) (-761.014) -- 0:03:32
203000 -- (-764.145) (-759.512) (-764.200) [-760.597] * (-760.198) [-762.012] (-761.713) (-766.753) -- 0:03:32
203500 -- (-763.081) [-760.131] (-767.515) (-759.494) * [-762.074] (-770.358) (-759.580) (-760.771) -- 0:03:31
204000 -- (-768.468) (-764.795) (-761.903) [-759.977] * (-770.315) (-769.461) [-755.848] (-768.410) -- 0:03:30
204500 -- (-771.969) (-769.322) (-755.782) [-755.873] * (-766.008) [-765.324] (-766.143) (-764.180) -- 0:03:30
205000 -- (-764.865) (-768.580) [-757.563] (-771.716) * (-759.925) (-770.520) [-757.052] (-769.835) -- 0:03:29
Average standard deviation of split frequencies: 0.019705
205500 -- (-765.704) (-761.283) (-761.642) [-762.810] * (-767.031) (-758.703) (-757.754) [-766.969] -- 0:03:28
206000 -- (-763.277) [-763.644] (-761.625) (-753.555) * (-762.526) [-758.018] (-759.111) (-762.434) -- 0:03:31
206500 -- (-769.660) (-760.259) [-762.229] (-763.185) * (-760.914) (-776.789) (-771.787) [-760.559] -- 0:03:31
207000 -- [-766.077] (-767.822) (-764.668) (-766.780) * (-763.819) [-763.011] (-763.634) (-761.094) -- 0:03:30
207500 -- (-778.784) (-763.799) [-757.775] (-765.097) * (-755.567) (-764.057) [-754.306] (-760.012) -- 0:03:30
208000 -- (-768.037) (-765.686) [-758.201] (-757.983) * (-762.250) (-765.921) (-761.875) [-759.635] -- 0:03:29
208500 -- (-768.273) [-765.790] (-753.984) (-776.187) * [-763.783] (-756.731) (-765.965) (-760.321) -- 0:03:28
209000 -- (-759.738) (-765.669) [-758.096] (-774.778) * (-764.486) [-759.369] (-757.971) (-764.238) -- 0:03:28
209500 -- (-771.104) (-765.809) (-765.093) [-763.126] * (-769.916) [-758.990] (-756.646) (-762.057) -- 0:03:31
210000 -- (-769.843) (-761.375) [-762.237] (-773.136) * (-769.651) (-767.367) [-761.634] (-764.635) -- 0:03:30
Average standard deviation of split frequencies: 0.017901
210500 -- (-761.945) [-752.105] (-760.579) (-766.957) * (-769.850) (-759.188) [-758.709] (-773.040) -- 0:03:30
211000 -- (-764.118) [-755.966] (-758.456) (-771.730) * [-772.589] (-759.884) (-763.392) (-757.351) -- 0:03:29
211500 -- (-765.394) (-760.512) [-758.501] (-764.525) * (-760.738) [-756.433] (-756.326) (-767.767) -- 0:03:28
212000 -- (-755.316) [-758.246] (-761.252) (-763.555) * (-761.261) (-768.395) [-756.865] (-780.668) -- 0:03:28
212500 -- [-764.005] (-761.990) (-758.565) (-768.146) * (-759.440) (-768.014) [-769.179] (-765.991) -- 0:03:27
213000 -- (-757.949) [-755.491] (-765.111) (-754.313) * (-772.286) [-756.036] (-769.004) (-774.030) -- 0:03:26
213500 -- (-763.787) (-758.362) [-760.467] (-763.171) * [-765.128] (-764.098) (-758.811) (-754.442) -- 0:03:29
214000 -- [-756.507] (-765.049) (-766.282) (-764.462) * (-773.288) (-767.706) [-757.231] (-761.285) -- 0:03:29
214500 -- [-766.541] (-763.086) (-758.444) (-760.981) * (-771.681) (-762.933) [-751.013] (-761.437) -- 0:03:28
215000 -- (-768.378) [-755.447] (-760.221) (-764.234) * [-764.551] (-760.007) (-762.619) (-769.795) -- 0:03:28
Average standard deviation of split frequencies: 0.016489
215500 -- (-766.265) [-759.411] (-763.007) (-765.774) * (-758.422) (-761.086) [-757.674] (-767.674) -- 0:03:27
216000 -- (-766.159) (-760.190) [-762.435] (-756.164) * (-764.315) (-765.330) [-758.792] (-762.107) -- 0:03:26
216500 -- (-763.099) (-775.597) (-758.269) [-762.257] * [-760.569] (-763.895) (-762.758) (-758.297) -- 0:03:26
217000 -- (-763.671) [-760.022] (-765.030) (-777.664) * (-771.278) [-759.301] (-770.082) (-764.567) -- 0:03:29
217500 -- [-759.972] (-759.845) (-766.689) (-759.679) * (-768.424) (-757.303) [-770.943] (-761.021) -- 0:03:28
218000 -- (-762.728) (-758.514) (-760.483) [-761.463] * (-768.581) (-762.548) [-762.137] (-763.222) -- 0:03:28
218500 -- (-763.397) [-765.470] (-769.784) (-765.423) * (-763.023) (-761.305) (-764.895) [-759.650] -- 0:03:27
219000 -- (-765.820) (-762.853) [-757.514] (-774.117) * (-761.167) [-762.191] (-759.292) (-762.422) -- 0:03:26
219500 -- [-751.306] (-758.078) (-761.262) (-759.088) * (-766.235) (-780.243) (-757.358) [-764.770] -- 0:03:26
220000 -- (-752.857) (-753.910) (-765.527) [-759.107] * [-762.186] (-761.743) (-766.948) (-767.176) -- 0:03:29
Average standard deviation of split frequencies: 0.017216
220500 -- [-759.316] (-758.836) (-754.154) (-761.659) * (-768.591) [-758.589] (-759.953) (-767.102) -- 0:03:28
221000 -- (-761.089) [-766.125] (-765.077) (-767.058) * (-765.586) (-757.934) (-760.505) [-759.555] -- 0:03:27
221500 -- (-764.151) (-763.498) (-772.707) [-764.420] * (-763.149) (-760.392) [-761.410] (-765.600) -- 0:03:27
222000 -- (-763.191) (-768.365) [-756.860] (-758.768) * (-762.803) (-760.136) [-762.125] (-766.892) -- 0:03:26
222500 -- (-760.901) (-769.032) (-754.329) [-762.665] * (-769.798) (-760.226) (-770.031) [-759.912] -- 0:03:26
223000 -- (-757.823) (-765.857) (-771.891) [-763.654] * [-762.032] (-762.243) (-762.209) (-763.216) -- 0:03:25
223500 -- (-767.763) (-756.927) (-764.940) [-755.851] * (-762.720) (-763.371) [-759.084] (-761.119) -- 0:03:28
224000 -- (-772.801) (-761.987) (-763.383) [-761.080] * (-759.021) (-764.153) (-765.180) [-760.496] -- 0:03:27
224500 -- (-772.942) (-770.874) (-756.631) [-761.486] * [-755.328] (-760.981) (-775.517) (-759.198) -- 0:03:27
225000 -- (-766.410) [-758.438] (-757.987) (-762.304) * (-762.493) (-766.048) (-755.740) [-761.866] -- 0:03:26
Average standard deviation of split frequencies: 0.016455
225500 -- (-774.119) [-769.043] (-769.206) (-766.945) * (-772.047) (-768.269) (-761.643) [-764.315] -- 0:03:26
226000 -- (-770.005) (-766.328) [-764.142] (-758.884) * (-758.364) (-769.402) [-759.092] (-760.249) -- 0:03:25
226500 -- (-771.797) (-757.315) (-754.931) [-758.594] * (-759.839) [-761.096] (-771.815) (-766.865) -- 0:03:24
227000 -- (-769.234) (-760.606) (-763.063) [-762.821] * (-770.299) (-765.578) [-760.843] (-758.492) -- 0:03:24
227500 -- (-771.857) (-763.441) (-773.764) [-755.940] * [-764.845] (-762.692) (-765.201) (-757.463) -- 0:03:27
228000 -- (-770.653) (-762.825) [-759.961] (-760.539) * (-766.280) (-763.379) [-755.911] (-766.615) -- 0:03:26
228500 -- (-770.621) [-771.074] (-765.866) (-765.695) * [-759.150] (-766.512) (-758.561) (-769.193) -- 0:03:25
229000 -- (-771.496) [-758.204] (-770.687) (-771.084) * [-760.346] (-769.294) (-764.470) (-763.852) -- 0:03:25
229500 -- (-765.414) (-756.843) (-762.861) [-759.384] * [-765.014] (-761.361) (-765.832) (-767.540) -- 0:03:24
230000 -- (-763.389) [-762.287] (-772.609) (-764.275) * (-765.529) [-760.264] (-756.011) (-763.975) -- 0:03:24
Average standard deviation of split frequencies: 0.017825
230500 -- (-767.386) (-751.680) [-770.251] (-758.681) * (-766.443) [-763.225] (-764.477) (-758.292) -- 0:03:23
231000 -- (-764.350) (-759.988) (-773.800) [-763.268] * (-766.819) [-755.052] (-758.894) (-761.986) -- 0:03:23
231500 -- (-765.062) [-754.783] (-762.826) (-766.618) * [-763.623] (-769.766) (-772.489) (-773.640) -- 0:03:25
232000 -- (-762.978) [-761.780] (-768.302) (-753.518) * (-765.300) (-762.717) (-767.969) [-762.469] -- 0:03:25
232500 -- (-764.352) [-763.361] (-765.446) (-763.341) * [-762.182] (-759.885) (-774.007) (-758.939) -- 0:03:24
233000 -- [-761.822] (-756.636) (-776.864) (-764.433) * [-752.679] (-758.497) (-754.602) (-754.157) -- 0:03:24
233500 -- [-764.637] (-761.075) (-765.101) (-762.669) * [-763.878] (-770.267) (-758.657) (-764.424) -- 0:03:23
234000 -- (-767.969) (-759.650) [-753.967] (-759.387) * (-774.144) (-765.421) [-759.667] (-760.436) -- 0:03:22
234500 -- (-770.837) (-762.430) (-759.855) [-757.520] * (-764.247) (-769.128) [-763.356] (-760.801) -- 0:03:22
235000 -- (-768.320) [-758.135] (-770.231) (-762.195) * (-771.345) (-766.447) (-765.350) [-764.005] -- 0:03:25
Average standard deviation of split frequencies: 0.017272
235500 -- (-759.972) [-757.523] (-764.896) (-763.996) * (-767.574) (-763.628) (-756.475) [-758.349] -- 0:03:24
236000 -- [-758.756] (-763.186) (-765.093) (-756.787) * (-759.252) (-762.138) (-764.780) [-755.138] -- 0:03:23
236500 -- (-764.419) [-766.158] (-762.518) (-765.671) * (-761.564) (-762.677) (-761.511) [-760.247] -- 0:03:23
237000 -- (-767.977) [-756.590] (-759.483) (-758.816) * (-758.764) [-763.821] (-773.374) (-767.347) -- 0:03:22
237500 -- (-763.462) (-763.506) (-768.253) [-761.811] * (-761.984) (-762.382) (-763.472) [-760.174] -- 0:03:22
238000 -- (-765.178) (-765.978) [-761.239] (-762.343) * (-763.858) (-765.055) (-774.941) [-764.636] -- 0:03:21
238500 -- (-767.908) (-768.368) (-762.063) [-756.962] * (-754.621) (-759.573) [-758.336] (-764.759) -- 0:03:21
239000 -- (-764.174) (-758.469) (-763.552) [-754.209] * [-758.876] (-763.974) (-761.504) (-760.016) -- 0:03:23
239500 -- (-771.363) (-765.534) [-758.819] (-757.501) * (-757.696) [-755.632] (-764.659) (-763.467) -- 0:03:23
240000 -- [-761.195] (-761.680) (-756.306) (-758.158) * (-763.813) (-769.530) (-761.447) [-753.888] -- 0:03:22
Average standard deviation of split frequencies: 0.015900
240500 -- [-761.873] (-760.528) (-760.360) (-766.260) * (-763.582) [-765.363] (-761.587) (-757.787) -- 0:03:22
241000 -- (-766.007) [-758.119] (-769.919) (-766.498) * (-758.132) (-763.051) [-757.298] (-766.218) -- 0:03:21
241500 -- (-767.930) [-758.770] (-766.107) (-770.786) * (-758.920) (-761.590) [-760.974] (-762.686) -- 0:03:21
242000 -- [-753.384] (-763.537) (-761.854) (-770.620) * [-756.673] (-760.810) (-758.496) (-759.660) -- 0:03:20
242500 -- (-760.144) (-762.902) (-765.015) [-771.122] * (-769.642) [-756.739] (-758.818) (-772.465) -- 0:03:23
243000 -- [-754.702] (-767.398) (-762.252) (-768.105) * [-762.885] (-756.977) (-761.223) (-762.564) -- 0:03:22
243500 -- [-760.841] (-764.440) (-759.149) (-763.223) * (-766.719) [-765.043] (-760.031) (-760.356) -- 0:03:21
244000 -- (-757.390) (-754.632) [-760.844] (-759.803) * (-761.255) (-766.361) (-765.050) [-763.125] -- 0:03:21
244500 -- [-767.229] (-763.872) (-766.107) (-763.769) * [-760.063] (-774.642) (-765.737) (-765.626) -- 0:03:20
245000 -- (-768.079) (-765.442) (-765.500) [-751.834] * (-759.665) (-761.052) [-755.414] (-762.114) -- 0:03:20
Average standard deviation of split frequencies: 0.016457
245500 -- [-762.424] (-775.740) (-761.281) (-765.512) * (-761.472) (-759.229) [-767.080] (-761.685) -- 0:03:19
246000 -- (-758.643) [-757.471] (-775.099) (-762.436) * (-766.634) (-768.682) (-767.306) [-753.240] -- 0:03:19
246500 -- (-761.583) (-767.994) [-756.264] (-764.894) * (-762.862) (-762.036) (-762.420) [-761.721] -- 0:03:21
247000 -- [-753.681] (-766.057) (-762.028) (-771.888) * (-764.368) (-767.353) [-760.177] (-761.567) -- 0:03:21
247500 -- (-772.270) (-762.375) (-761.683) [-761.810] * (-757.987) (-761.074) (-785.302) [-758.218] -- 0:03:20
248000 -- (-775.037) (-774.869) [-762.557] (-757.381) * (-769.619) (-775.882) [-768.951] (-765.413) -- 0:03:20
248500 -- (-763.010) (-768.414) [-757.968] (-760.872) * (-761.432) [-769.607] (-762.041) (-765.155) -- 0:03:19
249000 -- (-758.867) [-766.856] (-764.626) (-772.132) * (-763.305) (-773.493) [-756.589] (-762.248) -- 0:03:19
249500 -- (-765.316) [-754.757] (-761.043) (-762.859) * [-764.395] (-764.216) (-757.002) (-758.543) -- 0:03:18
250000 -- (-768.705) [-758.841] (-767.620) (-771.119) * (-768.873) [-766.544] (-769.380) (-762.713) -- 0:03:21
Average standard deviation of split frequencies: 0.016151
250500 -- (-760.184) (-764.870) [-752.857] (-764.317) * (-757.065) [-759.664] (-759.680) (-767.324) -- 0:03:20
251000 -- (-769.464) [-755.681] (-761.967) (-758.152) * (-759.142) [-758.388] (-777.222) (-760.907) -- 0:03:19
251500 -- (-762.218) (-761.604) (-765.219) [-756.158] * [-759.143] (-769.237) (-764.078) (-768.004) -- 0:03:19
252000 -- (-757.143) (-762.651) (-769.336) [-762.660] * [-765.155] (-758.897) (-756.395) (-767.034) -- 0:03:18
252500 -- (-760.124) (-760.165) [-761.214] (-763.002) * [-759.562] (-770.695) (-765.481) (-761.889) -- 0:03:18
253000 -- (-753.335) (-758.957) (-761.311) [-758.956] * (-773.335) (-762.271) (-764.383) [-761.742] -- 0:03:17
253500 -- (-760.608) (-765.810) (-768.053) [-755.427] * (-766.045) (-758.311) (-766.086) [-756.548] -- 0:03:17
254000 -- (-775.245) (-763.962) [-759.411] (-754.208) * (-763.775) [-753.077] (-758.143) (-762.170) -- 0:03:19
254500 -- (-759.577) (-761.648) (-759.917) [-754.488] * (-762.765) [-759.549] (-758.559) (-773.900) -- 0:03:19
255000 -- (-756.043) (-762.589) (-762.513) [-755.796] * (-770.808) [-755.163] (-756.460) (-761.286) -- 0:03:18
Average standard deviation of split frequencies: 0.015706
255500 -- (-773.757) (-759.941) [-768.162] (-767.095) * (-759.601) [-758.940] (-765.599) (-760.019) -- 0:03:18
256000 -- (-752.056) (-759.134) (-763.903) [-763.592] * (-768.748) [-753.183] (-761.971) (-765.270) -- 0:03:17
256500 -- (-761.235) [-756.853] (-756.717) (-755.767) * (-760.888) (-760.814) [-756.145] (-767.000) -- 0:03:17
257000 -- (-778.908) (-762.008) [-763.445] (-757.397) * (-760.939) (-770.720) [-766.487] (-757.601) -- 0:03:16
257500 -- (-775.545) (-767.930) [-759.218] (-761.106) * (-762.303) [-766.002] (-762.164) (-761.282) -- 0:03:18
258000 -- (-766.213) [-768.043] (-759.246) (-764.350) * (-765.816) (-765.249) (-765.039) [-767.307] -- 0:03:18
258500 -- (-758.241) (-757.552) [-754.866] (-768.931) * [-762.183] (-766.704) (-755.662) (-764.398) -- 0:03:17
259000 -- (-763.200) (-773.171) (-767.238) [-764.554] * (-767.348) [-759.568] (-757.589) (-768.280) -- 0:03:17
259500 -- [-760.204] (-762.615) (-773.103) (-758.980) * (-763.398) [-760.176] (-759.851) (-762.980) -- 0:03:16
260000 -- [-760.557] (-768.105) (-755.954) (-757.772) * (-766.269) [-762.553] (-761.468) (-773.792) -- 0:03:16
Average standard deviation of split frequencies: 0.015744
260500 -- [-757.823] (-764.574) (-760.029) (-767.957) * (-759.675) (-761.937) (-757.714) [-756.366] -- 0:03:15
261000 -- (-766.394) (-759.059) [-754.347] (-763.954) * (-764.355) (-770.945) [-753.307] (-761.902) -- 0:03:15
261500 -- (-755.158) (-762.094) [-755.085] (-775.314) * [-763.580] (-764.230) (-766.239) (-771.044) -- 0:03:17
262000 -- (-760.784) (-763.507) (-770.512) [-765.862] * (-757.366) (-777.206) [-758.369] (-759.205) -- 0:03:17
262500 -- (-756.178) (-765.602) [-765.585] (-764.495) * [-759.719] (-762.293) (-760.554) (-759.833) -- 0:03:16
263000 -- (-763.672) [-760.676] (-766.152) (-758.803) * (-759.401) (-765.144) (-769.175) [-766.004] -- 0:03:16
263500 -- (-762.620) (-766.526) [-762.176] (-770.705) * [-754.719] (-773.535) (-755.663) (-756.904) -- 0:03:15
264000 -- (-771.474) [-758.307] (-766.285) (-777.211) * (-765.797) (-773.612) (-760.515) [-764.074] -- 0:03:15
264500 -- (-763.264) (-766.954) [-755.891] (-760.127) * [-767.015] (-757.578) (-762.900) (-767.541) -- 0:03:14
265000 -- (-771.900) (-756.629) [-762.521] (-767.081) * (-759.433) (-766.621) (-761.304) [-762.479] -- 0:03:14
Average standard deviation of split frequencies: 0.015846
265500 -- (-771.360) [-761.026] (-761.515) (-762.031) * [-753.407] (-762.882) (-767.776) (-766.252) -- 0:03:16
266000 -- (-768.211) [-756.807] (-761.059) (-767.788) * (-756.859) (-762.605) [-766.443] (-754.953) -- 0:03:15
266500 -- (-774.406) [-756.769] (-764.142) (-765.005) * (-764.626) (-767.613) [-766.633] (-758.141) -- 0:03:15
267000 -- (-769.220) (-754.519) (-759.602) [-760.493] * [-767.550] (-758.410) (-764.036) (-762.770) -- 0:03:14
267500 -- (-766.091) [-755.869] (-764.756) (-759.507) * (-759.476) (-766.358) [-761.575] (-772.322) -- 0:03:14
268000 -- [-757.220] (-775.715) (-770.248) (-758.952) * [-761.035] (-761.931) (-765.499) (-768.103) -- 0:03:13
268500 -- (-770.728) [-753.335] (-760.356) (-766.532) * (-762.912) (-760.230) [-757.168] (-755.634) -- 0:03:13
269000 -- [-757.762] (-766.468) (-769.112) (-761.720) * (-772.257) (-762.387) [-759.819] (-761.480) -- 0:03:15
269500 -- (-765.954) (-765.972) [-753.951] (-769.789) * (-772.943) [-757.265] (-765.998) (-760.088) -- 0:03:15
270000 -- [-757.217] (-770.584) (-765.221) (-767.891) * (-765.774) (-763.852) (-761.005) [-764.660] -- 0:03:14
Average standard deviation of split frequencies: 0.015982
270500 -- (-763.074) [-756.447] (-764.648) (-757.555) * [-761.727] (-760.656) (-763.654) (-757.589) -- 0:03:14
271000 -- (-763.037) [-766.462] (-756.675) (-771.149) * (-761.130) (-768.503) (-769.101) [-756.904] -- 0:03:13
271500 -- [-755.633] (-768.279) (-763.851) (-759.229) * (-761.455) (-761.664) [-760.258] (-762.967) -- 0:03:13
272000 -- (-759.779) [-760.762] (-765.124) (-767.219) * (-767.763) [-762.880] (-773.809) (-767.604) -- 0:03:12
272500 -- (-768.884) [-756.201] (-766.576) (-759.323) * (-757.664) (-763.153) [-752.767] (-762.859) -- 0:03:12
273000 -- [-763.759] (-759.689) (-760.163) (-764.255) * (-761.924) (-754.472) [-755.364] (-770.427) -- 0:03:14
273500 -- (-775.710) [-759.653] (-760.859) (-763.940) * [-757.245] (-766.225) (-764.526) (-768.718) -- 0:03:13
274000 -- (-762.182) [-764.822] (-762.547) (-757.812) * (-763.406) [-764.084] (-761.916) (-771.410) -- 0:03:13
274500 -- (-766.094) (-761.757) (-760.989) [-755.595] * (-764.957) (-776.827) (-764.208) [-758.486] -- 0:03:12
275000 -- [-762.969] (-762.260) (-777.761) (-761.100) * (-766.793) (-761.801) [-757.034] (-765.404) -- 0:03:12
Average standard deviation of split frequencies: 0.015673
275500 -- (-769.097) (-756.926) (-777.063) [-757.809] * (-764.401) (-760.892) [-764.765] (-766.079) -- 0:03:11
276000 -- [-758.915] (-760.468) (-766.065) (-764.008) * (-762.384) [-763.164] (-764.893) (-764.515) -- 0:03:11
276500 -- (-770.548) (-752.491) [-762.553] (-767.919) * (-766.538) (-775.723) (-756.897) [-771.252] -- 0:03:13
277000 -- (-762.112) (-765.840) (-759.786) [-763.510] * (-762.676) [-762.919] (-766.015) (-773.336) -- 0:03:13
277500 -- [-759.809] (-760.772) (-768.264) (-767.804) * (-769.341) (-771.402) [-760.668] (-770.498) -- 0:03:12
278000 -- [-755.564] (-761.078) (-771.765) (-763.277) * (-766.573) (-764.134) (-774.878) [-761.070] -- 0:03:12
278500 -- [-762.661] (-761.735) (-759.896) (-772.544) * (-765.222) [-754.873] (-757.757) (-769.256) -- 0:03:11
279000 -- (-767.973) (-757.623) [-761.741] (-764.408) * (-774.298) [-761.646] (-757.928) (-760.911) -- 0:03:11
279500 -- (-769.315) [-759.840] (-761.854) (-771.482) * [-760.396] (-769.027) (-777.177) (-758.058) -- 0:03:10
280000 -- (-762.173) [-761.803] (-766.703) (-771.397) * (-767.273) [-758.232] (-762.370) (-765.834) -- 0:03:10
Average standard deviation of split frequencies: 0.015610
280500 -- (-771.341) [-763.434] (-763.756) (-763.740) * [-761.785] (-769.389) (-758.908) (-758.897) -- 0:03:12
281000 -- (-766.882) [-757.213] (-769.435) (-768.563) * (-763.089) [-761.101] (-769.810) (-762.396) -- 0:03:11
281500 -- (-762.568) (-766.882) (-770.169) [-761.025] * [-761.852] (-764.338) (-766.639) (-766.102) -- 0:03:11
282000 -- (-772.530) (-761.493) [-756.429] (-767.879) * (-773.457) [-759.566] (-759.946) (-761.643) -- 0:03:10
282500 -- [-756.128] (-758.281) (-767.258) (-765.794) * (-770.781) [-761.649] (-761.403) (-760.954) -- 0:03:10
283000 -- (-756.889) (-763.621) (-768.810) [-758.448] * (-764.992) (-766.995) (-764.532) [-760.065] -- 0:03:10
283500 -- (-760.498) [-763.159] (-764.180) (-762.503) * (-768.800) [-757.861] (-758.126) (-763.664) -- 0:03:09
284000 -- [-763.583] (-760.281) (-758.424) (-756.804) * (-768.486) [-763.780] (-770.496) (-767.292) -- 0:03:11
284500 -- [-768.530] (-761.990) (-769.522) (-763.752) * (-764.725) (-761.470) (-768.929) [-765.266] -- 0:03:11
285000 -- (-765.793) [-764.478] (-771.245) (-764.158) * (-764.682) (-755.863) [-761.958] (-768.117) -- 0:03:10
Average standard deviation of split frequencies: 0.015416
285500 -- (-769.763) (-768.664) [-767.735] (-769.080) * (-770.059) (-763.018) (-766.989) [-761.320] -- 0:03:10
286000 -- (-767.145) (-765.416) (-762.749) [-756.769] * [-756.855] (-765.669) (-774.648) (-768.638) -- 0:03:09
286500 -- (-772.931) (-765.156) [-758.553] (-762.482) * [-755.599] (-759.399) (-759.011) (-767.612) -- 0:03:09
287000 -- [-766.100] (-765.338) (-759.746) (-757.193) * (-760.710) (-765.380) (-761.741) [-755.935] -- 0:03:08
287500 -- (-762.812) [-765.697] (-756.266) (-764.708) * (-758.489) [-756.545] (-760.290) (-758.164) -- 0:03:10
288000 -- (-765.060) (-763.130) (-762.530) [-758.369] * (-760.238) (-761.456) [-762.872] (-773.508) -- 0:03:10
288500 -- (-768.743) [-761.841] (-764.167) (-753.378) * (-760.914) (-764.950) [-765.263] (-769.298) -- 0:03:09
289000 -- (-768.023) (-770.937) [-759.307] (-761.132) * [-755.834] (-764.397) (-778.315) (-765.044) -- 0:03:09
289500 -- [-763.001] (-754.549) (-760.208) (-759.886) * (-765.325) [-756.077] (-758.648) (-773.166) -- 0:03:08
290000 -- (-760.428) [-755.100] (-759.675) (-761.555) * (-765.725) (-768.377) [-760.238] (-761.431) -- 0:03:08
Average standard deviation of split frequencies: 0.015646
290500 -- [-763.635] (-758.079) (-753.590) (-778.263) * [-759.746] (-765.558) (-765.478) (-761.378) -- 0:03:08
291000 -- (-765.798) [-756.278] (-759.418) (-781.969) * (-762.846) (-779.359) [-758.126] (-764.760) -- 0:03:10
291500 -- (-762.489) (-776.043) [-758.583] (-763.669) * [-766.544] (-769.050) (-757.643) (-759.802) -- 0:03:09
292000 -- (-767.657) [-757.780] (-767.792) (-763.390) * (-773.267) (-768.589) [-758.501] (-762.181) -- 0:03:09
292500 -- (-765.419) (-761.441) (-754.613) [-760.677] * [-754.183] (-763.135) (-759.118) (-764.211) -- 0:03:08
293000 -- (-756.378) (-769.201) (-766.412) [-763.299] * [-756.296] (-767.550) (-757.435) (-760.389) -- 0:03:08
293500 -- (-760.480) (-761.069) (-764.038) [-761.851] * (-766.188) (-756.575) (-763.765) [-757.742] -- 0:03:07
294000 -- (-762.806) (-759.800) [-757.265] (-762.084) * [-758.727] (-771.309) (-764.492) (-763.430) -- 0:03:07
294500 -- (-757.484) (-772.813) (-765.256) [-755.166] * (-773.603) (-761.239) (-762.744) [-759.940] -- 0:03:09
295000 -- (-769.708) (-772.815) (-757.873) [-758.737] * (-764.109) (-760.267) (-766.376) [-760.737] -- 0:03:08
Average standard deviation of split frequencies: 0.015832
295500 -- [-760.956] (-757.605) (-765.998) (-760.618) * [-759.242] (-775.890) (-761.879) (-761.978) -- 0:03:08
296000 -- (-770.813) (-757.548) (-774.894) [-764.487] * (-775.386) (-766.660) (-761.974) [-755.767] -- 0:03:07
296500 -- [-765.512] (-762.263) (-758.199) (-765.033) * (-766.887) [-764.429] (-759.542) (-761.425) -- 0:03:07
297000 -- (-774.365) (-765.451) [-761.305] (-761.245) * (-759.827) [-765.109] (-757.995) (-764.577) -- 0:03:06
297500 -- (-767.583) (-761.050) [-758.670] (-763.798) * [-766.087] (-770.225) (-759.049) (-768.660) -- 0:03:06
298000 -- (-775.123) (-758.156) [-757.033] (-763.368) * (-762.737) (-765.764) (-771.255) [-759.781] -- 0:03:06
298500 -- (-759.230) (-766.543) [-755.080] (-769.715) * [-761.768] (-769.956) (-765.185) (-766.307) -- 0:03:08
299000 -- (-756.998) [-765.504] (-766.372) (-766.325) * (-763.748) [-764.313] (-760.282) (-756.547) -- 0:03:07
299500 -- (-756.923) (-763.238) (-764.839) [-759.698] * (-766.287) [-761.623] (-766.531) (-757.727) -- 0:03:07
300000 -- (-761.664) (-766.684) (-763.643) [-760.564] * (-769.756) (-768.137) [-756.364] (-758.437) -- 0:03:06
Average standard deviation of split frequencies: 0.014849
300500 -- (-760.648) (-767.491) [-769.406] (-761.495) * [-755.882] (-764.979) (-770.175) (-763.004) -- 0:03:06
301000 -- (-755.813) (-765.301) [-760.103] (-768.328) * (-759.281) (-766.337) (-761.925) [-763.860] -- 0:03:05
301500 -- (-766.234) (-757.398) [-756.831] (-772.481) * (-756.396) (-761.131) (-771.470) [-762.463] -- 0:03:05
302000 -- (-774.749) [-765.691] (-759.813) (-763.167) * (-760.295) (-758.138) (-759.730) [-757.414] -- 0:03:07
302500 -- (-765.631) (-756.108) [-754.583] (-763.002) * [-757.505] (-762.376) (-758.141) (-761.851) -- 0:03:06
303000 -- (-763.936) (-765.645) [-773.682] (-761.099) * (-758.856) (-766.014) [-759.548] (-763.126) -- 0:03:06
303500 -- [-758.130] (-761.684) (-763.195) (-764.780) * (-765.058) (-763.233) [-764.188] (-762.475) -- 0:03:05
304000 -- [-762.531] (-755.526) (-767.804) (-772.756) * [-755.399] (-758.900) (-763.700) (-758.693) -- 0:03:05
304500 -- (-758.751) [-754.780] (-767.018) (-766.259) * (-772.307) (-762.919) [-756.035] (-762.816) -- 0:03:05
305000 -- [-763.786] (-758.861) (-767.413) (-759.934) * [-765.420] (-764.081) (-761.756) (-767.849) -- 0:03:04
Average standard deviation of split frequencies: 0.015768
305500 -- (-765.523) [-761.950] (-761.646) (-761.051) * (-764.390) [-754.799] (-773.841) (-770.797) -- 0:03:04
306000 -- (-764.764) [-756.910] (-764.532) (-776.060) * [-762.372] (-763.553) (-762.000) (-769.278) -- 0:03:05
306500 -- (-762.138) [-755.832] (-768.332) (-763.431) * (-765.381) (-793.732) [-761.676] (-768.736) -- 0:03:05
307000 -- [-754.874] (-756.785) (-780.403) (-775.987) * [-767.927] (-768.785) (-765.062) (-765.601) -- 0:03:05
307500 -- [-762.397] (-758.729) (-774.333) (-761.651) * (-766.823) (-772.680) [-758.729] (-759.089) -- 0:03:04
308000 -- (-763.718) (-767.788) (-767.467) [-757.697] * [-766.294] (-762.311) (-760.665) (-763.632) -- 0:03:04
308500 -- (-757.493) (-763.350) (-760.223) [-767.564] * (-761.498) (-770.142) [-765.095] (-762.208) -- 0:03:03
309000 -- (-762.859) (-760.548) (-758.121) [-764.750] * (-767.236) (-763.554) [-758.345] (-761.526) -- 0:03:03
309500 -- (-780.320) (-761.078) [-753.107] (-780.256) * (-767.072) (-758.905) [-765.305] (-749.459) -- 0:03:05
310000 -- (-760.552) (-762.402) (-764.047) [-756.056] * (-769.224) (-763.174) [-764.287] (-759.694) -- 0:03:04
Average standard deviation of split frequencies: 0.015085
310500 -- (-764.344) [-771.421] (-761.218) (-759.674) * [-762.533] (-759.310) (-779.315) (-758.467) -- 0:03:04
311000 -- (-768.337) [-758.149] (-773.317) (-757.148) * (-760.616) (-770.039) [-754.673] (-769.757) -- 0:03:03
311500 -- (-756.576) (-761.182) (-763.399) [-752.783] * (-767.087) [-763.880] (-764.260) (-761.268) -- 0:03:03
312000 -- (-767.728) [-756.604] (-766.066) (-761.789) * (-764.961) [-759.181] (-763.371) (-760.378) -- 0:03:03
312500 -- [-755.792] (-758.031) (-761.350) (-765.191) * (-771.115) [-763.802] (-757.508) (-761.028) -- 0:03:02
313000 -- (-768.405) [-753.351] (-766.965) (-764.434) * (-762.727) (-763.227) [-758.002] (-768.072) -- 0:03:02
313500 -- (-759.122) (-767.907) [-765.601] (-763.936) * [-756.765] (-767.641) (-766.879) (-765.686) -- 0:03:03
314000 -- (-756.652) [-763.822] (-758.885) (-760.848) * (-754.461) (-763.504) (-757.836) [-757.660] -- 0:03:03
314500 -- [-760.644] (-761.052) (-759.111) (-773.149) * (-771.228) (-763.049) (-765.807) [-763.515] -- 0:03:03
315000 -- [-755.622] (-762.827) (-754.925) (-764.015) * (-777.131) (-760.733) [-762.581] (-768.042) -- 0:03:02
Average standard deviation of split frequencies: 0.016146
315500 -- (-757.295) (-765.647) [-765.810] (-765.389) * (-774.079) (-756.557) (-762.780) [-759.776] -- 0:03:02
316000 -- [-754.770] (-761.112) (-780.215) (-765.399) * (-762.951) [-754.325] (-756.951) (-753.195) -- 0:03:01
316500 -- (-759.998) (-765.309) (-765.514) [-755.899] * (-775.249) (-763.071) [-758.992] (-763.162) -- 0:03:01
317000 -- (-765.713) [-763.130] (-757.619) (-767.100) * (-764.808) (-769.964) (-765.167) [-756.991] -- 0:03:03
317500 -- (-769.607) (-759.233) (-763.312) [-762.973] * (-762.530) (-758.191) (-764.278) [-759.453] -- 0:03:02
318000 -- (-768.877) (-762.725) (-758.969) [-762.434] * [-759.850] (-756.113) (-761.168) (-769.916) -- 0:03:02
318500 -- (-771.725) (-752.912) [-758.821] (-765.527) * (-768.914) [-760.557] (-767.724) (-769.382) -- 0:03:01
319000 -- (-767.190) (-762.980) (-764.371) [-756.110] * (-763.189) [-756.524] (-776.880) (-769.155) -- 0:03:01
319500 -- (-763.904) [-764.241] (-762.310) (-760.721) * (-766.432) (-755.892) (-772.952) [-765.164] -- 0:03:01
320000 -- [-759.790] (-757.555) (-764.467) (-766.264) * (-761.815) [-754.663] (-762.493) (-763.419) -- 0:03:00
Average standard deviation of split frequencies: 0.016257
320500 -- (-766.359) (-757.560) (-764.459) [-759.287] * (-763.756) (-752.645) [-761.000] (-774.949) -- 0:03:00
321000 -- [-765.094] (-772.662) (-766.549) (-765.566) * (-773.502) [-758.648] (-772.228) (-770.375) -- 0:03:01
321500 -- (-767.847) [-757.131] (-768.285) (-773.102) * [-766.469] (-757.742) (-759.285) (-761.284) -- 0:03:01
322000 -- (-754.524) (-770.707) [-762.971] (-764.632) * (-765.533) [-753.582] (-763.344) (-763.178) -- 0:03:01
322500 -- (-772.527) [-760.209] (-777.746) (-760.699) * (-773.419) [-756.876] (-761.201) (-759.773) -- 0:03:00
323000 -- (-769.906) (-766.082) (-773.633) [-765.838] * (-780.566) [-753.470] (-761.487) (-763.591) -- 0:03:00
323500 -- (-768.987) (-773.100) (-774.852) [-761.028] * (-761.895) (-756.564) [-760.070] (-764.009) -- 0:02:59
324000 -- [-758.520] (-771.072) (-764.263) (-765.018) * (-779.810) (-761.196) [-754.976] (-754.634) -- 0:02:59
324500 -- (-773.833) (-764.423) [-760.346] (-759.402) * (-762.130) [-761.003] (-762.550) (-767.016) -- 0:03:01
325000 -- (-772.333) [-762.532] (-766.124) (-758.694) * (-766.022) (-768.044) [-756.284] (-763.473) -- 0:03:00
Average standard deviation of split frequencies: 0.015056
325500 -- (-755.050) [-754.517] (-768.228) (-776.262) * (-761.100) (-761.614) [-758.685] (-762.232) -- 0:03:00
326000 -- (-766.959) (-759.105) (-770.583) [-763.976] * (-762.881) (-761.876) (-756.668) [-756.391] -- 0:02:59
326500 -- (-775.473) (-759.734) (-771.038) [-763.512] * (-769.374) (-759.536) (-777.902) [-757.900] -- 0:02:59
327000 -- (-762.395) [-758.618] (-772.062) (-760.755) * (-760.699) [-762.108] (-769.758) (-756.172) -- 0:02:59
327500 -- (-755.744) (-770.679) [-770.990] (-767.995) * (-778.158) [-763.129] (-757.831) (-754.133) -- 0:02:58
328000 -- (-761.663) (-771.881) (-770.629) [-756.716] * [-760.421] (-757.976) (-765.370) (-757.382) -- 0:02:58
328500 -- [-759.411] (-763.125) (-764.274) (-758.917) * (-755.465) (-765.856) [-755.870] (-760.814) -- 0:02:59
329000 -- (-764.013) [-760.034] (-766.626) (-762.486) * [-754.802] (-771.219) (-757.632) (-765.960) -- 0:02:59
329500 -- (-760.464) (-770.673) (-775.890) [-758.847] * (-778.844) (-763.797) [-762.856] (-758.507) -- 0:02:59
330000 -- (-759.153) [-765.478] (-769.960) (-762.478) * (-760.112) (-759.766) (-768.345) [-753.159] -- 0:02:58
Average standard deviation of split frequencies: 0.015933
330500 -- (-763.771) (-766.949) [-761.460] (-756.109) * (-762.178) (-768.825) [-758.063] (-768.230) -- 0:02:58
331000 -- (-768.675) [-759.469] (-758.411) (-756.993) * (-761.516) [-758.904] (-764.852) (-767.346) -- 0:02:57
331500 -- (-764.383) (-765.559) [-754.531] (-763.948) * [-755.349] (-763.795) (-766.996) (-776.772) -- 0:02:57
332000 -- (-770.828) (-758.106) (-759.788) [-757.743] * (-757.817) (-766.113) (-771.680) [-765.848] -- 0:02:57
332500 -- (-766.524) [-761.840] (-763.433) (-759.557) * (-771.577) (-768.432) (-766.969) [-757.065] -- 0:02:58
333000 -- [-768.322] (-766.922) (-762.242) (-763.014) * (-774.078) (-768.776) (-759.840) [-759.731] -- 0:02:58
333500 -- [-758.035] (-764.029) (-763.458) (-770.240) * (-760.691) (-769.191) [-763.331] (-762.906) -- 0:02:57
334000 -- (-777.423) (-757.419) (-764.924) [-763.925] * (-756.848) (-758.141) [-760.543] (-766.827) -- 0:02:57
334500 -- (-767.479) (-755.343) [-759.904] (-766.545) * [-753.062] (-761.110) (-755.987) (-759.464) -- 0:02:57
335000 -- (-759.292) (-766.951) (-765.276) [-755.463] * (-759.630) [-760.187] (-768.606) (-760.318) -- 0:02:56
Average standard deviation of split frequencies: 0.017001
335500 -- (-760.923) (-760.871) (-761.191) [-763.280] * (-760.162) [-761.029] (-760.636) (-776.285) -- 0:02:56
336000 -- (-753.242) (-760.328) [-757.697] (-772.160) * (-761.601) [-761.705] (-758.719) (-769.976) -- 0:02:57
336500 -- (-757.976) (-762.755) [-766.316] (-758.450) * (-763.151) (-764.581) [-765.753] (-762.879) -- 0:02:57
337000 -- (-762.807) (-769.735) [-766.493] (-759.651) * [-764.496] (-761.297) (-759.494) (-756.012) -- 0:02:57
337500 -- (-768.315) [-759.669] (-761.016) (-756.569) * (-770.053) (-758.211) (-764.333) [-759.184] -- 0:02:56
338000 -- (-756.581) (-766.361) (-768.493) [-763.840] * (-766.495) [-756.230] (-758.696) (-757.002) -- 0:02:56
338500 -- (-763.672) [-763.519] (-755.779) (-765.195) * [-764.461] (-767.032) (-766.659) (-769.385) -- 0:02:55
339000 -- [-763.479] (-760.076) (-761.180) (-761.849) * (-765.765) [-763.209] (-759.176) (-769.092) -- 0:02:55
339500 -- (-772.750) (-767.653) [-771.204] (-770.319) * (-764.847) [-756.716] (-760.872) (-758.622) -- 0:02:57
340000 -- [-757.942] (-771.121) (-770.213) (-759.315) * [-754.806] (-763.585) (-775.357) (-765.908) -- 0:02:56
Average standard deviation of split frequencies: 0.017663
340500 -- (-754.000) (-758.393) (-764.741) [-755.456] * [-754.563] (-766.486) (-764.807) (-764.392) -- 0:02:56
341000 -- (-760.636) (-778.178) (-762.228) [-760.473] * (-763.882) (-774.058) [-758.176] (-778.312) -- 0:02:55
341500 -- (-761.393) [-762.120] (-766.038) (-763.699) * (-761.888) [-756.976] (-755.966) (-766.994) -- 0:02:55
342000 -- (-760.983) (-759.142) [-765.284] (-765.589) * (-769.718) (-765.016) (-764.880) [-761.237] -- 0:02:55
342500 -- (-760.128) (-762.690) [-758.893] (-762.748) * [-761.336] (-765.283) (-766.817) (-760.534) -- 0:02:54
343000 -- [-761.718] (-781.585) (-763.948) (-771.046) * [-757.831] (-765.857) (-765.706) (-767.532) -- 0:02:54
343500 -- [-758.286] (-767.789) (-767.620) (-766.307) * [-761.238] (-768.887) (-753.496) (-755.838) -- 0:02:55
344000 -- (-770.186) [-768.320] (-764.304) (-760.134) * (-765.768) [-764.272] (-754.956) (-760.073) -- 0:02:55
344500 -- (-765.000) (-765.410) [-764.979] (-757.000) * (-765.166) (-768.588) [-753.713] (-770.987) -- 0:02:55
345000 -- (-772.193) (-759.643) [-756.112] (-759.058) * (-763.778) (-774.801) [-754.918] (-763.284) -- 0:02:54
Average standard deviation of split frequencies: 0.018273
345500 -- (-768.921) [-761.735] (-767.622) (-755.892) * (-776.609) (-766.598) (-759.889) [-768.165] -- 0:02:54
346000 -- [-758.994] (-765.840) (-763.879) (-770.161) * (-762.929) [-759.548] (-756.538) (-764.289) -- 0:02:53
346500 -- (-754.637) (-762.701) [-758.238] (-777.421) * (-770.163) (-757.257) [-756.785] (-764.880) -- 0:02:53
347000 -- [-756.596] (-758.431) (-771.884) (-770.567) * (-765.163) (-758.969) (-762.994) [-758.819] -- 0:02:55
347500 -- [-758.551] (-765.598) (-766.970) (-772.307) * [-765.867] (-761.881) (-766.884) (-764.673) -- 0:02:54
348000 -- (-774.520) (-762.097) (-759.631) [-766.670] * (-758.367) (-757.208) (-773.132) [-756.030] -- 0:02:54
348500 -- [-756.722] (-771.480) (-759.242) (-764.314) * (-759.860) (-760.484) (-761.295) [-753.963] -- 0:02:53
349000 -- [-766.897] (-765.226) (-765.446) (-767.997) * (-760.645) (-763.652) [-762.434] (-765.929) -- 0:02:53
349500 -- (-768.803) [-762.472] (-762.348) (-767.149) * (-767.963) (-758.354) [-761.783] (-757.299) -- 0:02:53
350000 -- (-768.313) (-767.252) [-760.370] (-756.528) * [-754.466] (-757.211) (-766.625) (-761.463) -- 0:02:52
Average standard deviation of split frequencies: 0.018109
350500 -- (-766.480) (-770.501) [-756.233] (-763.019) * (-768.291) (-768.243) [-758.611] (-757.791) -- 0:02:52
351000 -- [-761.865] (-757.751) (-761.810) (-773.721) * [-762.326] (-762.207) (-758.280) (-766.115) -- 0:02:53
351500 -- (-759.539) (-761.325) [-765.708] (-768.153) * [-757.035] (-761.022) (-763.856) (-762.311) -- 0:02:53
352000 -- (-770.091) (-766.320) (-758.053) [-760.990] * [-758.762] (-757.880) (-759.197) (-763.551) -- 0:02:53
352500 -- (-767.641) (-768.605) (-765.932) [-758.816] * (-766.450) (-766.892) [-759.351] (-765.031) -- 0:02:52
353000 -- (-765.832) (-775.668) (-759.693) [-762.594] * (-770.116) (-759.658) [-756.780] (-762.004) -- 0:02:52
353500 -- (-766.579) (-766.421) [-755.872] (-762.874) * (-770.294) (-761.362) (-772.954) [-764.085] -- 0:02:51
354000 -- (-777.909) (-767.040) (-761.834) [-758.142] * (-777.202) [-756.594] (-756.822) (-763.413) -- 0:02:51
354500 -- (-758.210) (-767.946) [-752.451] (-757.740) * (-761.259) [-755.989] (-756.093) (-763.161) -- 0:02:52
355000 -- [-759.277] (-779.278) (-757.457) (-764.158) * [-753.516] (-771.803) (-757.491) (-768.557) -- 0:02:52
Average standard deviation of split frequencies: 0.017448
355500 -- [-757.497] (-762.541) (-771.114) (-766.852) * [-758.455] (-760.170) (-769.092) (-775.314) -- 0:02:52
356000 -- (-763.450) (-769.150) (-768.252) [-757.302] * (-759.104) (-753.117) (-766.879) [-761.956] -- 0:02:51
356500 -- (-757.912) (-766.097) (-761.241) [-759.538] * (-767.781) [-755.392] (-762.284) (-762.236) -- 0:02:51
357000 -- (-766.203) (-772.803) [-759.289] (-779.120) * (-762.769) [-766.140] (-760.994) (-762.243) -- 0:02:51
357500 -- (-758.055) [-763.489] (-764.518) (-768.996) * [-762.293] (-766.294) (-770.614) (-760.026) -- 0:02:50
358000 -- (-768.498) (-766.663) [-759.693] (-767.261) * (-762.176) [-761.129] (-771.110) (-763.360) -- 0:02:50
358500 -- [-761.374] (-767.468) (-765.065) (-760.241) * (-770.767) (-774.780) (-766.430) [-758.083] -- 0:02:51
359000 -- [-764.325] (-762.179) (-774.884) (-770.364) * (-769.098) [-766.097] (-774.691) (-761.102) -- 0:02:51
359500 -- (-765.698) (-756.754) (-763.510) [-765.179] * (-760.856) (-763.589) [-760.638] (-769.570) -- 0:02:51
360000 -- [-757.144] (-761.290) (-762.089) (-762.160) * (-766.526) (-766.483) [-756.737] (-772.683) -- 0:02:50
Average standard deviation of split frequencies: 0.017760
360500 -- (-757.980) (-764.121) (-758.972) [-758.227] * (-766.246) [-760.768] (-761.452) (-762.754) -- 0:02:50
361000 -- (-766.819) [-758.982] (-768.864) (-771.030) * (-760.092) (-766.239) (-758.668) [-759.323] -- 0:02:49
361500 -- [-756.637] (-766.941) (-759.417) (-771.031) * (-766.174) (-768.576) (-760.108) [-759.334] -- 0:02:49
362000 -- [-759.464] (-767.671) (-765.765) (-761.771) * (-761.663) (-770.079) (-773.248) [-766.659] -- 0:02:50
362500 -- (-774.706) [-754.443] (-761.556) (-775.795) * (-753.603) [-759.230] (-758.714) (-774.440) -- 0:02:50
363000 -- (-762.008) (-757.837) (-756.438) [-761.298] * (-771.895) (-760.839) [-752.622] (-770.230) -- 0:02:50
363500 -- (-763.300) (-766.270) [-759.044] (-765.982) * (-761.687) [-765.308] (-764.051) (-771.093) -- 0:02:49
364000 -- (-764.776) [-757.757] (-761.446) (-775.163) * (-753.498) [-756.232] (-758.458) (-768.174) -- 0:02:49
364500 -- (-765.200) (-766.038) [-763.622] (-758.452) * [-761.791] (-758.089) (-758.800) (-758.185) -- 0:02:49
365000 -- (-764.239) (-774.100) [-761.023] (-763.936) * [-756.678] (-763.035) (-765.558) (-760.390) -- 0:02:48
Average standard deviation of split frequencies: 0.017577
365500 -- (-772.676) (-759.879) [-763.276] (-758.626) * [-759.393] (-760.042) (-758.326) (-769.336) -- 0:02:48
366000 -- (-769.278) [-760.836] (-769.893) (-759.926) * [-765.852] (-772.603) (-767.489) (-764.375) -- 0:02:49
366500 -- (-760.764) [-767.768] (-761.731) (-764.323) * (-762.708) (-761.100) (-763.702) [-761.016] -- 0:02:49
367000 -- (-766.915) (-769.465) (-764.092) [-757.791] * [-768.934] (-761.933) (-758.659) (-766.275) -- 0:02:49
367500 -- [-761.836] (-755.198) (-761.908) (-767.639) * (-759.045) (-761.582) (-776.509) [-759.200] -- 0:02:48
368000 -- [-755.295] (-760.474) (-767.256) (-763.546) * (-757.571) (-772.568) [-757.659] (-759.769) -- 0:02:48
368500 -- [-754.896] (-762.257) (-758.986) (-755.879) * (-760.302) (-758.852) [-758.015] (-771.318) -- 0:02:47
369000 -- (-760.303) (-759.953) [-762.185] (-755.682) * (-772.129) (-763.855) [-772.212] (-755.750) -- 0:02:47
369500 -- (-752.338) (-766.530) (-761.637) [-756.066] * (-762.041) (-766.519) (-761.911) [-757.810] -- 0:02:48
370000 -- (-759.571) (-757.049) (-784.449) [-761.053] * (-760.253) [-754.367] (-759.299) (-766.626) -- 0:02:48
Average standard deviation of split frequencies: 0.018628
370500 -- (-763.897) (-764.364) [-761.557] (-764.928) * (-760.677) (-761.013) (-757.794) [-764.492] -- 0:02:48
371000 -- (-767.249) [-762.161] (-765.923) (-759.319) * (-768.141) (-771.099) (-757.249) [-762.836] -- 0:02:47
371500 -- [-757.128] (-761.948) (-766.760) (-762.083) * (-760.210) (-763.388) (-766.066) [-764.515] -- 0:02:47
372000 -- (-757.526) [-754.182] (-765.440) (-761.713) * [-761.749] (-757.806) (-755.437) (-765.532) -- 0:02:47
372500 -- (-761.791) [-759.588] (-769.454) (-766.087) * [-763.750] (-761.435) (-764.782) (-764.694) -- 0:02:46
373000 -- (-764.094) (-776.690) (-765.919) [-757.131] * (-759.695) (-767.923) (-772.373) [-765.564] -- 0:02:46
373500 -- [-763.267] (-766.112) (-769.021) (-760.021) * (-759.665) [-759.888] (-769.778) (-767.916) -- 0:02:47
374000 -- (-760.032) (-768.674) [-773.012] (-763.004) * [-760.347] (-758.103) (-762.090) (-761.942) -- 0:02:47
374500 -- [-770.307] (-759.039) (-764.443) (-766.093) * [-758.058] (-763.463) (-756.471) (-759.386) -- 0:02:47
375000 -- (-767.616) (-770.208) [-768.158] (-762.216) * (-759.591) (-771.440) [-755.902] (-770.551) -- 0:02:46
Average standard deviation of split frequencies: 0.018290
375500 -- (-771.348) [-761.330] (-767.085) (-767.867) * (-760.092) (-753.843) [-755.231] (-769.792) -- 0:02:46
376000 -- (-758.334) (-774.009) (-766.759) [-757.011] * [-757.500] (-762.767) (-758.673) (-763.722) -- 0:02:45
376500 -- [-765.040] (-769.037) (-765.919) (-768.168) * (-759.963) (-764.945) [-758.816] (-756.261) -- 0:02:45
377000 -- (-764.898) (-757.563) (-762.862) [-762.661] * (-766.824) (-759.339) (-763.367) [-764.675] -- 0:02:46
377500 -- (-759.048) [-751.920] (-762.506) (-756.679) * (-759.584) (-759.038) (-764.516) [-764.229] -- 0:02:46
378000 -- (-764.959) (-768.553) [-761.748] (-753.364) * (-760.254) [-755.339] (-764.751) (-770.712) -- 0:02:46
378500 -- [-755.473] (-763.825) (-756.024) (-764.001) * (-764.146) (-763.222) [-759.081] (-763.974) -- 0:02:45
379000 -- [-764.002] (-766.767) (-759.374) (-761.599) * (-769.625) (-761.457) (-769.139) [-758.609] -- 0:02:45
379500 -- (-755.874) (-753.425) [-775.110] (-771.967) * (-761.287) [-756.048] (-762.353) (-760.185) -- 0:02:45
380000 -- (-764.198) [-767.171] (-760.338) (-763.932) * (-760.900) (-773.355) [-761.454] (-762.948) -- 0:02:44
Average standard deviation of split frequencies: 0.017993
380500 -- (-759.162) (-767.239) [-758.995] (-762.325) * [-754.299] (-769.542) (-762.270) (-767.311) -- 0:02:46
381000 -- [-761.386] (-763.162) (-760.292) (-757.362) * [-765.864] (-770.054) (-763.162) (-772.117) -- 0:02:45
381500 -- (-761.204) (-759.923) [-761.983] (-758.661) * (-767.302) (-765.966) [-759.248] (-760.499) -- 0:02:45
382000 -- (-761.742) (-761.186) [-759.208] (-762.333) * [-758.540] (-768.844) (-771.522) (-764.224) -- 0:02:45
382500 -- (-764.317) (-763.814) (-760.986) [-756.039] * (-772.818) [-762.837] (-768.980) (-758.672) -- 0:02:44
383000 -- (-766.195) [-751.453] (-762.512) (-754.853) * (-765.367) (-756.078) [-770.935] (-762.604) -- 0:02:44
383500 -- (-767.969) [-757.842] (-764.413) (-763.056) * (-767.541) (-760.338) (-764.635) [-762.729] -- 0:02:43
384000 -- (-761.415) [-762.261] (-764.602) (-763.122) * (-753.171) [-756.060] (-757.065) (-760.477) -- 0:02:43
384500 -- [-760.761] (-764.249) (-770.946) (-759.253) * (-758.465) (-767.199) (-771.228) [-753.208] -- 0:02:44
385000 -- (-756.349) [-764.680] (-772.916) (-767.115) * (-763.789) [-755.724] (-764.075) (-760.820) -- 0:02:44
Average standard deviation of split frequencies: 0.018103
385500 -- (-760.669) (-763.282) (-767.729) [-756.008] * (-756.211) (-762.810) (-772.617) [-759.711] -- 0:02:44
386000 -- (-762.116) (-765.420) [-758.531] (-760.781) * (-763.453) (-759.089) (-757.178) [-762.302] -- 0:02:43
386500 -- (-770.441) (-762.276) (-759.656) [-753.495] * (-768.472) [-762.158] (-773.343) (-760.582) -- 0:02:43
387000 -- (-759.087) [-761.396] (-767.547) (-755.249) * (-764.220) (-759.646) (-768.613) [-760.431] -- 0:02:43
387500 -- [-763.719] (-757.033) (-762.447) (-764.348) * [-752.219] (-766.224) (-776.009) (-765.975) -- 0:02:42
388000 -- (-763.498) [-756.590] (-766.005) (-759.551) * (-761.016) [-768.498] (-771.250) (-772.850) -- 0:02:44
388500 -- (-764.630) [-759.548] (-757.801) (-759.602) * (-766.954) (-758.193) (-774.117) [-759.207] -- 0:02:43
389000 -- (-759.439) (-757.900) [-757.495] (-767.856) * (-763.602) (-760.010) (-774.986) [-763.002] -- 0:02:43
389500 -- (-760.153) (-770.106) (-758.743) [-758.742] * (-759.389) (-773.101) (-777.947) [-756.993] -- 0:02:43
390000 -- (-764.220) (-763.647) (-752.711) [-761.026] * (-755.045) (-763.259) (-765.795) [-754.251] -- 0:02:42
Average standard deviation of split frequencies: 0.017603
390500 -- (-767.042) (-767.835) (-764.603) [-759.559] * (-765.079) (-763.260) (-765.104) [-757.015] -- 0:02:42
391000 -- (-757.481) [-764.010] (-765.046) (-761.589) * (-761.978) (-766.659) (-761.424) [-763.548] -- 0:02:41
391500 -- (-762.562) (-779.450) (-760.163) [-759.247] * (-757.294) (-767.284) (-763.790) [-759.159] -- 0:02:41
392000 -- [-759.691] (-766.479) (-763.432) (-758.816) * (-756.572) (-773.267) (-773.825) [-761.657] -- 0:02:42
392500 -- (-759.996) (-752.999) [-761.007] (-762.893) * (-769.648) (-762.509) (-765.198) [-759.230] -- 0:02:42
393000 -- (-762.051) [-760.506] (-767.529) (-772.348) * (-761.186) [-762.392] (-761.601) (-760.940) -- 0:02:42
393500 -- (-761.298) [-766.562] (-770.810) (-762.290) * (-768.238) (-758.995) [-754.776] (-764.119) -- 0:02:41
394000 -- (-756.670) (-762.790) [-760.557] (-773.812) * [-756.877] (-764.103) (-763.392) (-762.878) -- 0:02:41
394500 -- (-756.813) [-759.270] (-769.859) (-771.487) * (-760.340) [-765.378] (-764.878) (-756.057) -- 0:02:41
395000 -- (-760.543) (-763.987) (-764.071) [-757.303] * (-766.199) (-758.145) (-769.601) [-760.066] -- 0:02:40
Average standard deviation of split frequencies: 0.017296
395500 -- (-761.056) [-765.948] (-765.735) (-762.952) * (-772.719) [-754.404] (-764.640) (-764.860) -- 0:02:42
396000 -- (-775.527) (-765.579) (-777.179) [-755.454] * (-765.216) (-767.529) (-755.238) [-755.178] -- 0:02:41
396500 -- (-768.228) (-761.292) (-764.314) [-765.174] * (-762.474) [-768.102] (-767.172) (-757.789) -- 0:02:41
397000 -- (-771.798) (-757.566) [-760.721] (-769.310) * (-773.039) [-755.630] (-760.434) (-763.220) -- 0:02:41
397500 -- (-754.874) [-754.922] (-755.935) (-768.026) * (-765.700) [-758.485] (-759.268) (-761.022) -- 0:02:40
398000 -- [-760.296] (-758.288) (-756.137) (-767.772) * (-756.881) [-762.161] (-753.037) (-765.181) -- 0:02:40
398500 -- (-762.872) (-764.866) (-764.255) [-762.166] * [-756.520] (-763.496) (-766.074) (-763.954) -- 0:02:39
399000 -- [-754.335] (-771.986) (-761.787) (-770.213) * (-759.781) (-770.917) [-757.093] (-753.383) -- 0:02:39
399500 -- [-757.798] (-771.920) (-759.293) (-760.248) * [-753.979] (-765.099) (-766.277) (-765.020) -- 0:02:40
400000 -- (-759.778) (-761.650) [-757.470] (-764.139) * (-765.546) (-761.579) [-765.139] (-761.567) -- 0:02:40
Average standard deviation of split frequencies: 0.016749
400500 -- (-787.183) (-762.623) (-759.754) [-759.843] * (-760.118) (-764.488) [-760.162] (-768.881) -- 0:02:40
401000 -- (-763.816) (-766.617) (-763.773) [-764.157] * (-761.505) (-762.057) [-758.530] (-766.763) -- 0:02:39
401500 -- (-754.826) (-760.132) (-756.946) [-759.020] * (-768.846) (-768.829) [-758.612] (-765.453) -- 0:02:39
402000 -- (-760.712) (-759.145) (-765.732) [-755.025] * (-762.636) (-764.724) (-769.273) [-759.538] -- 0:02:39
402500 -- (-766.955) [-760.255] (-761.698) (-763.299) * (-770.169) [-762.139] (-757.727) (-760.586) -- 0:02:38
403000 -- (-756.333) [-766.088] (-755.100) (-761.475) * [-763.013] (-764.993) (-764.303) (-758.492) -- 0:02:39
403500 -- [-766.864] (-764.128) (-766.783) (-767.431) * (-760.585) [-763.482] (-776.828) (-761.989) -- 0:02:39
404000 -- (-766.770) [-766.720] (-764.602) (-773.333) * (-770.821) (-771.560) [-763.722] (-771.965) -- 0:02:39
404500 -- (-764.389) (-762.434) (-768.554) [-766.838] * (-761.776) [-758.539] (-761.588) (-781.072) -- 0:02:38
405000 -- (-772.171) [-757.315] (-763.005) (-763.736) * [-755.383] (-764.418) (-767.527) (-779.903) -- 0:02:38
Average standard deviation of split frequencies: 0.017280
405500 -- (-762.636) (-755.190) (-770.895) [-760.552] * (-765.747) [-758.038] (-778.133) (-764.064) -- 0:02:38
406000 -- [-761.600] (-758.760) (-760.452) (-761.689) * (-755.393) (-764.418) [-763.282] (-769.322) -- 0:02:38
406500 -- (-761.405) [-758.394] (-766.000) (-771.279) * (-773.606) (-765.164) [-761.634] (-764.568) -- 0:02:39
407000 -- [-752.380] (-761.982) (-760.012) (-769.980) * [-761.892] (-761.404) (-766.222) (-772.994) -- 0:02:38
407500 -- [-757.110] (-767.592) (-758.704) (-765.018) * (-761.844) (-759.788) [-761.278] (-761.108) -- 0:02:38
408000 -- [-757.836] (-772.183) (-764.392) (-766.034) * [-757.345] (-763.393) (-772.244) (-760.185) -- 0:02:38
408500 -- (-755.958) [-753.209] (-752.336) (-764.288) * (-766.326) (-760.897) [-755.980] (-777.888) -- 0:02:37
409000 -- (-758.653) [-753.812] (-762.608) (-756.298) * (-760.224) (-761.249) (-761.419) [-767.783] -- 0:02:37
409500 -- (-759.994) (-765.946) [-763.806] (-762.801) * (-762.246) (-763.372) [-759.564] (-767.383) -- 0:02:37
410000 -- (-762.828) (-762.102) [-758.716] (-764.777) * (-767.060) (-759.349) [-764.956] (-765.812) -- 0:02:36
Average standard deviation of split frequencies: 0.017286
410500 -- (-778.402) (-757.261) (-755.469) [-757.616] * [-765.639] (-758.443) (-768.738) (-763.213) -- 0:02:37
411000 -- (-755.245) (-760.728) [-756.298] (-765.121) * [-760.896] (-765.452) (-757.246) (-762.729) -- 0:02:37
411500 -- (-760.665) [-766.230] (-764.783) (-759.070) * [-763.706] (-764.941) (-755.907) (-756.431) -- 0:02:37
412000 -- (-760.456) [-752.139] (-773.724) (-763.913) * (-754.974) [-763.192] (-765.472) (-758.721) -- 0:02:36
412500 -- (-777.091) [-762.366] (-760.638) (-765.036) * (-761.164) (-759.510) [-756.314] (-761.019) -- 0:02:36
413000 -- (-760.194) (-759.480) [-765.460] (-767.097) * (-764.210) (-758.866) [-753.769] (-770.626) -- 0:02:36
413500 -- (-761.860) (-766.129) (-763.251) [-765.274] * [-761.495] (-767.094) (-757.239) (-763.588) -- 0:02:36
414000 -- [-758.262] (-768.588) (-760.140) (-756.390) * (-757.533) [-767.991] (-763.692) (-768.737) -- 0:02:37
414500 -- [-765.234] (-762.297) (-762.997) (-762.571) * (-760.226) (-766.940) (-763.972) [-759.835] -- 0:02:36
415000 -- (-767.727) (-759.412) (-769.722) [-761.952] * (-770.298) (-777.615) (-751.408) [-762.826] -- 0:02:36
Average standard deviation of split frequencies: 0.017598
415500 -- [-768.055] (-763.158) (-782.588) (-767.614) * (-760.431) [-764.961] (-759.717) (-775.640) -- 0:02:36
416000 -- (-756.982) (-766.082) (-766.880) [-763.841] * (-763.025) (-774.766) [-755.059] (-764.897) -- 0:02:35
416500 -- [-754.607] (-761.536) (-765.161) (-764.800) * (-760.989) (-762.100) (-759.732) [-755.199] -- 0:02:35
417000 -- (-762.861) (-770.669) (-763.779) [-764.602] * (-760.093) (-757.442) [-762.759] (-759.671) -- 0:02:35
417500 -- (-759.148) [-760.698] (-757.482) (-768.119) * (-765.594) (-758.963) [-760.104] (-772.583) -- 0:02:36
418000 -- [-755.590] (-760.825) (-764.397) (-761.123) * [-757.731] (-755.221) (-754.962) (-761.735) -- 0:02:35
418500 -- (-763.012) (-761.168) [-763.193] (-762.568) * (-773.063) [-765.917] (-766.318) (-769.829) -- 0:02:35
419000 -- (-754.541) [-759.127] (-758.807) (-770.939) * [-762.423] (-764.345) (-768.539) (-784.300) -- 0:02:35
419500 -- (-762.517) [-762.318] (-769.845) (-771.123) * [-753.949] (-771.111) (-757.349) (-770.503) -- 0:02:34
420000 -- [-762.154] (-760.232) (-763.752) (-766.555) * [-756.906] (-756.992) (-761.906) (-764.458) -- 0:02:34
Average standard deviation of split frequencies: 0.016743
420500 -- (-765.872) (-762.269) [-763.338] (-766.452) * (-763.051) [-757.358] (-754.151) (-775.115) -- 0:02:34
421000 -- (-772.062) (-764.175) (-766.546) [-752.956] * (-761.091) (-755.492) [-752.204] (-767.294) -- 0:02:35
421500 -- [-758.002] (-763.657) (-760.585) (-765.596) * (-767.211) (-760.697) [-760.102] (-766.727) -- 0:02:35
422000 -- (-768.737) [-761.591] (-766.148) (-753.736) * (-762.283) [-760.003] (-762.079) (-768.434) -- 0:02:34
422500 -- (-765.187) [-755.959] (-775.794) (-760.895) * (-769.615) [-759.677] (-759.572) (-769.454) -- 0:02:34
423000 -- (-764.617) [-757.574] (-769.459) (-765.118) * (-769.031) [-755.354] (-759.443) (-765.859) -- 0:02:34
423500 -- (-768.022) (-762.934) [-761.478] (-760.676) * (-763.816) [-757.879] (-765.697) (-765.563) -- 0:02:33
424000 -- (-772.954) (-765.099) [-759.700] (-769.933) * [-765.636] (-775.164) (-762.010) (-765.896) -- 0:02:33
424500 -- (-762.398) [-759.449] (-769.102) (-764.126) * [-756.261] (-760.282) (-771.150) (-765.897) -- 0:02:33
425000 -- (-763.825) [-756.928] (-768.350) (-761.386) * (-765.142) [-754.798] (-758.835) (-767.478) -- 0:02:34
Average standard deviation of split frequencies: 0.015753
425500 -- (-769.492) (-756.830) (-768.123) [-765.929] * (-765.169) (-765.544) (-762.104) [-760.841] -- 0:02:33
426000 -- (-775.018) (-766.484) (-760.434) [-761.123] * (-774.731) (-766.898) [-762.714] (-762.999) -- 0:02:33
426500 -- (-760.539) (-762.287) [-752.280] (-758.174) * (-760.572) (-756.346) (-764.814) [-766.861] -- 0:02:33
427000 -- [-758.005] (-757.352) (-771.648) (-755.889) * (-762.050) [-760.724] (-761.656) (-762.427) -- 0:02:32
427500 -- (-756.838) (-772.246) [-761.392] (-758.067) * (-763.159) (-763.513) [-759.752] (-761.519) -- 0:02:32
428000 -- (-759.092) (-771.917) (-762.337) [-758.759] * (-758.108) [-762.221] (-767.661) (-761.185) -- 0:02:32
428500 -- (-762.543) (-759.918) (-756.772) [-755.372] * (-761.231) (-764.057) [-761.492] (-767.417) -- 0:02:33
429000 -- [-761.995] (-771.060) (-760.803) (-760.644) * (-759.446) (-758.451) (-765.618) [-767.083] -- 0:02:33
429500 -- (-764.027) (-766.940) (-766.140) [-756.934] * (-759.710) [-766.592] (-756.427) (-758.452) -- 0:02:32
430000 -- (-768.872) [-765.205] (-763.560) (-766.479) * (-755.619) (-765.446) (-757.070) [-756.438] -- 0:02:32
Average standard deviation of split frequencies: 0.015904
430500 -- [-756.555] (-757.956) (-760.630) (-766.073) * (-765.380) (-764.700) (-755.353) [-757.309] -- 0:02:32
431000 -- (-765.458) (-762.621) (-772.951) [-762.498] * (-751.793) (-761.751) [-762.158] (-758.226) -- 0:02:31
431500 -- (-766.987) (-768.464) (-766.452) [-758.270] * (-760.888) (-762.767) (-767.191) [-753.688] -- 0:02:31
432000 -- (-777.649) (-763.121) (-756.536) [-763.398] * (-758.830) (-772.984) (-758.273) [-750.987] -- 0:02:31
432500 -- [-763.812] (-768.716) (-756.903) (-760.470) * (-766.392) (-761.915) [-759.217] (-758.117) -- 0:02:32
433000 -- (-767.387) (-772.265) [-761.380] (-759.503) * [-757.533] (-767.613) (-776.358) (-768.036) -- 0:02:31
433500 -- (-772.412) [-763.433] (-764.973) (-767.275) * [-758.165] (-762.019) (-766.048) (-758.892) -- 0:02:31
434000 -- (-761.403) [-763.688] (-767.456) (-763.375) * (-758.179) (-764.327) (-773.691) [-763.042] -- 0:02:31
434500 -- (-762.878) [-764.234] (-773.094) (-765.056) * [-760.357] (-775.476) (-766.176) (-764.856) -- 0:02:30
435000 -- [-758.057] (-777.573) (-762.141) (-763.867) * [-765.312] (-765.904) (-758.315) (-754.827) -- 0:02:30
Average standard deviation of split frequencies: 0.013865
435500 -- (-761.514) [-755.744] (-768.489) (-770.773) * [-756.606] (-761.718) (-757.684) (-758.168) -- 0:02:30
436000 -- [-761.280] (-757.826) (-766.890) (-763.970) * (-760.979) (-766.312) (-760.326) [-761.674] -- 0:02:31
436500 -- [-758.482] (-764.111) (-759.689) (-760.402) * (-757.471) [-760.104] (-764.842) (-763.986) -- 0:02:31
437000 -- [-759.975] (-763.304) (-765.113) (-754.613) * (-758.425) (-758.195) (-770.246) [-760.556] -- 0:02:30
437500 -- [-768.561] (-770.722) (-761.389) (-766.212) * [-764.870] (-767.653) (-761.969) (-761.749) -- 0:02:30
438000 -- (-771.514) (-759.773) [-766.242] (-766.793) * (-760.296) (-761.634) [-760.089] (-764.762) -- 0:02:30
438500 -- (-771.469) (-758.316) [-755.482] (-759.662) * (-753.634) (-768.665) (-762.627) [-759.970] -- 0:02:29
439000 -- [-762.365] (-766.264) (-760.145) (-763.084) * [-749.686] (-763.297) (-763.846) (-760.241) -- 0:02:29
439500 -- (-761.144) (-759.407) (-761.197) [-756.074] * (-753.458) (-775.045) [-760.695] (-759.969) -- 0:02:29
440000 -- (-761.175) [-753.895] (-772.939) (-766.380) * (-755.853) (-767.723) (-762.239) [-763.095] -- 0:02:30
Average standard deviation of split frequencies: 0.014096
440500 -- (-759.946) (-764.646) (-759.136) [-761.466] * [-759.607] (-774.611) (-765.388) (-762.698) -- 0:02:29
441000 -- (-773.968) [-765.720] (-765.243) (-761.227) * (-760.076) (-775.106) (-762.956) [-761.370] -- 0:02:29
441500 -- [-762.297] (-767.424) (-764.393) (-760.364) * [-758.658] (-763.165) (-770.049) (-756.789) -- 0:02:29
442000 -- (-764.340) (-771.012) [-766.458] (-763.905) * (-757.883) (-760.029) (-762.806) [-755.329] -- 0:02:28
442500 -- [-759.099] (-758.282) (-772.372) (-764.106) * (-762.270) (-767.067) (-764.856) [-756.812] -- 0:02:28
443000 -- (-755.254) (-761.065) (-771.912) [-753.203] * (-760.620) (-758.810) (-759.611) [-752.947] -- 0:02:28
443500 -- [-751.419] (-765.694) (-762.067) (-758.925) * [-764.264] (-758.164) (-765.315) (-781.292) -- 0:02:29
444000 -- (-757.278) [-758.552] (-767.048) (-756.865) * (-756.544) [-758.761] (-766.706) (-763.570) -- 0:02:29
444500 -- (-772.570) (-770.459) [-760.513] (-758.110) * (-759.299) (-766.058) [-761.877] (-764.361) -- 0:02:28
445000 -- (-760.321) [-761.728] (-764.423) (-771.845) * (-757.383) (-761.932) (-764.468) [-767.092] -- 0:02:28
Average standard deviation of split frequencies: 0.012746
445500 -- [-760.637] (-762.859) (-772.028) (-757.186) * (-760.394) (-760.724) [-762.614] (-767.551) -- 0:02:28
446000 -- [-757.934] (-767.227) (-763.872) (-761.912) * [-757.669] (-759.418) (-776.269) (-768.178) -- 0:02:27
446500 -- (-772.084) [-758.786] (-770.671) (-760.813) * (-760.522) [-760.796] (-768.310) (-764.594) -- 0:02:27
447000 -- (-767.995) (-753.514) [-758.343] (-763.864) * (-766.470) [-759.654] (-762.869) (-766.226) -- 0:02:27
447500 -- (-763.491) (-756.258) [-763.934] (-762.642) * [-763.595] (-771.191) (-759.474) (-773.821) -- 0:02:28
448000 -- (-753.093) [-758.428] (-771.695) (-759.331) * (-768.031) [-756.839] (-765.459) (-772.749) -- 0:02:27
448500 -- (-769.936) [-758.908] (-768.128) (-751.664) * (-762.619) (-757.915) [-764.574] (-766.112) -- 0:02:27
449000 -- (-764.444) (-771.368) [-755.926] (-764.703) * (-759.912) [-759.728] (-775.991) (-761.578) -- 0:02:27
449500 -- (-761.228) (-756.824) (-759.848) [-762.656] * [-758.368] (-758.888) (-761.674) (-759.092) -- 0:02:26
450000 -- [-760.632] (-766.190) (-773.566) (-764.685) * (-770.152) (-761.686) [-766.468] (-750.409) -- 0:02:26
Average standard deviation of split frequencies: 0.013167
450500 -- (-761.479) (-757.172) (-772.013) [-762.433] * (-764.524) [-762.299] (-761.886) (-763.877) -- 0:02:26
451000 -- (-763.700) (-762.077) (-758.926) [-758.473] * [-757.938] (-765.239) (-764.972) (-758.929) -- 0:02:27
451500 -- (-761.619) (-767.127) (-760.354) [-759.882] * (-767.384) (-760.837) [-753.618] (-761.253) -- 0:02:26
452000 -- (-758.410) (-764.621) [-764.140] (-755.936) * [-760.719] (-777.463) (-758.892) (-765.822) -- 0:02:26
452500 -- (-770.938) (-763.617) [-764.460] (-766.790) * (-765.002) (-760.236) [-759.614] (-766.245) -- 0:02:26
453000 -- (-754.877) (-762.581) [-773.320] (-768.980) * (-772.747) [-762.122] (-766.023) (-766.512) -- 0:02:26
453500 -- [-753.089] (-766.666) (-767.546) (-758.409) * [-756.103] (-759.684) (-769.510) (-764.288) -- 0:02:25
454000 -- (-764.079) (-761.447) (-760.046) [-754.585] * (-761.473) [-753.529] (-767.472) (-775.202) -- 0:02:25
454500 -- (-770.144) [-761.383] (-769.296) (-760.038) * (-761.277) [-754.427] (-762.159) (-759.015) -- 0:02:25
455000 -- [-761.552] (-758.958) (-764.879) (-770.899) * [-756.059] (-762.844) (-772.448) (-759.483) -- 0:02:26
Average standard deviation of split frequencies: 0.012709
455500 -- [-754.861] (-766.841) (-764.354) (-775.680) * (-764.503) [-758.194] (-767.898) (-758.256) -- 0:02:25
456000 -- [-764.608] (-761.753) (-763.680) (-769.492) * (-762.839) (-773.829) [-760.967] (-760.761) -- 0:02:25
456500 -- [-765.354] (-757.892) (-762.052) (-781.503) * (-762.695) (-771.965) (-759.755) [-757.087] -- 0:02:25
457000 -- (-759.613) [-761.599] (-761.080) (-769.456) * (-762.036) [-756.953] (-759.266) (-767.115) -- 0:02:24
457500 -- (-760.367) (-767.256) (-761.212) [-767.634] * (-771.901) (-754.052) [-764.008] (-770.125) -- 0:02:24
458000 -- (-767.955) (-761.445) [-760.605] (-765.112) * [-763.097] (-763.076) (-760.081) (-765.769) -- 0:02:24
458500 -- (-765.702) [-755.044] (-759.725) (-769.419) * [-756.953] (-765.648) (-763.471) (-784.487) -- 0:02:25
459000 -- (-760.763) [-761.072] (-769.715) (-774.862) * (-765.797) (-769.559) [-761.737] (-780.269) -- 0:02:24
459500 -- (-756.718) [-765.529] (-762.387) (-770.531) * [-763.092] (-761.204) (-769.343) (-763.292) -- 0:02:24
460000 -- (-763.806) (-760.488) [-757.355] (-767.912) * (-756.325) (-757.252) (-758.478) [-760.888] -- 0:02:24
Average standard deviation of split frequencies: 0.012280
460500 -- [-757.569] (-767.908) (-768.026) (-768.003) * (-756.524) (-763.917) (-758.536) [-764.501] -- 0:02:24
461000 -- [-758.129] (-770.111) (-765.569) (-757.092) * (-763.500) (-771.023) (-765.302) [-765.451] -- 0:02:23
461500 -- (-762.403) (-768.343) (-765.019) [-756.930] * (-760.975) [-762.580] (-764.411) (-755.955) -- 0:02:23
462000 -- (-767.651) (-763.760) (-761.698) [-767.104] * (-766.985) [-770.574] (-755.547) (-766.664) -- 0:02:23
462500 -- [-754.937] (-770.147) (-764.951) (-768.392) * (-772.818) (-766.226) [-760.610] (-756.429) -- 0:02:24
463000 -- (-761.251) [-762.226] (-757.083) (-770.267) * [-762.049] (-774.050) (-762.217) (-765.344) -- 0:02:23
463500 -- (-755.041) [-759.774] (-761.915) (-760.887) * (-765.050) (-767.458) [-758.663] (-767.954) -- 0:02:23
464000 -- (-758.175) (-770.803) [-758.882] (-758.324) * [-769.494] (-756.323) (-768.965) (-763.261) -- 0:02:23
464500 -- [-757.431] (-767.176) (-766.394) (-758.082) * (-761.071) (-757.309) (-761.322) [-755.927] -- 0:02:22
465000 -- (-776.351) [-765.451] (-763.091) (-761.133) * (-764.965) (-760.063) (-756.844) [-758.034] -- 0:02:22
Average standard deviation of split frequencies: 0.011842
465500 -- (-768.467) (-758.730) [-754.797] (-761.745) * (-774.782) [-767.053] (-761.974) (-771.001) -- 0:02:22
466000 -- (-758.549) (-770.050) [-755.788] (-771.383) * (-767.497) (-774.797) [-763.112] (-760.178) -- 0:02:22
466500 -- (-755.299) [-763.270] (-761.616) (-762.146) * (-771.493) (-760.194) [-761.045] (-764.040) -- 0:02:22
467000 -- [-762.335] (-757.512) (-772.519) (-764.874) * (-771.756) (-766.784) (-766.100) [-756.514] -- 0:02:22
467500 -- (-759.268) (-765.195) [-758.055] (-769.285) * (-777.493) (-765.375) (-771.128) [-754.599] -- 0:02:22
468000 -- [-761.965] (-766.340) (-764.570) (-760.659) * [-769.423] (-767.538) (-764.469) (-762.359) -- 0:02:22
468500 -- (-763.217) (-766.850) [-761.388] (-754.720) * (-760.499) (-759.354) (-771.680) [-761.134] -- 0:02:21
469000 -- (-757.992) (-757.672) (-761.742) [-770.726] * [-765.792] (-762.497) (-764.744) (-762.865) -- 0:02:21
469500 -- (-770.862) [-770.235] (-766.712) (-763.171) * (-766.062) (-769.070) (-767.524) [-762.075] -- 0:02:21
470000 -- (-772.417) [-762.155] (-763.912) (-764.024) * (-770.539) (-759.656) (-765.729) [-756.322] -- 0:02:22
Average standard deviation of split frequencies: 0.012431
470500 -- [-761.474] (-764.076) (-760.411) (-772.767) * (-773.421) (-766.659) (-762.425) [-762.277] -- 0:02:21
471000 -- (-761.455) (-759.046) [-759.829] (-767.286) * (-759.958) (-760.116) [-758.050] (-780.703) -- 0:02:21
471500 -- (-760.915) (-756.418) (-762.695) [-764.639] * (-756.202) (-775.907) (-760.972) [-759.592] -- 0:02:21
472000 -- (-766.500) (-763.657) [-753.345] (-763.560) * (-770.511) (-764.917) [-760.301] (-769.221) -- 0:02:20
472500 -- (-756.238) (-773.577) (-760.846) [-757.636] * (-766.010) (-772.600) [-761.900] (-752.827) -- 0:02:20
473000 -- (-762.424) [-768.681] (-761.177) (-757.833) * (-762.910) (-766.039) [-765.364] (-757.755) -- 0:02:20
473500 -- [-763.830] (-764.499) (-766.250) (-758.009) * [-769.034] (-777.093) (-769.187) (-759.839) -- 0:02:20
474000 -- [-754.218] (-760.385) (-773.007) (-754.631) * (-763.635) (-764.420) (-771.588) [-762.090] -- 0:02:20
474500 -- [-760.412] (-765.453) (-775.384) (-757.643) * (-762.626) (-760.294) [-759.495] (-760.688) -- 0:02:20
475000 -- (-767.043) (-771.324) [-758.460] (-758.378) * (-766.677) (-762.321) (-771.716) [-757.761] -- 0:02:20
Average standard deviation of split frequencies: 0.013166
475500 -- (-765.610) (-763.655) (-767.349) [-758.331] * (-759.519) [-753.172] (-767.486) (-763.101) -- 0:02:20
476000 -- (-771.172) [-763.642] (-767.731) (-763.749) * (-762.139) [-755.540] (-758.888) (-759.608) -- 0:02:19
476500 -- (-762.529) [-762.871] (-773.505) (-754.075) * (-771.526) (-766.975) [-763.904] (-767.785) -- 0:02:19
477000 -- (-768.596) (-757.975) [-759.607] (-754.165) * (-769.170) [-758.760] (-757.269) (-759.673) -- 0:02:19
477500 -- (-766.224) (-761.165) (-754.204) [-760.907] * (-763.757) (-768.813) [-761.591] (-765.520) -- 0:02:18
478000 -- (-761.197) (-763.186) [-756.677] (-758.189) * [-763.864] (-770.817) (-762.008) (-762.830) -- 0:02:19
478500 -- (-775.971) [-760.749] (-761.057) (-766.928) * (-762.560) (-765.548) [-760.132] (-759.828) -- 0:02:19
479000 -- (-758.752) [-755.795] (-754.208) (-764.720) * (-772.255) (-755.622) [-761.198] (-760.222) -- 0:02:19
479500 -- [-761.894] (-766.989) (-759.617) (-770.603) * (-763.144) [-759.920] (-759.708) (-757.481) -- 0:02:18
480000 -- (-778.196) (-763.041) (-758.269) [-757.792] * (-767.871) (-770.323) [-760.848] (-777.328) -- 0:02:18
Average standard deviation of split frequencies: 0.013615
480500 -- (-768.821) [-761.388] (-756.451) (-772.670) * (-764.641) (-763.685) (-760.439) [-759.469] -- 0:02:18
481000 -- (-762.740) [-762.649] (-766.970) (-756.858) * (-770.217) [-756.277] (-760.956) (-766.466) -- 0:02:18
481500 -- [-759.705] (-766.027) (-766.582) (-766.783) * (-769.216) [-760.106] (-761.453) (-757.413) -- 0:02:18
482000 -- (-764.251) [-758.069] (-751.392) (-762.262) * [-763.359] (-762.786) (-757.226) (-766.999) -- 0:02:18
482500 -- (-771.544) [-762.848] (-770.104) (-756.967) * (-760.317) (-757.581) [-761.295] (-771.065) -- 0:02:18
483000 -- (-768.589) [-764.495] (-767.248) (-763.588) * (-759.865) [-757.761] (-770.254) (-761.809) -- 0:02:18
483500 -- (-765.820) (-771.275) (-762.765) [-761.711] * (-766.234) (-760.956) [-762.312] (-774.895) -- 0:02:17
484000 -- (-764.645) (-761.119) (-763.126) [-752.888] * [-756.653] (-769.104) (-764.991) (-758.306) -- 0:02:17
484500 -- (-767.627) (-774.488) [-754.575] (-759.323) * (-754.725) [-762.663] (-756.956) (-756.367) -- 0:02:17
485000 -- (-774.823) (-769.346) [-758.778] (-761.102) * [-766.893] (-757.379) (-761.146) (-770.901) -- 0:02:16
Average standard deviation of split frequencies: 0.013751
485500 -- (-764.277) [-753.392] (-755.422) (-761.030) * (-762.844) (-764.766) (-775.462) [-763.643] -- 0:02:17
486000 -- [-757.205] (-754.255) (-755.529) (-762.326) * (-761.682) [-758.631] (-773.832) (-761.339) -- 0:02:17
486500 -- (-770.864) (-762.134) (-775.679) [-760.327] * (-763.682) (-761.129) (-768.165) [-756.286] -- 0:02:17
487000 -- [-760.311] (-761.113) (-777.176) (-761.693) * (-765.046) [-757.089] (-763.251) (-765.209) -- 0:02:16
487500 -- [-758.721] (-763.832) (-760.000) (-767.538) * (-778.577) (-757.212) (-762.032) [-759.808] -- 0:02:16
488000 -- (-771.019) (-761.573) [-760.116] (-759.259) * (-770.480) (-768.102) (-757.615) [-764.490] -- 0:02:16
488500 -- (-766.129) (-759.440) [-770.920] (-766.491) * (-765.195) [-758.993] (-755.804) (-761.201) -- 0:02:16
489000 -- (-758.967) [-756.125] (-759.961) (-766.512) * (-767.562) (-758.482) (-751.686) [-761.308] -- 0:02:15
489500 -- (-769.231) (-761.442) [-760.241] (-764.395) * (-767.216) [-761.577] (-769.118) (-754.433) -- 0:02:16
490000 -- [-751.847] (-765.100) (-758.576) (-761.777) * (-763.400) (-770.555) (-766.928) [-758.481] -- 0:02:16
Average standard deviation of split frequencies: 0.013733
490500 -- (-759.191) (-768.388) (-763.188) [-756.308] * (-762.275) (-764.303) (-763.681) [-759.128] -- 0:02:16
491000 -- (-773.409) (-768.143) (-758.572) [-753.116] * (-761.928) (-770.609) (-759.633) [-756.441] -- 0:02:15
491500 -- [-769.016] (-760.539) (-762.185) (-756.171) * [-764.356] (-768.617) (-761.103) (-763.360) -- 0:02:15
492000 -- (-766.043) (-756.824) (-764.724) [-759.341] * [-756.961] (-768.274) (-760.240) (-757.539) -- 0:02:15
492500 -- (-760.301) (-762.350) (-775.122) [-762.131] * [-759.936] (-768.741) (-761.550) (-757.300) -- 0:02:14
493000 -- (-760.189) (-759.517) (-769.771) [-757.092] * (-764.827) (-769.366) (-770.486) [-763.846] -- 0:02:15
493500 -- (-758.544) (-770.347) (-758.461) [-758.073] * (-764.429) (-760.900) [-767.463] (-758.916) -- 0:02:15
494000 -- (-768.183) (-763.096) (-769.999) [-767.813] * (-763.596) (-756.828) [-759.346] (-768.496) -- 0:02:15
494500 -- (-768.188) [-764.718] (-762.109) (-765.963) * (-770.389) (-755.046) [-762.590] (-761.415) -- 0:02:14
495000 -- (-770.574) (-772.333) (-761.799) [-758.240] * (-762.963) (-768.379) [-758.788] (-758.526) -- 0:02:14
Average standard deviation of split frequencies: 0.013585
495500 -- (-770.309) (-769.653) [-762.034] (-760.668) * [-759.378] (-773.909) (-758.070) (-759.471) -- 0:02:14
496000 -- (-773.061) (-762.346) [-754.596] (-773.926) * (-765.828) (-768.363) (-756.863) [-763.205] -- 0:02:14
496500 -- (-769.156) (-757.271) [-757.924] (-770.041) * (-763.787) [-764.364] (-766.849) (-767.586) -- 0:02:13
497000 -- (-761.848) [-754.200] (-760.289) (-773.306) * (-765.355) (-775.883) [-757.637] (-757.322) -- 0:02:14
497500 -- (-759.335) (-759.665) [-755.311] (-767.976) * (-763.309) (-761.422) (-763.286) [-760.082] -- 0:02:14
498000 -- (-763.073) (-756.817) (-766.514) [-760.961] * (-760.944) (-761.599) [-759.773] (-761.609) -- 0:02:14
498500 -- (-758.286) (-758.616) [-757.933] (-775.603) * (-766.421) (-765.702) [-753.788] (-759.889) -- 0:02:13
499000 -- (-758.353) (-765.062) (-766.189) [-764.122] * (-765.858) (-761.793) [-761.373] (-764.133) -- 0:02:13
499500 -- [-754.404] (-778.820) (-769.797) (-761.484) * (-776.428) (-769.897) [-759.057] (-774.751) -- 0:02:13
500000 -- (-755.170) (-774.969) (-760.066) [-755.035] * (-763.104) (-765.400) (-757.286) [-758.000] -- 0:02:13
Average standard deviation of split frequencies: 0.013459
500500 -- (-765.203) [-762.073] (-765.167) (-763.406) * [-758.764] (-771.454) (-759.770) (-764.223) -- 0:02:12
501000 -- (-768.660) (-774.124) [-754.640] (-756.296) * (-768.051) (-763.858) (-765.170) [-764.720] -- 0:02:13
501500 -- (-774.856) (-766.683) (-757.077) [-759.037] * (-765.444) (-764.545) (-761.665) [-751.408] -- 0:02:13
502000 -- (-762.578) (-770.713) (-764.984) [-763.424] * (-767.254) (-770.492) [-762.619] (-754.477) -- 0:02:12
502500 -- (-762.517) [-758.054] (-777.708) (-760.366) * (-759.726) (-774.619) [-761.330] (-763.635) -- 0:02:12
503000 -- (-776.836) (-759.545) [-757.656] (-760.674) * (-765.658) [-764.630] (-764.110) (-766.597) -- 0:02:12
503500 -- (-776.259) (-762.221) (-767.934) [-757.743] * [-763.251] (-766.537) (-761.980) (-769.212) -- 0:02:12
504000 -- (-774.798) (-759.308) [-756.199] (-763.594) * (-765.547) [-758.140] (-763.603) (-761.180) -- 0:02:11
504500 -- (-771.833) [-760.906] (-757.439) (-756.127) * (-762.277) (-757.082) [-755.241] (-763.319) -- 0:02:12
505000 -- [-766.121] (-763.525) (-766.166) (-764.690) * (-767.344) (-765.487) (-758.770) [-758.897] -- 0:02:12
Average standard deviation of split frequencies: 0.013536
505500 -- [-769.955] (-762.328) (-755.624) (-757.992) * (-769.100) (-765.367) [-759.426] (-754.908) -- 0:02:12
506000 -- (-773.171) (-759.669) (-760.494) [-755.416] * (-759.262) (-774.139) (-762.357) [-760.219] -- 0:02:11
506500 -- (-768.577) [-757.567] (-758.622) (-763.763) * (-767.259) (-763.785) [-756.880] (-770.605) -- 0:02:11
507000 -- (-758.281) (-761.591) [-756.568] (-762.044) * [-755.062] (-770.975) (-757.484) (-772.111) -- 0:02:11
507500 -- [-757.875] (-761.433) (-765.373) (-761.593) * (-763.813) [-765.171] (-764.398) (-766.854) -- 0:02:11
508000 -- [-758.467] (-760.558) (-755.234) (-761.010) * (-769.234) [-767.450] (-769.716) (-769.836) -- 0:02:10
508500 -- (-768.354) (-760.266) [-759.176] (-773.773) * [-762.720] (-760.284) (-760.401) (-765.538) -- 0:02:11
509000 -- [-767.165] (-757.114) (-758.483) (-760.627) * (-767.938) (-765.644) [-759.863] (-762.093) -- 0:02:11
509500 -- (-766.916) (-769.364) (-758.563) [-758.575] * (-758.188) (-775.137) (-757.386) [-757.768] -- 0:02:10
510000 -- (-755.550) (-769.874) [-758.809] (-767.645) * (-758.181) (-779.484) (-767.665) [-760.783] -- 0:02:10
Average standard deviation of split frequencies: 0.013249
510500 -- (-766.671) (-766.869) [-764.933] (-773.194) * (-762.839) (-763.785) [-765.521] (-755.350) -- 0:02:10
511000 -- (-758.670) (-762.383) (-765.292) [-762.842] * (-765.775) (-754.617) (-766.451) [-767.202] -- 0:02:10
511500 -- [-761.284] (-769.177) (-762.405) (-762.750) * (-759.613) (-759.745) (-772.559) [-757.877] -- 0:02:09
512000 -- (-762.594) (-764.721) [-759.888] (-762.941) * (-768.106) (-760.055) (-769.528) [-752.511] -- 0:02:10
512500 -- (-761.058) [-764.401] (-760.704) (-761.647) * (-770.199) [-756.924] (-760.826) (-761.630) -- 0:02:10
513000 -- (-759.809) (-761.159) [-750.449] (-765.921) * (-765.369) (-761.194) (-756.034) [-754.905] -- 0:02:10
513500 -- (-766.243) (-762.751) [-756.739] (-768.696) * [-759.516] (-766.129) (-764.551) (-767.132) -- 0:02:09
514000 -- (-770.766) (-761.784) (-758.301) [-756.349] * [-764.630] (-765.537) (-755.690) (-756.508) -- 0:02:09
514500 -- (-764.374) (-765.370) [-762.610] (-760.117) * (-762.248) (-763.582) (-768.243) [-760.039] -- 0:02:09
515000 -- (-765.183) (-765.316) [-754.108] (-764.502) * (-765.248) (-758.231) [-760.183] (-760.870) -- 0:02:09
Average standard deviation of split frequencies: 0.013489
515500 -- (-754.317) [-758.444] (-766.161) (-767.319) * (-763.951) [-762.293] (-769.805) (-763.719) -- 0:02:08
516000 -- (-763.390) (-774.885) [-754.286] (-761.782) * (-759.639) (-768.179) [-758.824] (-760.744) -- 0:02:09
516500 -- (-761.495) (-762.933) [-761.694] (-768.833) * (-757.754) (-760.744) (-763.255) [-769.004] -- 0:02:09
517000 -- (-773.951) (-760.295) (-759.717) [-760.947] * (-756.728) (-767.515) (-766.307) [-766.502] -- 0:02:08
517500 -- [-760.561] (-761.283) (-768.835) (-765.049) * [-755.492] (-759.363) (-769.438) (-764.521) -- 0:02:08
518000 -- (-767.722) (-756.386) (-765.964) [-759.930] * (-761.395) (-764.016) [-756.081] (-768.448) -- 0:02:08
518500 -- [-757.693] (-758.450) (-757.691) (-765.754) * [-752.528] (-767.213) (-762.232) (-764.132) -- 0:02:08
519000 -- (-768.710) [-763.630] (-763.909) (-770.403) * (-763.170) (-763.644) [-756.521] (-762.445) -- 0:02:07
519500 -- [-756.679] (-770.097) (-757.221) (-773.810) * (-770.547) (-763.060) (-761.810) [-754.834] -- 0:02:07
520000 -- [-760.643] (-757.929) (-772.231) (-766.597) * (-766.302) [-757.265] (-766.297) (-768.961) -- 0:02:08
Average standard deviation of split frequencies: 0.013315
520500 -- (-765.899) (-757.306) [-760.560] (-759.902) * (-762.958) (-757.305) [-756.137] (-766.881) -- 0:02:08
521000 -- (-761.940) (-760.422) [-762.729] (-772.001) * (-765.225) (-762.165) (-766.784) [-761.391] -- 0:02:07
521500 -- (-764.315) [-757.676] (-774.984) (-760.819) * (-764.368) (-758.398) (-756.390) [-753.158] -- 0:02:07
522000 -- (-763.839) [-752.779] (-776.375) (-767.661) * (-762.804) (-766.722) (-768.756) [-763.303] -- 0:02:07
522500 -- [-764.414] (-755.779) (-765.852) (-767.001) * (-756.422) [-760.681] (-765.216) (-767.241) -- 0:02:07
523000 -- (-759.369) (-759.017) (-757.541) [-759.179] * (-764.704) [-751.559] (-764.069) (-769.668) -- 0:02:06
523500 -- (-762.339) (-766.956) (-757.564) [-766.227] * (-769.548) (-765.562) (-766.020) [-763.911] -- 0:02:07
524000 -- [-760.618] (-758.376) (-762.290) (-765.359) * (-770.940) (-773.414) [-756.351] (-762.620) -- 0:02:07
524500 -- [-763.164] (-755.376) (-756.168) (-773.531) * (-759.562) (-771.702) (-771.412) [-766.921] -- 0:02:06
525000 -- (-759.104) [-760.158] (-757.582) (-762.647) * [-759.254] (-768.816) (-764.286) (-762.046) -- 0:02:06
Average standard deviation of split frequencies: 0.013812
525500 -- (-770.486) (-763.864) (-760.358) [-772.265] * [-761.894] (-761.061) (-768.361) (-759.505) -- 0:02:06
526000 -- (-762.246) (-756.262) (-766.177) [-757.735] * (-758.562) (-760.912) (-767.668) [-762.764] -- 0:02:06
526500 -- (-760.104) (-769.536) [-761.300] (-759.729) * [-765.033] (-770.129) (-765.384) (-769.690) -- 0:02:05
527000 -- (-772.242) (-767.710) [-759.224] (-767.320) * (-764.625) [-752.685] (-768.339) (-769.228) -- 0:02:05
527500 -- (-757.690) [-755.928] (-758.529) (-762.567) * (-765.730) [-762.571] (-762.912) (-773.269) -- 0:02:06
528000 -- (-760.316) [-761.088] (-767.472) (-761.713) * [-756.061] (-759.795) (-771.803) (-766.859) -- 0:02:06
528500 -- (-768.646) [-761.078] (-778.782) (-760.924) * (-767.446) [-764.244] (-765.140) (-759.277) -- 0:02:05
529000 -- [-758.553] (-769.484) (-768.415) (-767.272) * (-764.132) (-756.546) (-772.953) [-758.428] -- 0:02:05
529500 -- (-760.083) (-760.690) (-769.358) [-775.176] * [-756.786] (-766.876) (-767.399) (-763.018) -- 0:02:05
530000 -- [-760.697] (-775.775) (-770.414) (-757.105) * (-770.515) (-763.776) (-760.360) [-761.671] -- 0:02:05
Average standard deviation of split frequencies: 0.013325
530500 -- [-762.101] (-761.046) (-773.721) (-759.645) * (-774.618) [-762.248] (-763.019) (-757.461) -- 0:02:04
531000 -- (-773.573) (-764.448) (-783.370) [-758.846] * (-763.404) [-759.000] (-767.574) (-755.208) -- 0:02:04
531500 -- [-769.490] (-760.710) (-769.509) (-761.306) * (-762.274) (-762.028) (-768.259) [-755.618] -- 0:02:05
532000 -- (-773.117) (-760.767) (-776.026) [-763.394] * (-766.153) [-765.769] (-767.302) (-762.128) -- 0:02:04
532500 -- (-775.771) (-766.214) [-759.677] (-761.022) * (-761.159) [-760.326] (-773.019) (-769.828) -- 0:02:04
533000 -- (-772.117) (-763.305) (-762.526) [-757.388] * (-772.998) (-764.573) [-759.360] (-771.658) -- 0:02:04
533500 -- [-758.177] (-760.310) (-770.236) (-759.755) * [-757.550] (-762.867) (-766.390) (-763.970) -- 0:02:04
534000 -- [-765.461] (-762.907) (-762.620) (-758.455) * (-756.228) (-771.787) (-765.044) [-769.093] -- 0:02:03
534500 -- (-770.070) [-762.881] (-762.991) (-761.807) * (-761.458) (-759.963) [-762.595] (-762.129) -- 0:02:03
535000 -- [-764.232] (-765.262) (-759.459) (-762.969) * (-766.962) (-764.046) [-752.617] (-774.187) -- 0:02:04
Average standard deviation of split frequencies: 0.013554
535500 -- (-775.311) (-757.709) (-762.657) [-764.693] * (-762.769) [-764.199] (-760.220) (-766.297) -- 0:02:04
536000 -- (-767.423) (-765.872) (-771.095) [-766.600] * (-767.747) (-764.239) [-761.556] (-765.666) -- 0:02:03
536500 -- (-759.834) (-755.647) [-758.433] (-769.306) * (-769.256) (-774.801) (-768.443) [-765.528] -- 0:02:03
537000 -- (-757.220) (-761.158) (-762.408) [-762.130] * (-759.393) (-764.554) [-760.118] (-755.677) -- 0:02:03
537500 -- (-762.431) [-758.795] (-759.561) (-768.624) * [-757.729] (-764.942) (-764.040) (-763.716) -- 0:02:03
538000 -- (-767.668) [-756.917] (-762.408) (-759.601) * (-755.514) [-760.374] (-755.449) (-762.060) -- 0:02:02
538500 -- [-763.280] (-762.683) (-757.129) (-765.723) * (-758.122) (-767.014) (-763.384) [-756.993] -- 0:02:02
539000 -- (-762.081) (-764.732) (-762.057) [-765.609] * (-757.523) (-760.331) (-754.494) [-765.122] -- 0:02:03
539500 -- (-760.715) (-766.560) [-762.455] (-758.567) * (-761.988) (-777.753) (-766.533) [-757.193] -- 0:02:02
540000 -- (-763.259) (-756.809) (-769.158) [-763.038] * (-761.270) (-758.335) (-759.953) [-759.105] -- 0:02:02
Average standard deviation of split frequencies: 0.013232
540500 -- (-765.767) [-759.010] (-763.782) (-766.140) * [-762.653] (-759.692) (-759.174) (-764.355) -- 0:02:02
541000 -- [-761.809] (-768.934) (-765.959) (-763.489) * [-767.469] (-764.924) (-762.282) (-759.104) -- 0:02:02
541500 -- [-755.052] (-757.820) (-768.056) (-753.912) * [-760.394] (-759.641) (-765.208) (-762.036) -- 0:02:01
542000 -- [-771.142] (-760.048) (-765.374) (-762.449) * (-756.028) (-759.567) [-758.483] (-765.070) -- 0:02:01
542500 -- (-772.224) (-764.263) (-766.602) [-760.077] * (-766.207) [-765.078] (-770.116) (-754.832) -- 0:02:02
543000 -- (-766.141) [-763.131] (-770.228) (-766.506) * (-761.885) [-752.783] (-760.172) (-757.708) -- 0:02:02
543500 -- (-767.359) [-767.900] (-758.107) (-762.005) * (-772.513) [-760.514] (-759.054) (-766.893) -- 0:02:01
544000 -- (-776.649) [-761.029] (-757.379) (-766.964) * (-760.840) [-756.455] (-768.058) (-762.216) -- 0:02:01
544500 -- (-762.862) [-760.508] (-772.345) (-760.515) * (-767.898) (-765.462) (-775.041) [-761.651] -- 0:02:01
545000 -- (-771.866) (-769.169) [-764.130] (-773.141) * (-759.889) [-762.977] (-756.257) (-771.028) -- 0:02:01
Average standard deviation of split frequencies: 0.012646
545500 -- (-763.508) (-763.113) [-758.385] (-764.809) * (-760.520) [-754.526] (-762.808) (-759.152) -- 0:02:00
546000 -- (-767.697) [-755.193] (-763.416) (-757.653) * (-773.499) (-761.454) (-754.449) [-761.162] -- 0:02:00
546500 -- (-760.593) (-753.226) (-766.015) [-752.601] * (-763.564) (-766.438) (-766.141) [-769.062] -- 0:02:01
547000 -- (-767.124) (-758.420) (-776.345) [-757.981] * (-772.171) [-756.261] (-764.371) (-755.418) -- 0:02:00
547500 -- (-761.929) (-764.087) [-758.339] (-759.728) * (-763.972) [-756.622] (-762.323) (-760.660) -- 0:02:00
548000 -- [-761.233] (-758.765) (-764.506) (-761.697) * [-760.293] (-763.005) (-758.909) (-768.761) -- 0:02:00
548500 -- (-759.267) (-757.359) [-767.494] (-762.030) * (-760.455) (-762.556) [-766.833] (-763.921) -- 0:02:00
549000 -- (-762.983) (-766.627) (-765.921) [-764.108] * (-765.797) [-767.422] (-767.190) (-767.162) -- 0:01:59
549500 -- (-759.378) (-761.846) (-763.372) [-756.719] * [-764.029] (-763.076) (-773.464) (-768.525) -- 0:01:59
550000 -- [-756.526] (-760.236) (-763.451) (-766.559) * (-765.048) (-754.537) [-760.025] (-773.180) -- 0:02:00
Average standard deviation of split frequencies: 0.012438
550500 -- (-761.633) [-760.079] (-766.541) (-761.225) * (-764.263) [-756.348] (-767.972) (-757.334) -- 0:02:00
551000 -- (-768.213) (-760.110) [-762.163] (-769.882) * (-773.362) (-760.341) [-755.841] (-764.473) -- 0:01:59
551500 -- (-782.158) (-764.521) (-762.113) [-767.198] * [-759.641] (-754.001) (-762.365) (-770.971) -- 0:01:59
552000 -- (-777.745) (-762.950) [-761.306] (-759.391) * (-763.738) (-756.000) [-763.582] (-765.317) -- 0:01:59
552500 -- (-769.008) [-755.943] (-758.159) (-762.945) * (-758.012) [-759.822] (-763.265) (-759.840) -- 0:01:59
553000 -- (-770.430) (-764.475) (-771.298) [-757.064] * [-761.107] (-765.389) (-762.693) (-755.585) -- 0:01:58
553500 -- (-761.280) [-757.971] (-770.813) (-757.301) * (-761.338) (-764.022) [-761.008] (-758.782) -- 0:01:59
554000 -- [-759.640] (-762.166) (-764.526) (-779.135) * (-775.078) (-758.975) [-757.709] (-765.629) -- 0:01:59
554500 -- (-763.154) (-759.109) (-765.554) [-757.452] * (-768.268) (-761.184) [-756.494] (-764.408) -- 0:01:58
555000 -- (-760.516) (-766.578) (-771.140) [-766.104] * (-766.276) (-767.330) [-759.781] (-755.354) -- 0:01:58
Average standard deviation of split frequencies: 0.011371
555500 -- (-755.149) (-768.969) [-758.356] (-753.872) * (-758.212) (-765.323) (-763.650) [-763.681] -- 0:01:58
556000 -- (-760.265) (-762.750) [-762.230] (-760.393) * (-765.961) (-764.294) [-771.927] (-768.283) -- 0:01:58
556500 -- [-756.221] (-760.497) (-760.448) (-771.985) * (-759.301) (-758.925) (-767.974) [-761.387] -- 0:01:57
557000 -- (-759.675) (-763.287) (-761.038) [-759.567] * [-767.494] (-772.056) (-761.208) (-773.175) -- 0:01:58
557500 -- [-755.247] (-759.181) (-766.023) (-765.501) * (-773.893) (-763.954) [-753.763] (-754.044) -- 0:01:58
558000 -- (-754.135) (-767.941) [-760.278] (-758.175) * [-770.601] (-766.950) (-765.545) (-754.818) -- 0:01:58
558500 -- (-755.345) [-763.372] (-762.764) (-762.845) * (-764.012) (-768.501) (-771.297) [-763.280] -- 0:01:57
559000 -- (-761.619) (-774.542) (-765.347) [-759.772] * (-772.769) (-762.023) [-756.391] (-770.626) -- 0:01:57
559500 -- (-766.435) (-767.515) [-764.562] (-763.657) * [-761.403] (-771.343) (-763.061) (-762.717) -- 0:01:57
560000 -- (-767.566) (-763.251) [-761.315] (-766.816) * (-764.191) (-755.960) (-770.871) [-753.185] -- 0:01:57
Average standard deviation of split frequencies: 0.011029
560500 -- (-763.043) (-762.762) [-761.378] (-762.689) * (-767.160) [-761.958] (-765.425) (-763.251) -- 0:01:56
561000 -- (-766.255) (-761.647) [-763.143] (-765.804) * (-760.427) (-759.416) (-780.647) [-756.128] -- 0:01:57
561500 -- (-762.235) (-771.667) [-759.784] (-768.082) * [-759.656] (-763.067) (-772.469) (-763.993) -- 0:01:57
562000 -- (-779.863) (-764.173) [-756.896] (-756.516) * (-763.603) [-767.853] (-766.198) (-768.313) -- 0:01:56
562500 -- (-762.511) [-764.113] (-774.962) (-768.386) * [-757.944] (-763.105) (-770.431) (-764.449) -- 0:01:56
563000 -- (-774.044) (-757.444) [-763.392] (-761.735) * (-773.372) [-760.660] (-767.710) (-764.576) -- 0:01:56
563500 -- [-762.502] (-767.008) (-768.648) (-763.252) * [-760.218] (-762.911) (-756.393) (-759.170) -- 0:01:56
564000 -- [-764.529] (-771.829) (-764.524) (-751.613) * (-765.198) [-760.412] (-764.244) (-783.977) -- 0:01:55
564500 -- (-760.540) (-763.064) (-759.623) [-754.976] * (-755.501) (-756.594) [-763.202] (-768.660) -- 0:01:56
565000 -- (-765.004) (-757.548) (-763.666) [-758.139] * (-769.491) [-758.828] (-759.009) (-768.712) -- 0:01:56
Average standard deviation of split frequencies: 0.011072
565500 -- (-760.071) (-757.230) [-760.134] (-769.977) * [-756.864] (-761.337) (-761.669) (-765.301) -- 0:01:56
566000 -- (-756.787) (-762.085) [-768.329] (-757.707) * [-769.345] (-766.476) (-755.780) (-769.045) -- 0:01:55
566500 -- [-756.374] (-771.075) (-760.518) (-756.767) * (-763.998) (-762.939) (-773.251) [-753.202] -- 0:01:55
567000 -- (-760.489) (-759.369) [-760.314] (-774.156) * (-766.086) (-757.510) [-766.913] (-759.735) -- 0:01:55
567500 -- [-760.441] (-762.529) (-762.011) (-771.757) * (-768.467) (-760.388) (-782.003) [-762.018] -- 0:01:55
568000 -- (-755.618) (-761.922) [-756.559] (-764.646) * (-760.639) [-764.913] (-761.000) (-769.784) -- 0:01:54
568500 -- (-764.793) (-769.327) [-762.095] (-759.704) * (-770.176) [-760.745] (-764.670) (-765.564) -- 0:01:55
569000 -- (-761.251) [-758.979] (-765.988) (-761.944) * [-766.169] (-766.539) (-771.635) (-760.880) -- 0:01:55
569500 -- [-764.956] (-755.075) (-762.191) (-769.859) * (-760.463) (-762.242) (-777.190) [-761.056] -- 0:01:54
570000 -- (-767.155) (-761.067) [-758.330] (-764.851) * [-759.205] (-762.323) (-767.538) (-757.376) -- 0:01:54
Average standard deviation of split frequencies: 0.010933
570500 -- (-758.599) (-763.091) (-759.574) [-767.697] * (-768.868) [-761.351] (-775.404) (-762.775) -- 0:01:54
571000 -- (-757.711) (-770.533) [-764.968] (-765.694) * (-759.455) (-768.033) (-777.926) [-765.251] -- 0:01:54
571500 -- (-759.249) (-758.709) (-762.235) [-761.764] * (-756.148) [-771.017] (-768.489) (-768.348) -- 0:01:53
572000 -- [-761.725] (-767.097) (-761.730) (-758.398) * [-752.815] (-766.366) (-769.512) (-755.263) -- 0:01:54
572500 -- (-757.220) [-758.700] (-769.403) (-765.502) * (-761.067) [-758.183] (-764.233) (-771.077) -- 0:01:54
573000 -- (-760.271) (-760.868) [-764.971] (-774.261) * (-761.828) [-759.752] (-759.505) (-766.472) -- 0:01:54
573500 -- (-756.408) (-764.316) (-764.089) [-760.496] * (-761.671) [-756.961] (-762.512) (-767.847) -- 0:01:53
574000 -- (-759.116) (-762.756) (-773.083) [-760.531] * [-761.825] (-762.402) (-760.435) (-777.458) -- 0:01:53
574500 -- [-762.638] (-753.807) (-764.443) (-767.243) * [-768.431] (-760.029) (-768.982) (-758.888) -- 0:01:53
575000 -- (-769.681) [-761.038] (-759.126) (-768.714) * (-767.264) (-764.476) (-766.118) [-765.682] -- 0:01:53
Average standard deviation of split frequencies: 0.011554
575500 -- (-771.041) (-766.345) (-760.337) [-753.544] * [-764.749] (-763.031) (-758.271) (-777.796) -- 0:01:53
576000 -- (-759.513) (-775.603) [-761.874] (-759.044) * [-762.522] (-765.161) (-760.621) (-760.715) -- 0:01:53
576500 -- (-759.257) (-762.093) (-760.333) [-767.507] * [-764.890] (-759.299) (-760.402) (-768.252) -- 0:01:53
577000 -- (-762.024) (-773.677) [-769.287] (-766.802) * [-758.461] (-764.322) (-768.988) (-763.905) -- 0:01:52
577500 -- (-761.605) [-758.550] (-767.662) (-763.688) * (-759.059) (-766.810) (-776.499) [-760.240] -- 0:01:52
578000 -- [-768.781] (-772.966) (-778.192) (-760.863) * [-759.669] (-763.936) (-770.634) (-754.828) -- 0:01:52
578500 -- [-767.930] (-763.417) (-776.636) (-756.445) * (-772.689) (-757.870) (-758.636) [-761.546] -- 0:01:52
579000 -- (-766.995) [-760.588] (-771.701) (-761.185) * (-756.145) (-764.871) (-760.093) [-755.779] -- 0:01:51
579500 -- (-768.802) [-757.780] (-763.066) (-757.092) * [-755.167] (-758.736) (-769.700) (-758.691) -- 0:01:52
580000 -- (-768.772) (-759.529) (-768.590) [-752.400] * (-773.507) (-762.116) [-762.079] (-766.780) -- 0:01:52
Average standard deviation of split frequencies: 0.011461
580500 -- (-765.987) (-761.463) (-769.515) [-771.258] * (-767.680) (-762.632) (-759.223) [-757.322] -- 0:01:52
581000 -- (-763.272) (-761.884) (-766.245) [-765.688] * (-757.445) (-763.528) [-754.087] (-757.656) -- 0:01:51
581500 -- [-762.738] (-762.628) (-761.605) (-762.459) * [-767.800] (-767.354) (-766.279) (-755.605) -- 0:01:51
582000 -- (-765.531) (-757.830) (-768.183) [-760.266] * (-760.340) (-764.366) (-765.065) [-762.286] -- 0:01:51
582500 -- (-760.784) (-757.281) [-763.224] (-763.733) * (-762.139) (-769.715) [-751.156] (-767.364) -- 0:01:51
583000 -- (-770.743) (-756.805) [-757.403] (-771.182) * (-768.350) (-778.576) (-761.422) [-763.371] -- 0:01:51
583500 -- (-769.782) (-758.131) (-768.405) [-765.156] * (-769.690) (-770.986) [-762.355] (-759.975) -- 0:01:51
584000 -- [-766.434] (-758.657) (-763.594) (-752.838) * (-757.628) (-760.879) [-762.055] (-766.609) -- 0:01:51
584500 -- (-761.433) (-762.145) (-761.235) [-749.935] * [-761.568] (-760.449) (-766.335) (-767.730) -- 0:01:50
585000 -- (-761.985) (-761.034) (-755.541) [-757.077] * (-762.974) (-763.282) [-759.929] (-759.951) -- 0:01:50
Average standard deviation of split frequencies: 0.011026
585500 -- (-767.062) (-771.306) (-769.835) [-754.972] * (-769.954) [-753.461] (-763.227) (-766.497) -- 0:01:50
586000 -- (-763.870) [-755.986] (-764.620) (-763.827) * (-765.386) (-767.845) [-763.384] (-770.174) -- 0:01:50
586500 -- (-765.464) [-754.497] (-770.444) (-760.388) * (-763.033) [-750.514] (-767.893) (-763.046) -- 0:01:50
587000 -- (-769.521) (-756.138) [-763.007] (-769.251) * (-768.114) (-763.084) [-762.073] (-771.270) -- 0:01:50
587500 -- (-760.226) [-753.226] (-768.596) (-764.718) * (-767.467) (-766.543) [-761.670] (-766.740) -- 0:01:50
588000 -- (-759.453) (-765.982) [-752.803] (-771.566) * (-770.573) (-774.157) [-762.807] (-757.181) -- 0:01:50
588500 -- (-756.416) [-765.700] (-767.941) (-777.705) * (-765.768) (-772.436) [-760.182] (-760.521) -- 0:01:49
589000 -- [-760.113] (-766.356) (-759.768) (-767.388) * (-762.102) [-763.540] (-770.020) (-765.079) -- 0:01:49
589500 -- (-768.335) [-756.611] (-764.023) (-765.809) * (-759.104) [-756.733] (-769.429) (-759.729) -- 0:01:49
590000 -- (-765.280) (-762.704) [-757.404] (-767.111) * (-764.023) (-759.605) (-776.010) [-763.183] -- 0:01:49
Average standard deviation of split frequencies: 0.010985
590500 -- (-767.196) (-756.671) (-757.760) [-758.224] * (-758.383) [-766.817] (-770.298) (-771.340) -- 0:01:49
591000 -- (-767.823) (-768.411) [-749.587] (-762.064) * (-764.021) [-768.879] (-766.039) (-767.234) -- 0:01:49
591500 -- [-759.504] (-779.164) (-762.131) (-758.598) * [-756.753] (-764.132) (-757.196) (-766.519) -- 0:01:49
592000 -- [-752.683] (-765.060) (-761.192) (-770.221) * (-758.280) (-758.759) (-762.893) [-767.202] -- 0:01:48
592500 -- [-756.876] (-760.935) (-765.393) (-756.153) * (-765.390) (-767.254) (-770.075) [-762.466] -- 0:01:48
593000 -- [-761.312] (-777.651) (-761.916) (-764.736) * (-756.075) (-766.676) (-755.801) [-756.924] -- 0:01:48
593500 -- (-765.830) (-779.773) (-762.172) [-759.818] * (-757.017) (-758.771) (-766.785) [-768.143] -- 0:01:48
594000 -- (-758.861) (-763.057) (-764.709) [-764.600] * (-765.223) (-763.982) (-765.531) [-764.400] -- 0:01:48
594500 -- (-760.670) [-759.739] (-765.381) (-759.889) * (-762.145) (-756.990) (-758.035) [-770.410] -- 0:01:48
595000 -- (-764.396) (-762.842) [-757.871] (-768.886) * (-761.432) [-759.392] (-767.989) (-756.895) -- 0:01:48
Average standard deviation of split frequencies: 0.010934
595500 -- [-756.634] (-762.777) (-758.438) (-763.082) * (-769.671) (-760.009) (-764.359) [-760.637] -- 0:01:48
596000 -- [-759.416] (-766.210) (-754.061) (-772.624) * (-770.837) [-762.356] (-759.709) (-759.421) -- 0:01:47
596500 -- [-760.849] (-764.327) (-765.083) (-772.559) * (-758.716) (-767.605) (-756.601) [-757.852] -- 0:01:47
597000 -- [-759.816] (-764.481) (-762.774) (-773.859) * (-762.399) (-769.871) [-764.784] (-759.418) -- 0:01:47
597500 -- (-759.141) (-757.147) (-757.952) [-760.388] * (-765.290) (-770.391) (-772.358) [-758.314] -- 0:01:47
598000 -- (-767.276) (-760.862) [-763.327] (-764.009) * [-762.528] (-763.464) (-777.329) (-760.248) -- 0:01:47
598500 -- (-757.886) [-765.178] (-763.125) (-767.399) * (-777.150) (-756.452) (-773.530) [-753.861] -- 0:01:47
599000 -- (-769.207) (-758.187) (-765.353) [-763.112] * (-759.785) (-764.075) [-756.432] (-768.418) -- 0:01:47
599500 -- [-766.092] (-767.179) (-759.838) (-760.060) * (-764.547) [-768.407] (-763.208) (-764.827) -- 0:01:46
600000 -- (-771.709) [-753.414] (-760.323) (-767.528) * [-756.421] (-761.615) (-770.759) (-760.734) -- 0:01:46
Average standard deviation of split frequencies: 0.010433
600500 -- (-764.603) (-756.035) [-765.350] (-760.037) * [-759.502] (-758.708) (-766.066) (-767.996) -- 0:01:46
601000 -- (-763.077) (-759.535) [-753.192] (-764.858) * [-758.376] (-760.028) (-777.428) (-772.732) -- 0:01:46
601500 -- (-767.177) [-762.210] (-762.639) (-767.748) * [-758.004] (-763.907) (-761.013) (-765.002) -- 0:01:46
602000 -- (-763.021) [-759.075] (-760.224) (-767.923) * (-771.555) [-764.203] (-756.827) (-763.354) -- 0:01:46
602500 -- (-762.338) (-766.355) [-759.901] (-760.444) * [-756.404] (-774.834) (-756.953) (-766.027) -- 0:01:46
603000 -- [-759.945] (-759.245) (-779.546) (-768.882) * [-754.722] (-769.259) (-762.680) (-759.042) -- 0:01:45
603500 -- (-753.650) (-762.276) [-765.952] (-768.125) * (-762.425) (-763.431) [-762.742] (-757.265) -- 0:01:45
604000 -- (-763.910) (-765.754) (-770.359) [-761.817] * [-761.930] (-765.306) (-760.265) (-761.439) -- 0:01:45
604500 -- [-757.150] (-767.093) (-775.936) (-763.582) * (-771.186) [-756.700] (-764.210) (-775.533) -- 0:01:45
605000 -- (-757.161) [-762.439] (-774.658) (-763.878) * (-766.269) (-764.339) [-755.398] (-767.738) -- 0:01:45
Average standard deviation of split frequencies: 0.010616
605500 -- (-759.693) (-761.818) (-765.126) [-756.388] * (-767.148) [-760.031] (-764.587) (-762.981) -- 0:01:45
606000 -- (-761.531) (-773.307) (-759.923) [-761.571] * (-770.277) (-764.091) (-767.589) [-772.317] -- 0:01:45
606500 -- (-762.818) (-764.042) (-761.805) [-756.095] * (-767.416) [-757.323] (-767.113) (-768.831) -- 0:01:45
607000 -- (-767.896) (-766.044) (-765.299) [-763.008] * [-759.302] (-764.351) (-768.474) (-761.606) -- 0:01:44
607500 -- [-767.717] (-760.741) (-764.040) (-758.406) * (-770.642) (-758.714) [-753.436] (-758.988) -- 0:01:44
608000 -- (-762.327) (-765.897) (-769.209) [-758.880] * (-762.271) (-757.816) (-759.565) [-755.984] -- 0:01:45
608500 -- (-761.167) [-766.425] (-755.542) (-770.421) * (-765.082) (-765.673) [-758.414] (-763.488) -- 0:01:44
609000 -- (-759.756) [-758.904] (-763.788) (-767.274) * (-767.526) (-760.935) (-761.250) [-762.296] -- 0:01:44
609500 -- (-763.683) (-768.012) (-759.596) [-765.840] * (-763.896) (-755.834) (-763.146) [-763.594] -- 0:01:44
610000 -- (-761.423) (-778.262) (-753.680) [-762.808] * [-764.135] (-763.651) (-757.512) (-764.820) -- 0:01:44
Average standard deviation of split frequencies: 0.010444
610500 -- [-754.382] (-761.040) (-760.704) (-772.785) * (-780.701) [-759.691] (-763.467) (-762.020) -- 0:01:43
611000 -- (-761.876) (-757.014) (-764.273) [-758.422] * (-756.871) [-775.486] (-762.707) (-761.111) -- 0:01:43
611500 -- (-761.442) [-759.690] (-755.813) (-767.408) * (-763.212) (-758.106) (-758.015) [-760.781] -- 0:01:44
612000 -- (-762.503) (-764.156) [-755.932] (-769.522) * (-765.629) (-761.196) (-765.870) [-769.092] -- 0:01:43
612500 -- (-764.158) (-763.886) [-758.976] (-778.902) * (-766.366) (-759.246) (-768.027) [-758.258] -- 0:01:43
613000 -- (-763.563) (-766.756) [-763.211] (-765.476) * [-768.619] (-764.347) (-765.731) (-761.402) -- 0:01:43
613500 -- (-762.980) (-761.487) [-759.646] (-766.367) * (-761.211) [-762.525] (-759.048) (-762.464) -- 0:01:43
614000 -- (-768.258) [-761.484] (-761.678) (-767.049) * (-767.639) (-765.779) (-765.883) [-765.600] -- 0:01:43
614500 -- (-758.340) (-769.019) [-758.017] (-770.819) * (-759.707) (-766.474) [-773.329] (-761.217) -- 0:01:42
615000 -- (-762.916) [-760.398] (-768.878) (-776.539) * (-764.291) [-758.467] (-757.868) (-761.690) -- 0:01:42
Average standard deviation of split frequencies: 0.009903
615500 -- [-760.131] (-760.313) (-760.957) (-759.308) * (-762.909) (-758.439) [-757.996] (-757.138) -- 0:01:43
616000 -- (-758.873) [-759.330] (-767.357) (-766.482) * (-769.238) (-767.768) [-759.922] (-770.420) -- 0:01:42
616500 -- [-764.721] (-756.193) (-762.481) (-770.561) * (-762.651) (-766.595) [-759.528] (-761.217) -- 0:01:42
617000 -- (-760.590) (-764.216) [-759.502] (-761.692) * [-761.350] (-763.414) (-771.302) (-765.437) -- 0:01:42
617500 -- [-758.831] (-767.365) (-769.221) (-758.428) * (-758.352) [-760.368] (-761.679) (-772.995) -- 0:01:42
618000 -- (-767.936) (-780.341) (-758.105) [-760.163] * (-765.554) [-756.387] (-761.258) (-766.089) -- 0:01:41
618500 -- (-756.669) (-758.882) [-758.648] (-765.034) * [-754.530] (-770.217) (-767.998) (-767.628) -- 0:01:41
619000 -- (-766.426) [-754.710] (-757.316) (-759.774) * (-764.663) [-757.894] (-762.581) (-761.218) -- 0:01:42
619500 -- (-763.658) (-768.409) [-759.568] (-765.416) * [-765.650] (-757.851) (-767.122) (-766.642) -- 0:01:41
620000 -- [-762.767] (-763.726) (-763.845) (-756.204) * (-753.056) (-765.815) [-772.581] (-759.215) -- 0:01:41
Average standard deviation of split frequencies: 0.009963
620500 -- (-772.735) (-760.827) [-756.997] (-756.784) * [-763.735] (-763.018) (-766.436) (-764.361) -- 0:01:41
621000 -- (-764.901) (-767.254) (-761.629) [-773.986] * (-768.963) [-757.684] (-773.415) (-758.226) -- 0:01:41
621500 -- [-762.440] (-778.285) (-761.806) (-775.964) * (-762.581) (-758.307) (-758.217) [-757.981] -- 0:01:41
622000 -- (-766.086) [-766.922] (-762.288) (-762.562) * (-755.462) (-760.184) (-763.969) [-756.129] -- 0:01:40
622500 -- [-765.556] (-762.595) (-766.874) (-764.478) * (-772.725) (-762.444) (-763.874) [-755.290] -- 0:01:41
623000 -- [-767.986] (-770.217) (-760.274) (-761.021) * (-763.741) (-767.055) [-765.558] (-767.646) -- 0:01:41
623500 -- (-757.651) [-758.319] (-759.325) (-758.420) * (-764.428) (-760.175) [-757.495] (-764.202) -- 0:01:40
624000 -- [-755.072] (-767.215) (-757.773) (-758.544) * (-760.673) (-764.356) (-760.165) [-757.133] -- 0:01:40
624500 -- (-761.116) (-771.152) (-760.874) [-768.203] * [-765.615] (-767.637) (-760.083) (-755.962) -- 0:01:40
625000 -- (-765.754) (-766.001) (-756.564) [-760.187] * (-767.572) (-773.380) [-758.360] (-758.617) -- 0:01:40
Average standard deviation of split frequencies: 0.009701
625500 -- (-765.244) (-755.205) [-755.877] (-761.676) * (-762.029) [-757.679] (-761.297) (-762.679) -- 0:01:39
626000 -- [-758.486] (-760.567) (-762.366) (-761.335) * (-768.234) (-758.774) [-759.698] (-762.092) -- 0:01:39
626500 -- (-764.631) [-757.735] (-756.408) (-773.600) * [-755.143] (-760.987) (-774.521) (-756.026) -- 0:01:40
627000 -- (-768.065) [-756.905] (-771.552) (-761.367) * (-759.126) [-764.148] (-759.326) (-769.192) -- 0:01:39
627500 -- (-765.498) (-757.616) (-762.397) [-755.107] * (-764.378) (-763.219) [-761.713] (-769.093) -- 0:01:39
628000 -- (-767.440) (-768.427) [-755.741] (-774.495) * (-764.156) (-770.897) (-761.541) [-763.463] -- 0:01:39
628500 -- [-756.257] (-766.154) (-768.640) (-758.982) * (-757.048) (-762.568) [-755.585] (-763.675) -- 0:01:39
629000 -- [-756.712] (-760.059) (-766.043) (-768.269) * [-764.524] (-772.644) (-766.143) (-766.164) -- 0:01:39
629500 -- [-753.790] (-766.152) (-771.569) (-763.656) * (-755.160) (-767.063) [-759.964] (-758.686) -- 0:01:38
630000 -- (-762.718) (-759.398) [-755.731] (-772.387) * (-756.055) (-769.652) [-760.640] (-763.710) -- 0:01:39
Average standard deviation of split frequencies: 0.009673
630500 -- (-754.943) (-759.915) (-764.457) [-756.538] * (-762.977) (-761.031) (-769.788) [-756.126] -- 0:01:39
631000 -- (-773.128) [-761.114] (-757.610) (-768.292) * (-773.336) (-755.213) (-773.591) [-758.974] -- 0:01:38
631500 -- (-767.938) (-765.972) [-770.025] (-763.024) * (-775.970) [-761.178] (-772.293) (-758.665) -- 0:01:38
632000 -- [-758.404] (-760.118) (-759.232) (-769.888) * [-763.427] (-759.035) (-769.334) (-763.550) -- 0:01:38
632500 -- [-757.682] (-758.522) (-771.920) (-761.233) * (-760.821) (-762.754) (-762.690) [-755.151] -- 0:01:38
633000 -- (-764.834) (-777.271) [-766.700] (-766.826) * [-759.255] (-770.753) (-763.069) (-771.663) -- 0:01:37
633500 -- [-759.209] (-772.652) (-765.242) (-768.173) * [-765.080] (-768.803) (-768.260) (-763.596) -- 0:01:38
634000 -- (-758.454) [-760.132] (-762.233) (-770.962) * [-757.659] (-763.898) (-760.019) (-761.418) -- 0:01:38
634500 -- (-761.209) [-761.181] (-772.336) (-756.753) * (-760.042) [-763.822] (-760.793) (-773.612) -- 0:01:37
635000 -- (-758.891) (-762.183) [-760.179] (-761.902) * (-762.440) (-758.081) [-763.024] (-761.320) -- 0:01:37
Average standard deviation of split frequencies: 0.009243
635500 -- [-755.932] (-756.815) (-761.288) (-762.389) * (-760.602) [-768.103] (-760.077) (-759.219) -- 0:01:37
636000 -- (-762.054) (-763.244) [-752.505] (-754.187) * (-767.312) (-756.098) (-766.901) [-763.442] -- 0:01:37
636500 -- (-767.802) (-767.435) (-765.191) [-754.761] * (-755.270) (-772.559) (-757.089) [-753.730] -- 0:01:37
637000 -- (-757.160) (-761.891) (-766.218) [-768.848] * (-761.483) (-756.504) [-764.070] (-768.349) -- 0:01:36
637500 -- (-769.190) (-762.607) [-762.907] (-772.614) * [-764.249] (-755.347) (-760.000) (-765.043) -- 0:01:37
638000 -- (-766.400) (-764.904) [-757.312] (-771.397) * (-762.697) (-765.553) [-756.620] (-772.074) -- 0:01:37
638500 -- (-767.029) [-770.961] (-763.802) (-761.165) * (-760.017) (-758.679) (-771.016) [-755.797] -- 0:01:36
639000 -- (-758.981) (-768.836) [-756.808] (-757.091) * (-762.926) [-757.666] (-764.394) (-760.999) -- 0:01:36
639500 -- (-756.329) (-769.921) (-772.000) [-766.914] * (-767.785) (-761.357) (-769.231) [-757.032] -- 0:01:36
640000 -- (-762.388) (-767.562) [-764.658] (-772.548) * (-772.415) (-756.571) [-761.525] (-763.138) -- 0:01:36
Average standard deviation of split frequencies: 0.009522
640500 -- (-772.914) (-768.338) (-768.451) [-762.691] * (-765.686) (-758.043) (-771.296) [-757.260] -- 0:01:35
641000 -- [-758.093] (-773.159) (-770.214) (-754.603) * (-773.569) (-770.879) (-768.990) [-766.556] -- 0:01:36
641500 -- (-761.320) [-758.382] (-757.465) (-768.375) * (-766.151) (-763.829) [-761.887] (-761.780) -- 0:01:36
642000 -- (-759.053) [-759.034] (-762.322) (-765.298) * (-767.646) (-761.408) (-757.020) [-768.752] -- 0:01:35
642500 -- (-753.897) [-764.124] (-759.271) (-767.296) * (-760.577) (-773.392) [-764.037] (-766.262) -- 0:01:35
643000 -- [-754.975] (-764.212) (-757.359) (-764.093) * [-765.325] (-762.758) (-775.470) (-772.647) -- 0:01:35
643500 -- (-769.532) [-760.205] (-766.258) (-756.003) * (-757.996) [-765.674] (-765.343) (-765.128) -- 0:01:35
644000 -- (-759.454) (-764.384) [-764.828] (-771.663) * [-761.994] (-766.968) (-768.628) (-756.779) -- 0:01:35
644500 -- [-765.680] (-761.554) (-755.292) (-761.867) * [-770.500] (-756.123) (-766.267) (-765.547) -- 0:01:34
645000 -- (-764.953) (-762.666) (-760.260) [-756.951] * (-759.796) (-763.380) [-766.051] (-765.497) -- 0:01:35
Average standard deviation of split frequencies: 0.009229
645500 -- [-766.060] (-757.978) (-760.017) (-775.341) * (-762.427) [-761.881] (-764.991) (-759.731) -- 0:01:35
646000 -- (-764.785) (-770.633) (-756.628) [-761.907] * (-758.941) (-758.901) (-772.436) [-759.453] -- 0:01:34
646500 -- (-763.891) (-761.331) (-766.930) [-756.208] * (-760.688) (-763.424) [-757.793] (-767.406) -- 0:01:34
647000 -- [-762.269] (-758.938) (-760.644) (-760.866) * [-766.891] (-773.930) (-766.123) (-767.536) -- 0:01:34
647500 -- (-770.313) [-756.863] (-766.398) (-755.358) * [-754.307] (-758.881) (-768.358) (-761.456) -- 0:01:34
648000 -- (-766.926) (-756.355) (-759.013) [-757.310] * (-775.751) [-753.386] (-767.685) (-757.254) -- 0:01:33
648500 -- (-765.713) (-762.377) [-757.162] (-764.280) * [-759.216] (-759.271) (-767.682) (-764.694) -- 0:01:34
649000 -- (-766.274) (-759.412) (-770.145) [-765.482] * (-755.516) (-763.508) [-761.132] (-768.458) -- 0:01:34
649500 -- (-762.458) [-758.506] (-766.462) (-759.011) * (-763.498) [-759.189] (-753.843) (-770.581) -- 0:01:33
650000 -- (-758.878) [-763.712] (-761.560) (-764.253) * (-777.083) (-759.838) (-768.446) [-764.042] -- 0:01:33
Average standard deviation of split frequencies: 0.008737
650500 -- [-759.048] (-763.691) (-762.037) (-758.919) * (-770.502) (-761.447) [-760.224] (-758.904) -- 0:01:33
651000 -- [-756.865] (-756.205) (-759.011) (-761.586) * (-757.437) (-763.358) [-762.523] (-764.081) -- 0:01:33
651500 -- (-752.381) (-762.930) [-755.511] (-773.998) * (-754.624) (-763.803) [-756.630] (-771.793) -- 0:01:33
652000 -- (-761.302) (-766.052) (-758.871) [-756.512] * (-761.271) [-760.509] (-759.153) (-768.680) -- 0:01:32
652500 -- (-761.697) (-763.241) (-757.423) [-759.447] * (-761.678) (-760.938) (-758.920) [-756.388] -- 0:01:33
653000 -- (-756.086) (-754.997) [-757.318] (-758.773) * (-772.633) (-775.002) (-759.192) [-762.172] -- 0:01:32
653500 -- (-759.517) [-769.970] (-764.293) (-770.321) * (-770.753) (-777.079) (-764.178) [-767.155] -- 0:01:32
654000 -- (-762.739) (-764.478) (-759.378) [-762.214] * [-757.722] (-773.458) (-761.923) (-765.611) -- 0:01:32
654500 -- [-752.079] (-772.882) (-766.787) (-777.243) * [-767.334] (-756.421) (-775.793) (-756.465) -- 0:01:32
655000 -- (-769.852) (-764.299) [-776.193] (-765.109) * (-764.786) [-762.354] (-768.754) (-761.414) -- 0:01:32
Average standard deviation of split frequencies: 0.008666
655500 -- (-766.274) (-758.544) [-760.375] (-774.314) * (-763.389) (-758.285) (-777.883) [-757.724] -- 0:01:31
656000 -- (-762.072) [-759.394] (-761.943) (-764.434) * (-762.179) (-759.185) (-764.156) [-758.473] -- 0:01:32
656500 -- (-773.408) (-756.714) (-753.073) [-759.631] * (-766.739) [-762.734] (-759.923) (-758.153) -- 0:01:32
657000 -- (-766.938) (-760.182) [-758.223] (-768.271) * (-773.623) [-759.828] (-766.760) (-758.525) -- 0:01:31
657500 -- (-769.289) (-762.915) [-751.896] (-762.748) * (-762.286) (-772.732) (-762.165) [-759.392] -- 0:01:31
658000 -- (-760.308) (-766.816) (-760.783) [-757.079] * (-760.740) (-759.617) (-764.516) [-756.891] -- 0:01:31
658500 -- (-762.884) (-754.043) [-762.452] (-769.127) * (-759.875) [-758.350] (-764.062) (-756.622) -- 0:01:31
659000 -- (-768.472) (-759.608) [-753.383] (-761.024) * (-768.828) (-765.032) (-770.588) [-757.301] -- 0:01:31
659500 -- (-765.340) (-760.924) [-759.568] (-762.390) * (-757.555) [-757.776] (-772.725) (-764.082) -- 0:01:30
660000 -- (-765.516) [-761.740] (-765.594) (-767.070) * [-755.592] (-770.759) (-763.213) (-765.137) -- 0:01:31
Average standard deviation of split frequencies: 0.008856
660500 -- (-763.650) (-759.930) [-761.565] (-768.944) * [-761.080] (-767.795) (-770.795) (-758.450) -- 0:01:30
661000 -- (-761.493) (-760.043) [-752.027] (-760.208) * (-761.531) (-755.620) (-778.002) [-758.001] -- 0:01:30
661500 -- (-764.316) (-763.421) [-763.930] (-766.554) * (-772.437) [-767.446] (-766.795) (-759.464) -- 0:01:30
662000 -- (-761.767) [-759.850] (-758.902) (-765.807) * (-766.120) [-763.287] (-762.181) (-763.350) -- 0:01:30
662500 -- (-754.502) (-765.669) (-772.563) [-752.342] * (-765.400) (-759.285) (-757.593) [-763.559] -- 0:01:30
663000 -- [-763.341] (-761.819) (-762.206) (-759.492) * (-762.737) [-758.402] (-773.701) (-768.962) -- 0:01:29
663500 -- [-759.309] (-770.804) (-756.753) (-761.817) * (-756.886) (-758.714) [-762.720] (-772.488) -- 0:01:30
664000 -- (-766.760) (-773.425) (-758.550) [-760.501] * (-765.116) [-767.090] (-768.844) (-772.750) -- 0:01:30
664500 -- [-766.563] (-765.062) (-767.817) (-758.125) * [-756.248] (-755.659) (-774.816) (-765.047) -- 0:01:29
665000 -- (-756.515) (-758.245) (-763.486) [-756.496] * (-764.903) (-767.279) (-770.694) [-764.415] -- 0:01:29
Average standard deviation of split frequencies: 0.008827
665500 -- (-768.043) (-760.697) (-762.800) [-762.570] * (-761.400) (-757.524) [-754.903] (-763.939) -- 0:01:29
666000 -- (-765.482) (-759.886) (-752.673) [-760.700] * (-758.105) [-762.734] (-770.323) (-762.649) -- 0:01:29
666500 -- [-762.997] (-761.264) (-758.577) (-759.027) * (-778.209) [-757.812] (-767.937) (-754.914) -- 0:01:29
667000 -- (-768.710) (-757.287) (-777.938) [-763.912] * (-768.120) [-757.052] (-763.517) (-757.154) -- 0:01:28
667500 -- [-763.959] (-761.202) (-781.534) (-783.409) * (-766.461) (-764.563) (-761.372) [-760.056] -- 0:01:29
668000 -- (-763.626) (-762.795) (-768.529) [-759.267] * (-754.120) [-753.066] (-765.150) (-764.122) -- 0:01:28
668500 -- (-774.693) (-777.067) (-769.367) [-759.803] * [-760.171] (-771.960) (-753.950) (-765.175) -- 0:01:28
669000 -- (-760.973) (-764.813) (-757.081) [-764.519] * [-770.160] (-770.119) (-760.634) (-760.797) -- 0:01:28
669500 -- [-758.996] (-766.279) (-765.310) (-759.572) * (-775.430) (-759.659) (-766.512) [-758.891] -- 0:01:28
670000 -- (-762.107) [-755.644] (-762.507) (-760.748) * (-762.049) (-760.409) (-769.182) [-760.432] -- 0:01:28
Average standard deviation of split frequencies: 0.009510
670500 -- (-760.908) (-763.181) (-771.157) [-762.572] * [-760.662] (-778.563) (-768.466) (-765.495) -- 0:01:27
671000 -- (-762.864) (-757.070) (-753.604) [-758.555] * (-756.958) [-760.711] (-764.395) (-760.581) -- 0:01:28
671500 -- [-760.840] (-773.563) (-763.350) (-766.242) * (-754.912) (-763.417) [-754.938] (-765.855) -- 0:01:28
672000 -- (-763.984) (-771.179) [-757.476] (-764.372) * [-761.570] (-770.180) (-764.828) (-762.396) -- 0:01:27
672500 -- [-753.559] (-762.108) (-767.437) (-760.194) * (-755.939) (-759.959) (-765.074) [-759.038] -- 0:01:27
673000 -- [-757.034] (-764.389) (-761.008) (-758.535) * (-758.261) (-756.492) [-764.732] (-763.964) -- 0:01:27
673500 -- (-770.029) (-765.980) [-758.142] (-753.524) * (-764.688) [-763.071] (-774.858) (-766.368) -- 0:01:27
674000 -- (-765.386) (-762.077) (-766.743) [-758.672] * (-767.226) [-754.046] (-772.605) (-757.504) -- 0:01:27
674500 -- [-760.136] (-761.236) (-768.789) (-759.691) * (-759.157) (-759.629) [-760.372] (-752.208) -- 0:01:26
675000 -- (-758.600) (-765.300) [-757.815] (-765.280) * [-761.486] (-767.519) (-762.282) (-761.836) -- 0:01:27
Average standard deviation of split frequencies: 0.009681
675500 -- (-764.767) [-763.889] (-759.212) (-779.873) * (-764.131) (-759.872) [-762.140] (-757.780) -- 0:01:26
676000 -- (-769.439) [-759.763] (-763.491) (-773.231) * (-761.079) (-764.256) (-765.581) [-753.384] -- 0:01:26
676500 -- (-760.850) [-764.635] (-763.859) (-762.001) * (-764.868) (-760.943) [-757.458] (-762.800) -- 0:01:26
677000 -- [-758.256] (-762.500) (-763.444) (-764.860) * (-763.979) (-766.127) (-758.960) [-761.177] -- 0:01:26
677500 -- (-767.236) (-776.042) [-756.154] (-760.229) * (-762.101) [-764.164] (-759.836) (-772.444) -- 0:01:26
678000 -- (-763.985) [-765.558] (-764.771) (-765.577) * (-759.045) (-760.512) [-768.227] (-774.080) -- 0:01:25
678500 -- (-764.925) [-758.915] (-770.843) (-759.412) * (-767.657) [-765.637] (-764.696) (-775.172) -- 0:01:26
679000 -- (-760.942) [-751.653] (-772.394) (-764.084) * (-763.526) (-762.881) (-764.868) [-760.163] -- 0:01:26
679500 -- (-769.832) (-762.837) (-763.616) [-754.858] * (-760.178) (-767.882) [-762.129] (-772.005) -- 0:01:25
680000 -- [-761.986] (-769.380) (-754.773) (-763.223) * (-761.205) (-761.664) [-763.653] (-767.729) -- 0:01:25
Average standard deviation of split frequencies: 0.009329
680500 -- (-763.198) [-763.722] (-759.953) (-762.435) * [-764.938] (-769.311) (-761.559) (-766.504) -- 0:01:25
681000 -- (-772.711) (-757.302) [-757.497] (-762.334) * (-760.446) [-766.198] (-763.471) (-770.842) -- 0:01:25
681500 -- (-777.783) [-756.122] (-767.245) (-765.888) * (-754.893) [-763.387] (-770.288) (-773.713) -- 0:01:25
682000 -- (-766.453) (-756.073) (-763.102) [-755.972] * [-757.399] (-766.724) (-773.956) (-770.271) -- 0:01:24
682500 -- (-769.693) [-751.557] (-768.749) (-754.537) * (-755.032) (-757.260) (-765.370) [-762.407] -- 0:01:25
683000 -- (-767.089) (-765.268) (-754.088) [-757.805] * (-771.335) (-758.401) [-761.585] (-767.306) -- 0:01:24
683500 -- (-757.269) (-766.395) [-757.374] (-764.886) * (-766.442) (-769.801) [-756.785] (-762.164) -- 0:01:24
684000 -- [-763.564] (-768.676) (-763.506) (-758.699) * [-757.481] (-756.687) (-761.831) (-753.742) -- 0:01:24
684500 -- (-759.595) (-762.213) [-762.012] (-756.975) * [-761.502] (-771.161) (-769.620) (-767.076) -- 0:01:24
685000 -- (-765.422) [-756.646] (-776.113) (-770.176) * (-767.305) [-758.151] (-750.889) (-765.361) -- 0:01:24
Average standard deviation of split frequencies: 0.009095
685500 -- (-761.032) [-763.155] (-761.603) (-759.652) * [-752.954] (-767.485) (-761.386) (-759.186) -- 0:01:23
686000 -- (-767.418) (-762.275) [-759.519] (-767.596) * (-764.273) [-772.287] (-755.123) (-760.964) -- 0:01:23
686500 -- (-767.638) (-765.648) [-763.255] (-768.353) * (-757.110) (-766.990) (-763.808) [-763.918] -- 0:01:24
687000 -- (-755.833) (-767.768) [-753.031] (-768.742) * (-765.033) (-776.166) [-757.876] (-766.440) -- 0:01:23
687500 -- [-764.824] (-777.302) (-757.863) (-757.896) * (-765.335) [-760.304] (-760.340) (-770.829) -- 0:01:23
688000 -- (-764.357) (-766.525) [-769.479] (-759.711) * (-761.160) (-760.076) [-756.907] (-759.749) -- 0:01:23
688500 -- (-768.055) (-767.636) [-770.555] (-759.895) * (-762.596) (-760.258) (-768.347) [-758.089] -- 0:01:23
689000 -- (-764.769) (-774.098) [-753.659] (-765.337) * (-772.665) (-768.679) [-763.128] (-767.896) -- 0:01:23
689500 -- (-763.377) (-764.109) [-758.825] (-766.948) * [-765.476] (-767.841) (-767.916) (-756.958) -- 0:01:22
690000 -- (-759.283) [-756.310] (-762.506) (-766.084) * (-765.818) [-759.370] (-759.472) (-763.362) -- 0:01:23
Average standard deviation of split frequencies: 0.008311
690500 -- (-766.252) (-771.912) (-760.105) [-763.309] * (-762.595) [-761.565] (-765.445) (-764.153) -- 0:01:22
691000 -- (-761.080) (-765.194) [-758.600] (-769.333) * [-765.759] (-764.239) (-763.407) (-758.355) -- 0:01:22
691500 -- (-768.113) (-757.650) [-760.206] (-759.199) * (-770.676) (-768.513) (-758.751) [-765.240] -- 0:01:22
692000 -- (-761.751) [-762.622] (-762.513) (-765.664) * (-759.087) (-763.966) (-759.792) [-763.227] -- 0:01:22
692500 -- (-753.348) (-767.807) (-762.518) [-757.027] * (-762.651) (-768.985) (-754.757) [-754.904] -- 0:01:22
693000 -- (-760.247) [-764.475] (-763.958) (-756.577) * (-760.237) (-763.548) [-765.861] (-764.538) -- 0:01:21
693500 -- (-761.861) (-766.170) (-756.769) [-756.259] * [-753.060] (-764.024) (-763.853) (-789.303) -- 0:01:21
694000 -- (-766.065) [-772.788] (-759.782) (-762.841) * (-764.482) [-762.809] (-753.002) (-761.243) -- 0:01:22
694500 -- [-757.648] (-763.870) (-768.806) (-757.095) * [-760.171] (-757.630) (-761.962) (-772.259) -- 0:01:21
695000 -- [-765.723] (-775.364) (-764.179) (-773.645) * (-774.925) [-767.775] (-765.034) (-766.147) -- 0:01:21
Average standard deviation of split frequencies: 0.008407
695500 -- (-759.712) (-754.179) (-768.982) [-761.755] * (-768.574) (-765.130) (-766.216) [-760.929] -- 0:01:21
696000 -- (-760.767) [-757.560] (-763.879) (-769.067) * (-761.569) [-763.133] (-773.019) (-759.690) -- 0:01:21
696500 -- (-768.635) (-766.090) (-758.537) [-764.523] * [-751.475] (-780.306) (-770.964) (-759.783) -- 0:01:21
697000 -- (-758.797) (-758.214) [-759.029] (-758.375) * (-762.256) (-771.311) (-765.572) [-765.239] -- 0:01:20
697500 -- (-765.132) [-759.443] (-771.684) (-764.952) * (-764.311) [-760.809] (-773.818) (-768.727) -- 0:01:21
698000 -- (-758.561) (-761.276) (-763.892) [-760.040] * (-760.876) [-765.692] (-762.580) (-765.057) -- 0:01:20
698500 -- (-776.791) [-763.201] (-769.880) (-764.277) * (-763.684) (-764.920) [-754.651] (-765.614) -- 0:01:20
699000 -- (-763.306) (-768.577) (-763.845) [-761.145] * [-763.829] (-760.434) (-763.122) (-759.746) -- 0:01:20
699500 -- (-770.242) (-764.718) [-762.323] (-765.694) * (-764.806) [-761.518] (-765.635) (-772.045) -- 0:01:20
700000 -- (-767.593) (-761.624) [-761.823] (-759.611) * (-766.069) [-765.270] (-764.532) (-771.679) -- 0:01:20
Average standard deviation of split frequencies: 0.008113
700500 -- (-770.113) [-768.132] (-766.848) (-762.319) * (-765.305) [-759.154] (-751.601) (-760.939) -- 0:01:19
701000 -- (-762.897) (-765.995) (-774.000) [-757.131] * (-761.901) (-773.462) (-756.019) [-753.469] -- 0:01:19
701500 -- [-762.577] (-764.196) (-777.507) (-774.039) * (-761.005) (-762.080) [-762.629] (-762.145) -- 0:01:19
702000 -- [-757.040] (-762.030) (-770.045) (-763.834) * [-755.789] (-768.324) (-763.465) (-754.929) -- 0:01:19
702500 -- (-762.824) [-760.684] (-759.949) (-779.261) * (-763.226) [-768.616] (-768.841) (-763.932) -- 0:01:19
703000 -- (-755.876) (-762.717) (-765.695) [-754.804] * [-763.617] (-760.212) (-765.534) (-765.572) -- 0:01:19
703500 -- (-755.603) (-769.034) (-753.734) [-761.617] * (-771.673) (-762.406) (-758.033) [-754.579] -- 0:01:19
704000 -- (-761.468) [-754.108] (-760.688) (-762.986) * (-764.753) [-755.463] (-767.966) (-772.524) -- 0:01:19
704500 -- (-757.597) [-765.529] (-765.343) (-771.153) * (-760.411) [-753.493] (-764.438) (-765.495) -- 0:01:18
705000 -- (-755.424) [-767.389] (-768.077) (-770.596) * (-766.042) [-757.571] (-760.924) (-759.322) -- 0:01:19
Average standard deviation of split frequencies: 0.008091
705500 -- (-774.974) (-760.820) [-755.962] (-761.056) * (-767.497) [-756.221] (-762.247) (-765.870) -- 0:01:18
706000 -- (-768.878) (-770.565) [-757.019] (-768.825) * (-762.563) (-762.861) [-756.229] (-769.767) -- 0:01:18
706500 -- (-778.084) (-760.184) [-764.000] (-765.527) * (-764.393) (-766.958) (-763.705) [-759.502] -- 0:01:18
707000 -- (-762.297) (-759.635) [-754.765] (-771.760) * (-765.063) (-760.690) [-753.282] (-756.752) -- 0:01:18
707500 -- (-759.492) [-766.959] (-758.909) (-765.093) * (-767.070) (-766.161) (-764.597) [-760.417] -- 0:01:18
708000 -- (-771.892) [-762.945] (-761.187) (-767.139) * [-759.411] (-760.599) (-768.164) (-768.435) -- 0:01:17
708500 -- (-763.964) [-767.439] (-768.556) (-762.224) * (-763.334) (-761.423) (-764.678) [-751.123] -- 0:01:17
709000 -- (-752.270) [-764.169] (-760.705) (-764.176) * (-770.846) [-758.314] (-771.502) (-760.877) -- 0:01:17
709500 -- [-766.482] (-766.964) (-763.306) (-757.412) * (-760.180) [-756.609] (-769.256) (-771.757) -- 0:01:17
710000 -- (-768.197) (-764.321) (-769.535) [-762.770] * [-756.855] (-761.351) (-761.536) (-758.189) -- 0:01:17
Average standard deviation of split frequencies: 0.007687
710500 -- [-759.503] (-772.287) (-767.115) (-759.963) * [-751.149] (-756.968) (-761.407) (-758.967) -- 0:01:17
711000 -- [-768.895] (-759.184) (-763.362) (-763.526) * (-758.547) (-762.877) [-762.108] (-765.542) -- 0:01:17
711500 -- (-776.453) [-762.539] (-768.685) (-758.020) * (-771.669) [-765.574] (-763.921) (-758.607) -- 0:01:17
712000 -- (-769.434) [-759.148] (-762.662) (-758.469) * (-768.525) (-774.642) (-766.470) [-754.101] -- 0:01:16
712500 -- (-768.815) [-765.531] (-761.768) (-758.461) * [-765.874] (-766.779) (-768.365) (-762.387) -- 0:01:17
713000 -- [-761.225] (-763.598) (-776.029) (-771.062) * [-757.938] (-762.519) (-759.608) (-781.591) -- 0:01:16
713500 -- (-757.319) (-758.288) (-765.525) [-760.255] * [-760.089] (-764.287) (-762.023) (-778.262) -- 0:01:16
714000 -- [-756.520] (-761.168) (-771.100) (-762.292) * [-758.219] (-760.213) (-763.859) (-784.198) -- 0:01:16
714500 -- [-758.090] (-762.715) (-766.750) (-764.220) * [-752.173] (-761.391) (-762.234) (-771.181) -- 0:01:16
715000 -- [-756.716] (-763.021) (-766.811) (-761.618) * (-761.222) (-760.013) (-761.902) [-759.133] -- 0:01:16
Average standard deviation of split frequencies: 0.007707
715500 -- (-762.365) (-766.369) (-770.119) [-763.111] * (-764.127) [-767.347] (-762.940) (-768.826) -- 0:01:15
716000 -- (-768.633) (-771.040) [-761.190] (-755.992) * (-760.528) [-763.785] (-758.768) (-764.368) -- 0:01:15
716500 -- [-768.523] (-758.085) (-760.888) (-763.900) * (-760.256) (-763.813) [-765.218] (-763.556) -- 0:01:15
717000 -- (-766.564) (-765.532) [-753.538] (-757.461) * (-770.726) [-760.342] (-761.690) (-763.657) -- 0:01:15
717500 -- [-768.851] (-760.831) (-763.238) (-760.354) * (-762.642) (-762.863) (-772.982) [-764.938] -- 0:01:15
718000 -- (-758.211) (-765.032) [-755.015] (-759.169) * [-758.163] (-769.222) (-766.814) (-754.192) -- 0:01:15
718500 -- (-767.589) (-765.208) [-757.245] (-771.444) * (-761.439) (-761.637) [-762.116] (-761.765) -- 0:01:15
719000 -- (-766.913) (-761.084) (-766.723) [-758.807] * (-757.043) (-761.460) [-759.543] (-762.251) -- 0:01:15
719500 -- [-762.150] (-764.482) (-760.284) (-771.380) * (-755.973) (-768.524) [-757.956] (-768.923) -- 0:01:14
720000 -- (-773.296) [-757.437] (-757.983) (-762.300) * [-758.680] (-758.635) (-761.380) (-771.098) -- 0:01:15
Average standard deviation of split frequencies: 0.007542
720500 -- (-769.207) (-761.571) (-757.314) [-762.596] * [-764.155] (-759.995) (-764.063) (-772.556) -- 0:01:14
721000 -- (-763.151) (-759.813) [-766.222] (-760.909) * (-760.224) [-759.598] (-773.044) (-757.999) -- 0:01:14
721500 -- (-757.945) [-761.953] (-767.502) (-769.849) * (-770.591) (-775.145) [-753.210] (-760.984) -- 0:01:14
722000 -- [-755.078] (-758.138) (-758.353) (-771.916) * (-756.913) (-770.363) (-767.491) [-757.398] -- 0:01:14
722500 -- (-761.441) [-752.877] (-754.672) (-764.348) * (-759.253) (-763.131) [-759.193] (-764.697) -- 0:01:14
723000 -- (-762.891) [-757.447] (-760.333) (-764.293) * [-763.111] (-768.634) (-759.153) (-764.180) -- 0:01:13
723500 -- (-759.498) (-765.257) [-761.065] (-761.948) * (-759.573) (-760.436) [-757.412] (-772.933) -- 0:01:13
724000 -- (-764.112) (-765.638) (-763.403) [-765.667] * [-766.709] (-765.784) (-762.667) (-762.179) -- 0:01:13
724500 -- (-770.306) [-756.813] (-767.697) (-765.146) * [-761.542] (-761.765) (-759.415) (-759.939) -- 0:01:13
725000 -- (-766.245) [-756.770] (-767.211) (-761.550) * (-764.701) (-760.770) (-768.169) [-757.512] -- 0:01:13
Average standard deviation of split frequencies: 0.007410
725500 -- (-769.484) (-752.885) (-766.047) [-759.782] * (-763.693) (-760.072) [-755.284] (-770.064) -- 0:01:13
726000 -- (-775.069) (-764.468) (-770.959) [-756.277] * (-758.470) (-765.884) [-760.665] (-761.880) -- 0:01:13
726500 -- (-758.529) (-761.897) [-762.853] (-775.370) * [-766.542] (-772.587) (-770.671) (-763.315) -- 0:01:13
727000 -- [-757.922] (-765.736) (-761.660) (-759.504) * (-768.082) (-768.211) (-765.650) [-760.113] -- 0:01:12
727500 -- (-778.133) [-763.849] (-768.162) (-767.569) * (-759.868) (-771.822) (-765.030) [-756.671] -- 0:01:13
728000 -- (-765.994) (-769.217) (-765.770) [-755.034] * [-752.820] (-769.122) (-755.194) (-764.057) -- 0:01:12
728500 -- (-771.963) [-760.822] (-761.079) (-756.857) * (-762.051) (-760.760) [-757.169] (-761.107) -- 0:01:12
729000 -- [-771.651] (-775.384) (-772.539) (-763.517) * [-752.738] (-765.015) (-769.508) (-763.766) -- 0:01:12
729500 -- (-765.605) (-778.418) [-759.465] (-752.557) * [-759.258] (-760.010) (-779.275) (-771.705) -- 0:01:12
730000 -- (-754.400) (-773.310) (-782.313) [-756.545] * [-756.573] (-763.863) (-769.857) (-758.311) -- 0:01:12
Average standard deviation of split frequencies: 0.007363
730500 -- (-761.516) (-767.095) (-773.206) [-759.512] * [-759.310] (-761.111) (-764.140) (-765.737) -- 0:01:11
731000 -- (-766.093) (-771.423) (-762.695) [-758.730] * [-764.350] (-757.947) (-763.511) (-763.608) -- 0:01:11
731500 -- (-755.493) (-769.468) [-764.233] (-765.747) * (-765.333) (-762.161) (-761.109) [-768.301] -- 0:01:11
732000 -- [-754.392] (-764.630) (-769.747) (-761.337) * (-760.501) (-768.674) (-761.563) [-767.272] -- 0:01:11
732500 -- [-758.971] (-766.556) (-762.947) (-770.237) * (-766.328) (-758.791) [-761.388] (-766.757) -- 0:01:11
733000 -- (-765.262) [-759.204] (-762.807) (-765.220) * (-767.781) (-755.049) [-757.877] (-768.458) -- 0:01:11
733500 -- (-767.562) [-759.518] (-765.866) (-765.602) * (-761.198) (-758.764) [-764.086] (-756.073) -- 0:01:11
734000 -- (-763.239) (-770.241) (-757.640) [-756.406] * (-760.094) [-766.038] (-776.026) (-762.797) -- 0:01:11
734500 -- (-761.722) [-762.589] (-771.344) (-762.255) * [-758.785] (-767.213) (-763.739) (-767.135) -- 0:01:10
735000 -- (-756.535) [-762.397] (-781.615) (-769.949) * (-758.694) [-754.476] (-761.549) (-760.373) -- 0:01:11
Average standard deviation of split frequencies: 0.007611
735500 -- (-759.272) (-766.577) [-766.614] (-767.070) * (-760.771) (-758.758) (-768.254) [-761.303] -- 0:01:10
736000 -- (-756.790) (-769.122) [-756.707] (-759.347) * (-764.951) [-762.299] (-768.359) (-754.422) -- 0:01:10
736500 -- (-760.544) (-768.768) (-768.521) [-753.814] * (-761.309) [-758.797] (-763.744) (-767.301) -- 0:01:10
737000 -- (-771.610) [-758.634] (-756.657) (-763.752) * (-763.788) (-759.759) [-756.801] (-763.847) -- 0:01:10
737500 -- [-761.490] (-759.954) (-758.908) (-756.756) * [-755.613] (-758.526) (-762.962) (-763.217) -- 0:01:10
738000 -- (-774.173) (-765.546) [-759.370] (-759.449) * (-764.975) (-758.813) (-765.255) [-763.203] -- 0:01:09
738500 -- (-771.022) (-766.823) [-757.099] (-760.211) * [-755.124] (-761.836) (-767.534) (-761.909) -- 0:01:09
739000 -- (-761.499) (-758.599) [-748.907] (-765.034) * (-773.129) (-768.214) (-755.500) [-756.494] -- 0:01:09
739500 -- [-757.283] (-759.398) (-764.128) (-770.197) * (-765.889) (-760.198) (-771.377) [-761.751] -- 0:01:09
740000 -- (-769.720) (-764.950) [-758.757] (-766.524) * (-759.626) [-753.789] (-767.090) (-767.020) -- 0:01:09
Average standard deviation of split frequencies: 0.007525
740500 -- (-756.139) (-757.048) (-763.768) [-753.991] * (-761.949) (-776.277) [-756.466] (-762.119) -- 0:01:09
741000 -- (-770.210) (-756.032) (-761.415) [-759.973] * (-775.191) (-761.361) (-763.162) [-757.960] -- 0:01:09
741500 -- (-766.350) (-756.003) [-760.015] (-763.031) * [-754.197] (-761.603) (-759.604) (-758.524) -- 0:01:09
742000 -- (-764.548) (-762.487) [-754.282] (-760.698) * (-771.518) (-760.502) [-752.876] (-768.858) -- 0:01:08
742500 -- [-759.766] (-770.190) (-760.132) (-754.962) * (-758.188) (-768.503) [-753.017] (-776.120) -- 0:01:09
743000 -- (-756.352) (-771.657) [-765.387] (-764.689) * (-758.157) (-761.346) (-763.008) [-762.851] -- 0:01:08
743500 -- (-759.934) (-761.198) (-763.492) [-761.481] * [-755.600] (-760.683) (-754.153) (-762.623) -- 0:01:08
744000 -- (-768.044) [-759.105] (-759.201) (-756.687) * (-759.394) [-755.561] (-768.250) (-762.609) -- 0:01:08
744500 -- [-756.813] (-765.229) (-761.955) (-763.944) * (-766.251) (-756.094) [-758.603] (-763.157) -- 0:01:08
745000 -- [-758.854] (-765.860) (-767.381) (-759.087) * [-769.355] (-766.318) (-751.210) (-772.015) -- 0:01:08
Average standard deviation of split frequencies: 0.007806
745500 -- (-770.932) [-752.277] (-758.251) (-755.423) * [-763.102] (-769.870) (-766.147) (-765.602) -- 0:01:07
746000 -- (-777.944) [-756.381] (-764.719) (-768.041) * (-773.765) (-768.256) (-756.367) [-765.324] -- 0:01:07
746500 -- (-765.017) [-755.614] (-760.987) (-766.012) * (-773.360) [-755.236] (-757.838) (-771.944) -- 0:01:07
747000 -- [-763.932] (-760.655) (-769.729) (-757.918) * [-753.442] (-760.239) (-767.843) (-759.670) -- 0:01:07
747500 -- [-756.089] (-761.771) (-756.535) (-774.947) * (-756.787) (-764.002) [-755.569] (-763.733) -- 0:01:07
748000 -- (-761.384) (-771.401) (-756.477) [-762.105] * (-763.698) (-760.165) (-757.707) [-764.979] -- 0:01:07
748500 -- (-761.993) [-767.842] (-767.436) (-766.965) * [-758.968] (-757.658) (-764.112) (-758.597) -- 0:01:07
749000 -- [-759.612] (-761.898) (-767.942) (-761.043) * (-761.556) (-763.904) (-771.609) [-756.755] -- 0:01:07
749500 -- (-775.590) [-769.997] (-765.671) (-764.939) * (-764.997) (-776.171) (-767.145) [-759.980] -- 0:01:06
750000 -- (-769.799) (-764.727) [-760.335] (-764.524) * (-758.402) (-760.963) (-759.366) [-755.536] -- 0:01:07
Average standard deviation of split frequencies: 0.007831
750500 -- [-759.917] (-755.161) (-768.910) (-761.853) * (-753.367) (-756.248) [-754.463] (-764.840) -- 0:01:06
751000 -- (-764.143) (-759.133) [-761.168] (-765.239) * (-758.588) (-771.538) [-756.218] (-758.590) -- 0:01:06
751500 -- (-763.397) (-767.556) (-769.719) [-759.450] * [-759.707] (-773.111) (-758.089) (-759.096) -- 0:01:06
752000 -- (-767.064) [-763.821] (-772.365) (-766.554) * [-754.289] (-758.759) (-771.406) (-763.488) -- 0:01:06
752500 -- [-760.915] (-764.583) (-764.085) (-774.570) * [-766.041] (-763.398) (-786.204) (-776.098) -- 0:01:06
753000 -- (-760.923) [-761.064] (-770.003) (-765.851) * (-776.257) (-760.924) (-765.901) [-763.332] -- 0:01:05
753500 -- (-761.207) [-755.345] (-773.599) (-764.822) * (-757.565) (-770.444) (-766.183) [-767.434] -- 0:01:05
754000 -- (-762.321) (-765.321) (-759.803) [-762.792] * (-764.027) [-764.646] (-760.994) (-754.301) -- 0:01:05
754500 -- (-762.688) (-768.687) [-760.522] (-772.347) * (-759.714) [-754.558] (-764.283) (-769.125) -- 0:01:05
755000 -- [-770.241] (-761.309) (-759.877) (-757.990) * (-752.680) [-756.081] (-765.168) (-781.693) -- 0:01:05
Average standard deviation of split frequencies: 0.007813
755500 -- (-765.043) (-775.681) (-772.011) [-765.304] * (-770.042) (-759.485) (-761.692) [-767.216] -- 0:01:05
756000 -- [-763.428] (-765.086) (-759.152) (-765.065) * [-760.265] (-752.497) (-757.744) (-774.457) -- 0:01:05
756500 -- (-770.820) [-762.876] (-769.330) (-760.751) * (-764.314) (-760.371) [-757.636] (-773.790) -- 0:01:05
757000 -- (-769.745) [-756.856] (-755.738) (-759.534) * (-757.765) [-755.677] (-767.332) (-762.817) -- 0:01:04
757500 -- (-771.885) [-764.479] (-756.618) (-766.428) * (-767.405) (-761.265) [-760.564] (-760.660) -- 0:01:04
758000 -- (-775.566) (-763.941) (-769.454) [-767.757] * (-767.548) [-758.862] (-755.091) (-764.740) -- 0:01:04
758500 -- (-769.353) (-764.050) (-760.775) [-767.959] * (-767.742) [-757.001] (-768.267) (-764.543) -- 0:01:04
759000 -- (-765.320) (-773.095) (-761.601) [-759.215] * (-768.947) (-765.650) (-763.120) [-759.029] -- 0:01:04
759500 -- (-763.732) [-760.897] (-763.142) (-764.717) * (-765.531) [-757.310] (-767.674) (-763.543) -- 0:01:04
760000 -- (-770.772) [-767.478] (-764.883) (-768.097) * (-767.546) (-767.909) [-761.880] (-760.362) -- 0:01:04
Average standard deviation of split frequencies: 0.008020
760500 -- (-764.499) (-766.152) [-757.293] (-764.142) * (-766.471) (-762.477) (-758.677) [-754.433] -- 0:01:03
761000 -- (-764.891) (-771.896) [-766.105] (-771.143) * (-764.094) (-763.125) (-767.225) [-760.121] -- 0:01:03
761500 -- (-767.933) (-757.664) [-759.897] (-764.143) * (-777.321) (-764.253) (-754.111) [-765.800] -- 0:01:03
762000 -- (-757.694) (-768.220) [-763.354] (-774.575) * (-761.808) [-756.216] (-763.173) (-766.318) -- 0:01:03
762500 -- (-766.212) (-769.610) [-762.318] (-761.667) * (-766.012) (-766.668) [-754.835] (-759.125) -- 0:01:03
763000 -- (-765.579) (-757.511) (-756.920) [-767.764] * (-759.086) (-764.168) [-762.154] (-761.029) -- 0:01:03
763500 -- (-761.348) (-763.557) [-756.762] (-763.346) * (-751.503) (-762.770) (-774.366) [-762.048] -- 0:01:03
764000 -- (-763.076) (-764.585) (-762.695) [-760.993] * (-758.022) [-761.453] (-765.393) (-765.063) -- 0:01:03
764500 -- (-758.021) [-760.212] (-763.376) (-771.103) * (-765.482) [-755.498] (-764.904) (-763.953) -- 0:01:02
765000 -- [-759.271] (-762.797) (-767.524) (-775.056) * (-758.137) [-762.894] (-761.528) (-764.276) -- 0:01:02
Average standard deviation of split frequencies: 0.007747
765500 -- (-773.530) (-760.099) (-757.485) [-760.359] * (-767.101) (-757.388) (-766.737) [-758.710] -- 0:01:02
766000 -- [-763.653] (-763.936) (-766.113) (-758.054) * (-784.514) [-769.939] (-762.085) (-766.094) -- 0:01:02
766500 -- (-769.429) [-761.969] (-758.318) (-766.966) * (-765.516) (-769.897) (-769.975) [-759.329] -- 0:01:02
767000 -- (-762.801) (-762.624) [-758.170] (-763.006) * (-772.819) (-757.263) (-774.015) [-757.271] -- 0:01:02
767500 -- (-764.229) (-772.267) [-762.585] (-756.697) * [-771.240] (-767.114) (-760.970) (-757.631) -- 0:01:02
768000 -- [-757.519] (-770.129) (-760.213) (-763.686) * (-765.724) (-761.626) [-755.371] (-758.474) -- 0:01:01
768500 -- (-758.270) (-777.082) (-770.720) [-761.807] * (-756.887) (-763.860) (-754.965) [-763.108] -- 0:01:01
769000 -- (-759.621) [-756.088] (-770.774) (-761.014) * (-767.403) (-763.247) (-753.527) [-765.013] -- 0:01:01
769500 -- [-758.421] (-773.522) (-754.641) (-762.154) * (-773.856) (-758.420) [-762.819] (-764.349) -- 0:01:01
770000 -- [-761.964] (-777.661) (-758.503) (-765.687) * (-777.913) [-762.654] (-769.770) (-764.443) -- 0:01:01
Average standard deviation of split frequencies: 0.007844
770500 -- (-764.828) [-760.529] (-756.410) (-759.631) * (-759.838) (-762.581) [-758.894] (-772.479) -- 0:01:01
771000 -- (-758.305) [-766.480] (-757.035) (-774.758) * (-763.626) (-763.061) (-765.768) [-760.298] -- 0:01:01
771500 -- (-758.031) (-763.047) (-759.500) [-762.368] * (-758.845) (-761.473) (-760.694) [-755.062] -- 0:01:01
772000 -- [-758.903] (-771.851) (-764.150) (-758.151) * [-765.892] (-763.598) (-775.396) (-763.048) -- 0:01:00
772500 -- (-762.523) [-757.794] (-772.604) (-765.135) * (-767.032) [-761.141] (-756.955) (-764.205) -- 0:01:00
773000 -- [-759.269] (-765.275) (-755.263) (-768.852) * (-763.897) (-777.554) [-753.658] (-762.309) -- 0:01:00
773500 -- [-760.606] (-777.077) (-766.805) (-764.691) * (-761.030) (-764.216) (-763.214) [-767.119] -- 0:01:00
774000 -- (-760.852) [-760.466] (-766.231) (-766.714) * (-760.646) (-771.016) [-756.259] (-762.269) -- 0:01:00
774500 -- (-765.360) (-768.485) (-768.729) [-767.035] * [-772.853] (-761.844) (-757.053) (-763.064) -- 0:01:00
775000 -- (-763.987) [-764.028] (-767.657) (-760.296) * (-762.108) [-760.432] (-760.918) (-770.961) -- 0:01:00
Average standard deviation of split frequencies: 0.008290
775500 -- (-764.990) (-771.701) (-765.087) [-760.248] * (-762.649) (-767.906) [-754.813] (-771.134) -- 0:00:59
776000 -- (-765.832) (-757.867) (-769.074) [-762.203] * (-773.668) (-759.157) [-764.480] (-773.147) -- 0:00:59
776500 -- (-757.481) (-755.167) (-765.800) [-767.247] * (-770.352) (-764.901) [-765.259] (-768.973) -- 0:00:59
777000 -- (-767.198) [-763.155] (-774.965) (-763.580) * (-772.067) (-766.965) (-752.739) [-760.430] -- 0:00:59
777500 -- (-759.581) (-764.473) [-760.525] (-761.363) * (-761.507) (-769.961) (-758.294) [-758.266] -- 0:00:59
778000 -- [-754.441] (-771.410) (-755.241) (-767.601) * (-759.676) [-761.966] (-762.082) (-762.367) -- 0:00:59
778500 -- (-759.928) (-763.500) (-771.541) [-770.541] * (-758.717) (-766.560) [-756.999] (-768.597) -- 0:00:59
779000 -- (-766.380) (-762.804) [-759.154] (-773.881) * (-773.027) [-766.718] (-764.771) (-762.510) -- 0:00:59
779500 -- (-761.291) [-760.271] (-759.070) (-768.546) * (-761.408) [-753.996] (-760.658) (-764.714) -- 0:00:58
780000 -- (-751.811) (-771.077) (-769.666) [-756.832] * (-759.032) (-764.015) [-759.673] (-764.464) -- 0:00:58
Average standard deviation of split frequencies: 0.008809
780500 -- (-756.558) (-759.455) [-762.779] (-766.325) * [-755.632] (-767.867) (-763.931) (-766.185) -- 0:00:58
781000 -- (-755.769) (-757.527) (-761.248) [-761.433] * [-761.176] (-773.259) (-761.196) (-762.877) -- 0:00:58
781500 -- [-759.572] (-760.428) (-759.599) (-755.775) * (-756.778) (-763.746) (-762.456) [-755.818] -- 0:00:58
782000 -- (-770.623) [-760.613] (-776.894) (-766.058) * (-764.755) [-757.048] (-757.432) (-758.550) -- 0:00:58
782500 -- (-769.764) (-762.695) (-762.977) [-755.226] * (-773.682) (-758.222) [-768.252] (-762.588) -- 0:00:58
783000 -- (-768.096) (-765.696) (-767.456) [-751.673] * (-773.108) [-755.526] (-764.027) (-765.246) -- 0:00:57
783500 -- (-776.841) (-757.216) (-769.104) [-760.618] * (-766.848) (-759.510) (-768.314) [-766.008] -- 0:00:58
784000 -- (-761.426) (-757.427) (-767.698) [-766.101] * (-760.906) (-761.858) [-758.592] (-760.317) -- 0:00:57
784500 -- (-768.190) [-759.373] (-758.372) (-765.971) * (-758.373) (-768.338) (-764.867) [-755.978] -- 0:00:57
785000 -- (-770.229) (-774.613) (-764.508) [-762.539] * [-756.394] (-766.069) (-765.701) (-766.177) -- 0:00:57
Average standard deviation of split frequencies: 0.008255
785500 -- (-762.076) [-761.817] (-763.310) (-759.448) * (-761.706) [-761.191] (-761.156) (-768.035) -- 0:00:57
786000 -- (-759.145) (-754.723) [-760.584] (-764.294) * (-764.878) (-765.515) [-758.626] (-761.928) -- 0:00:57
786500 -- [-755.136] (-763.406) (-757.584) (-759.926) * (-764.682) (-760.298) (-772.175) [-755.741] -- 0:00:57
787000 -- (-758.521) (-763.275) [-753.604] (-764.311) * (-758.920) (-761.954) [-761.741] (-763.260) -- 0:00:56
787500 -- (-759.331) (-759.037) [-759.170] (-766.388) * (-761.564) (-759.105) (-760.556) [-763.858] -- 0:00:56
788000 -- (-758.749) (-758.773) (-770.313) [-765.133] * (-772.895) (-769.773) [-760.002] (-756.370) -- 0:00:56
788500 -- [-760.987] (-772.252) (-767.789) (-760.801) * (-770.460) (-759.832) (-755.487) [-761.989] -- 0:00:56
789000 -- (-763.614) (-759.937) (-770.956) [-762.265] * (-761.253) (-765.520) [-756.077] (-762.706) -- 0:00:56
789500 -- (-763.334) (-768.361) (-768.847) [-755.605] * (-760.250) (-760.411) [-759.757] (-766.176) -- 0:00:56
790000 -- (-769.944) [-772.021] (-762.358) (-771.678) * (-761.780) [-763.182] (-758.997) (-763.539) -- 0:00:56
Average standard deviation of split frequencies: 0.008347
790500 -- (-770.382) (-777.722) (-759.665) [-773.535] * [-767.345] (-764.244) (-757.491) (-768.060) -- 0:00:55
791000 -- (-756.883) (-773.126) [-755.864] (-772.839) * (-761.730) (-774.997) [-757.590] (-764.923) -- 0:00:56
791500 -- [-757.570] (-771.468) (-755.314) (-758.341) * [-764.827] (-781.007) (-766.682) (-775.823) -- 0:00:55
792000 -- (-761.198) [-770.581] (-766.678) (-766.562) * (-758.965) (-768.498) (-763.181) [-766.417] -- 0:00:55
792500 -- (-767.035) (-771.555) [-754.961] (-757.199) * (-755.739) (-788.047) (-761.030) [-763.798] -- 0:00:55
793000 -- (-764.588) [-769.010] (-767.770) (-764.239) * (-758.337) (-775.142) (-762.662) [-757.966] -- 0:00:55
793500 -- (-762.882) (-772.261) [-765.489] (-772.013) * [-754.646] (-769.001) (-761.947) (-755.987) -- 0:00:55
794000 -- (-760.970) [-758.230] (-758.180) (-768.515) * (-760.795) (-767.867) [-760.478] (-756.448) -- 0:00:55
794500 -- (-768.258) (-767.934) [-757.838] (-756.554) * (-756.756) (-768.671) (-772.472) [-759.373] -- 0:00:54
795000 -- (-765.797) [-759.927] (-767.259) (-768.926) * (-763.049) (-766.076) [-760.235] (-756.981) -- 0:00:54
Average standard deviation of split frequencies: 0.008152
795500 -- [-763.971] (-758.517) (-771.439) (-766.899) * (-764.892) [-759.021] (-763.776) (-764.663) -- 0:00:54
796000 -- (-763.670) [-757.713] (-765.348) (-762.462) * (-764.570) (-762.892) (-768.416) [-762.054] -- 0:00:54
796500 -- (-761.681) [-757.123] (-764.240) (-757.378) * [-759.130] (-771.982) (-767.683) (-766.980) -- 0:00:54
797000 -- (-760.170) (-761.024) [-763.923] (-760.494) * (-764.819) (-759.247) (-762.624) [-759.106] -- 0:00:54
797500 -- (-758.833) [-759.172] (-758.778) (-764.977) * (-753.634) [-757.304] (-753.832) (-773.197) -- 0:00:54
798000 -- (-770.830) (-768.595) [-758.950] (-773.174) * (-763.858) (-764.851) (-760.983) [-764.531] -- 0:00:53
798500 -- (-762.708) (-762.970) (-758.665) [-764.439] * (-757.018) (-758.221) [-758.292] (-760.207) -- 0:00:54
799000 -- (-771.003) (-758.773) (-764.592) [-752.134] * (-760.864) [-758.436] (-760.522) (-759.774) -- 0:00:53
799500 -- (-758.847) (-760.952) (-757.787) [-766.385] * [-772.417] (-758.750) (-762.001) (-764.128) -- 0:00:53
800000 -- (-760.362) (-759.214) [-754.295] (-764.612) * (-766.290) (-778.138) (-764.909) [-755.835] -- 0:00:53
Average standard deviation of split frequencies: 0.007966
800500 -- (-762.777) (-759.967) [-751.608] (-764.168) * (-761.810) (-766.908) [-751.996] (-760.793) -- 0:00:53
801000 -- (-767.633) (-765.169) (-759.854) [-763.880] * [-770.763] (-759.216) (-758.574) (-765.331) -- 0:00:53
801500 -- (-760.108) [-764.226] (-764.506) (-760.295) * [-758.128] (-763.330) (-761.391) (-762.409) -- 0:00:52
802000 -- (-773.127) (-764.170) (-764.169) [-758.315] * [-758.919] (-759.678) (-758.063) (-757.442) -- 0:00:52
802500 -- (-763.304) (-765.975) [-759.878] (-763.808) * (-763.326) (-782.953) (-758.005) [-759.149] -- 0:00:52
803000 -- (-761.492) (-770.824) (-767.664) [-767.796] * (-758.705) (-761.612) (-760.890) [-757.374] -- 0:00:52
803500 -- (-762.775) [-753.971] (-768.949) (-770.688) * (-773.653) (-768.195) [-767.354] (-768.413) -- 0:00:52
804000 -- (-771.070) (-756.968) (-765.854) [-758.481] * (-760.335) (-759.576) (-760.985) [-763.166] -- 0:00:52
804500 -- (-763.943) [-756.126] (-769.448) (-763.480) * (-765.360) (-761.450) [-753.886] (-772.787) -- 0:00:52
805000 -- (-766.353) (-768.832) (-771.484) [-765.345] * (-759.907) (-767.152) [-754.051] (-763.108) -- 0:00:52
Average standard deviation of split frequencies: 0.008188
805500 -- (-766.986) (-762.584) (-768.299) [-762.424] * (-770.502) (-762.690) (-755.853) [-769.928] -- 0:00:51
806000 -- (-766.012) (-773.263) (-757.594) [-756.679] * (-772.795) [-756.956] (-775.743) (-763.632) -- 0:00:51
806500 -- (-763.139) (-762.224) (-756.659) [-763.970] * (-765.538) (-762.087) [-754.313] (-755.150) -- 0:00:51
807000 -- (-767.901) (-772.157) [-758.637] (-768.787) * (-772.197) [-756.690] (-756.118) (-763.821) -- 0:00:51
807500 -- [-757.168] (-761.537) (-771.051) (-761.247) * (-763.711) [-753.908] (-769.140) (-757.408) -- 0:00:51
808000 -- [-759.725] (-769.003) (-769.559) (-765.025) * [-752.590] (-766.315) (-766.843) (-769.635) -- 0:00:51
808500 -- (-762.502) [-767.726] (-764.402) (-756.441) * (-762.848) (-765.216) [-754.704] (-760.685) -- 0:00:51
809000 -- (-754.832) (-774.993) [-762.028] (-771.269) * (-760.181) (-772.027) [-768.732] (-764.134) -- 0:00:50
809500 -- (-763.442) (-768.099) [-759.606] (-771.918) * (-761.186) [-761.681] (-763.296) (-769.849) -- 0:00:50
810000 -- (-760.324) (-760.103) (-764.056) [-766.639] * (-760.917) [-755.926] (-771.035) (-767.283) -- 0:00:50
Average standard deviation of split frequencies: 0.008483
810500 -- [-759.044] (-774.469) (-763.831) (-763.239) * (-761.464) (-766.665) (-761.346) [-763.812] -- 0:00:50
811000 -- [-758.331] (-772.000) (-764.782) (-766.222) * (-775.407) [-761.134] (-769.796) (-761.514) -- 0:00:50
811500 -- (-765.240) (-766.264) (-766.922) [-755.057] * (-758.267) (-760.413) [-756.456] (-758.497) -- 0:00:50
812000 -- [-756.937] (-759.664) (-764.839) (-768.771) * (-772.075) [-761.422] (-763.047) (-771.191) -- 0:00:50
812500 -- [-764.266] (-765.507) (-770.155) (-754.902) * (-759.493) (-756.942) [-765.237] (-779.852) -- 0:00:50
813000 -- (-765.280) [-749.887] (-754.298) (-762.920) * (-773.949) (-756.771) (-755.404) [-769.618] -- 0:00:49
813500 -- (-765.585) (-761.181) [-758.038] (-767.456) * [-755.487] (-761.868) (-755.020) (-771.293) -- 0:00:49
814000 -- (-766.823) (-760.724) (-764.814) [-755.320] * (-762.775) [-754.608] (-761.533) (-758.717) -- 0:00:49
814500 -- (-765.272) (-760.666) [-767.170] (-772.787) * (-773.342) [-758.454] (-767.471) (-759.568) -- 0:00:49
815000 -- [-755.691] (-771.186) (-767.219) (-773.780) * (-758.801) (-758.848) (-765.059) [-759.506] -- 0:00:49
Average standard deviation of split frequencies: 0.008122
815500 -- (-759.679) [-755.300] (-761.657) (-760.777) * (-770.239) (-776.035) [-767.036] (-756.648) -- 0:00:49
816000 -- [-760.790] (-764.001) (-757.952) (-763.764) * (-777.017) (-766.732) [-763.750] (-763.641) -- 0:00:49
816500 -- (-763.599) [-758.191] (-762.938) (-777.722) * [-759.607] (-764.083) (-763.139) (-766.457) -- 0:00:48
817000 -- (-764.227) [-757.548] (-769.679) (-773.101) * (-763.043) (-762.106) [-764.330] (-762.916) -- 0:00:48
817500 -- (-764.320) [-761.913] (-753.428) (-770.545) * (-765.162) (-762.040) (-765.055) [-765.332] -- 0:00:48
818000 -- (-762.848) [-755.229] (-761.130) (-760.273) * (-764.235) (-773.571) [-757.311] (-760.786) -- 0:00:48
818500 -- (-768.577) [-753.907] (-761.325) (-765.647) * (-762.318) (-771.169) [-764.006] (-762.785) -- 0:00:48
819000 -- (-766.042) (-767.776) [-764.928] (-756.858) * (-765.488) (-762.148) [-762.034] (-765.134) -- 0:00:48
819500 -- (-768.505) (-764.745) (-755.651) [-761.101] * (-767.728) [-762.790] (-762.652) (-769.028) -- 0:00:48
820000 -- [-757.768] (-765.805) (-765.935) (-770.321) * (-763.474) (-760.606) (-771.307) [-764.370] -- 0:00:48
Average standard deviation of split frequencies: 0.008650
820500 -- (-763.541) (-758.849) (-762.350) [-757.934] * [-762.181] (-769.057) (-766.304) (-765.845) -- 0:00:47
821000 -- (-764.786) [-764.031] (-761.973) (-759.319) * [-756.895] (-757.214) (-761.082) (-773.067) -- 0:00:47
821500 -- (-756.689) (-762.544) [-763.802] (-763.161) * (-765.765) (-765.854) [-759.084] (-768.749) -- 0:00:47
822000 -- [-756.428] (-768.911) (-764.497) (-764.331) * (-763.368) (-766.275) [-753.513] (-759.234) -- 0:00:47
822500 -- (-768.391) [-760.629] (-769.426) (-761.496) * [-759.136] (-760.104) (-764.161) (-768.530) -- 0:00:47
823000 -- [-765.706] (-765.322) (-771.243) (-760.818) * (-761.613) (-772.983) [-757.399] (-775.241) -- 0:00:47
823500 -- (-763.829) (-759.807) [-762.684] (-761.442) * [-750.583] (-764.573) (-767.869) (-770.072) -- 0:00:47
824000 -- [-758.348] (-761.242) (-766.633) (-760.843) * [-756.140] (-759.252) (-763.054) (-771.667) -- 0:00:46
824500 -- (-769.298) (-759.799) (-761.562) [-754.846] * [-754.595] (-762.975) (-765.757) (-764.453) -- 0:00:46
825000 -- (-773.940) [-761.229] (-757.229) (-767.856) * (-759.528) [-755.345] (-767.789) (-765.283) -- 0:00:46
Average standard deviation of split frequencies: 0.007889
825500 -- (-771.012) (-757.861) (-760.332) [-757.819] * (-763.826) [-760.041] (-772.783) (-767.834) -- 0:00:46
826000 -- (-761.552) [-762.874] (-762.619) (-760.155) * (-761.748) (-767.115) (-764.925) [-759.397] -- 0:00:46
826500 -- [-762.390] (-767.750) (-764.213) (-760.388) * (-759.739) (-764.101) [-759.993] (-760.107) -- 0:00:46
827000 -- [-771.465] (-761.930) (-758.275) (-763.979) * [-773.064] (-765.043) (-762.937) (-758.540) -- 0:00:46
827500 -- (-761.197) (-757.511) (-767.259) [-773.167] * [-758.686] (-761.364) (-773.464) (-762.854) -- 0:00:46
828000 -- (-762.757) (-762.822) [-758.918] (-765.004) * (-763.287) [-759.063] (-766.160) (-761.117) -- 0:00:45
828500 -- [-765.387] (-767.967) (-757.535) (-762.915) * (-760.479) [-767.470] (-767.237) (-764.532) -- 0:00:45
829000 -- (-765.967) (-772.835) [-759.897] (-763.119) * [-758.403] (-771.576) (-765.982) (-762.428) -- 0:00:45
829500 -- (-765.381) (-767.941) (-776.069) [-752.935] * (-759.626) (-765.412) [-756.328] (-773.286) -- 0:00:45
830000 -- (-772.494) (-759.950) (-759.762) [-752.655] * (-768.087) [-765.617] (-764.054) (-759.194) -- 0:00:45
Average standard deviation of split frequencies: 0.007645
830500 -- [-761.824] (-760.327) (-759.760) (-762.830) * (-765.675) (-766.997) [-770.774] (-757.392) -- 0:00:45
831000 -- (-764.122) [-767.874] (-768.556) (-764.265) * (-765.477) (-765.415) [-754.134] (-757.461) -- 0:00:45
831500 -- (-760.773) [-757.930] (-756.879) (-768.972) * (-762.347) (-759.827) [-761.051] (-769.780) -- 0:00:44
832000 -- (-771.898) (-760.248) (-759.302) [-763.399] * (-757.306) [-767.278] (-759.279) (-771.733) -- 0:00:44
832500 -- (-760.315) [-756.762] (-761.499) (-766.545) * [-756.392] (-761.203) (-766.435) (-764.921) -- 0:00:44
833000 -- [-758.001] (-765.839) (-772.358) (-764.559) * [-760.750] (-760.393) (-759.261) (-766.671) -- 0:00:44
833500 -- [-757.070] (-761.817) (-767.475) (-755.453) * (-764.455) (-765.008) [-758.766] (-766.586) -- 0:00:44
834000 -- (-762.049) (-771.055) [-768.408] (-770.984) * (-768.336) (-763.319) [-761.013] (-763.345) -- 0:00:44
834500 -- [-761.267] (-765.231) (-770.143) (-752.465) * (-758.924) (-761.121) [-756.976] (-762.260) -- 0:00:44
835000 -- (-766.504) [-758.011] (-770.890) (-762.182) * (-772.722) (-759.717) (-760.287) [-758.696] -- 0:00:44
Average standard deviation of split frequencies: 0.007695
835500 -- (-773.586) (-762.506) [-752.050] (-766.706) * (-775.984) (-757.924) (-760.689) [-763.134] -- 0:00:43
836000 -- (-759.171) [-762.160] (-761.101) (-769.787) * (-770.197) (-775.153) (-762.921) [-756.950] -- 0:00:43
836500 -- (-774.725) (-759.352) (-768.081) [-772.501] * (-776.282) (-762.301) [-759.940] (-759.281) -- 0:00:43
837000 -- [-756.876] (-759.339) (-766.096) (-777.927) * (-767.076) (-761.773) (-767.287) [-757.115] -- 0:00:43
837500 -- (-755.342) (-766.390) [-759.154] (-769.345) * (-771.411) [-763.912] (-760.841) (-757.518) -- 0:00:43
838000 -- (-763.398) (-772.414) [-754.882] (-757.129) * (-761.036) [-767.138] (-763.575) (-764.655) -- 0:00:43
838500 -- (-769.584) (-762.066) [-758.438] (-765.019) * [-766.951] (-767.382) (-768.899) (-762.464) -- 0:00:43
839000 -- [-760.122] (-767.676) (-765.455) (-764.872) * (-758.666) (-764.090) [-760.264] (-771.303) -- 0:00:42
839500 -- (-766.541) (-764.175) [-762.851] (-768.329) * (-762.353) (-767.176) (-764.298) [-764.929] -- 0:00:42
840000 -- [-752.966] (-767.166) (-765.175) (-762.823) * (-764.053) [-760.550] (-765.504) (-760.939) -- 0:00:42
Average standard deviation of split frequencies: 0.007158
840500 -- (-773.803) (-752.841) [-764.623] (-763.133) * (-770.288) (-770.586) (-772.101) [-761.387] -- 0:00:42
841000 -- (-769.420) (-765.102) [-757.094] (-763.668) * (-755.577) (-767.163) (-767.620) [-773.019] -- 0:00:42
841500 -- [-762.006] (-754.832) (-766.697) (-766.304) * [-763.983] (-758.620) (-762.546) (-766.856) -- 0:00:42
842000 -- (-764.190) (-759.406) (-763.057) [-755.067] * [-762.105] (-757.195) (-762.299) (-755.530) -- 0:00:42
842500 -- (-767.441) (-762.809) [-761.498] (-768.582) * (-771.304) (-762.173) [-762.902] (-767.544) -- 0:00:42
843000 -- (-761.939) [-758.826] (-759.051) (-761.272) * (-769.171) (-765.801) [-768.859] (-768.297) -- 0:00:41
843500 -- (-767.661) (-761.089) (-758.462) [-754.926] * (-762.475) [-764.474] (-765.449) (-768.601) -- 0:00:41
844000 -- (-764.075) (-759.607) [-767.523] (-763.812) * [-761.423] (-766.590) (-772.971) (-762.403) -- 0:00:41
844500 -- (-756.132) [-761.629] (-760.835) (-770.416) * (-767.791) [-762.900] (-771.640) (-774.092) -- 0:00:41
845000 -- (-767.266) (-767.701) (-775.428) [-765.427] * (-753.580) (-764.947) [-764.525] (-772.313) -- 0:00:41
Average standard deviation of split frequencies: 0.007211
845500 -- (-764.627) (-763.684) (-768.728) [-763.096] * [-755.343] (-762.431) (-769.201) (-760.809) -- 0:00:41
846000 -- (-753.723) [-758.150] (-769.750) (-765.504) * (-761.831) [-762.401] (-767.019) (-756.423) -- 0:00:41
846500 -- (-769.047) [-757.562] (-763.009) (-761.215) * (-769.410) (-764.653) [-756.941] (-761.303) -- 0:00:40
847000 -- [-760.944] (-768.923) (-763.681) (-762.470) * (-762.485) (-765.070) [-759.895] (-756.155) -- 0:00:40
847500 -- (-763.794) [-760.050] (-758.964) (-768.367) * (-764.833) (-758.040) [-760.204] (-767.324) -- 0:00:40
848000 -- [-756.556] (-759.881) (-761.051) (-762.353) * (-768.050) (-759.861) (-760.527) [-755.786] -- 0:00:40
848500 -- (-764.235) (-760.295) (-762.601) [-762.343] * (-761.835) (-762.485) [-751.173] (-764.527) -- 0:00:40
849000 -- (-764.977) (-771.220) [-758.077] (-755.196) * (-764.751) (-762.337) [-762.880] (-758.408) -- 0:00:40
849500 -- [-767.230] (-768.071) (-766.285) (-762.023) * [-767.808] (-764.121) (-758.940) (-761.643) -- 0:00:40
850000 -- (-757.922) (-764.592) (-763.561) [-751.288] * [-770.844] (-759.146) (-767.859) (-771.143) -- 0:00:40
Average standard deviation of split frequencies: 0.007041
850500 -- (-757.457) [-766.241] (-766.337) (-778.533) * [-755.782] (-757.889) (-765.918) (-768.313) -- 0:00:39
851000 -- (-764.352) [-754.675] (-757.703) (-760.206) * [-760.196] (-754.810) (-762.462) (-770.173) -- 0:00:39
851500 -- (-770.548) [-761.059] (-758.310) (-768.425) * (-766.406) (-759.724) [-758.211] (-762.560) -- 0:00:39
852000 -- (-764.387) (-768.225) [-768.602] (-760.951) * [-764.228] (-773.931) (-761.453) (-765.084) -- 0:00:39
852500 -- [-760.757] (-759.755) (-764.207) (-762.411) * [-760.911] (-757.156) (-752.789) (-770.752) -- 0:00:39
853000 -- [-761.423] (-759.693) (-761.190) (-768.153) * (-759.684) (-759.269) (-772.592) [-768.756] -- 0:00:39
853500 -- (-761.774) (-760.282) [-755.610] (-775.534) * (-766.165) (-762.489) [-762.638] (-776.405) -- 0:00:39
854000 -- (-763.037) (-763.822) [-752.202] (-767.525) * (-767.587) [-759.959] (-764.890) (-766.920) -- 0:00:38
854500 -- (-776.940) (-765.056) (-761.981) [-754.830] * (-766.047) (-768.833) [-765.021] (-770.196) -- 0:00:38
855000 -- (-761.779) (-776.720) [-769.871] (-763.951) * (-764.739) (-766.350) (-761.170) [-758.213] -- 0:00:38
Average standard deviation of split frequencies: 0.007354
855500 -- (-760.982) (-761.984) (-779.694) [-763.177] * (-752.629) [-757.140] (-771.454) (-772.102) -- 0:00:38
856000 -- (-762.335) (-764.383) (-758.669) [-752.453] * (-777.334) (-764.660) [-757.721] (-763.042) -- 0:00:38
856500 -- (-770.062) (-767.423) [-760.695] (-756.307) * (-759.276) (-763.832) [-757.969] (-763.920) -- 0:00:38
857000 -- [-759.530] (-765.534) (-759.800) (-772.760) * (-759.413) [-759.404] (-763.465) (-764.685) -- 0:00:38
857500 -- (-763.171) [-758.889] (-761.935) (-767.334) * (-759.465) (-769.848) (-775.362) [-753.406] -- 0:00:38
858000 -- (-763.983) [-761.043] (-759.666) (-772.590) * (-768.058) (-766.014) (-765.672) [-769.567] -- 0:00:37
858500 -- (-770.313) [-776.104] (-763.821) (-767.190) * (-757.652) (-763.999) (-763.563) [-761.062] -- 0:00:37
859000 -- (-770.433) [-763.259] (-768.118) (-763.545) * (-764.072) [-759.914] (-773.235) (-763.462) -- 0:00:37
859500 -- [-765.225] (-772.120) (-767.004) (-755.962) * [-759.229] (-759.567) (-762.256) (-771.367) -- 0:00:37
860000 -- [-759.816] (-754.972) (-766.823) (-763.373) * (-766.929) (-762.467) [-760.600] (-760.862) -- 0:00:37
Average standard deviation of split frequencies: 0.007120
860500 -- (-769.171) [-758.269] (-755.497) (-761.371) * (-762.972) [-761.536] (-760.798) (-761.559) -- 0:00:37
861000 -- [-759.069] (-767.467) (-762.983) (-762.050) * [-754.083] (-765.225) (-768.870) (-767.242) -- 0:00:37
861500 -- (-761.643) (-767.011) (-768.680) [-760.961] * (-765.818) (-770.944) (-763.974) [-758.133] -- 0:00:36
862000 -- [-761.624] (-758.513) (-763.446) (-767.895) * (-764.272) (-760.272) [-770.718] (-761.977) -- 0:00:36
862500 -- [-759.672] (-768.807) (-764.716) (-760.555) * [-756.692] (-756.734) (-761.404) (-763.024) -- 0:00:36
863000 -- [-757.572] (-764.203) (-762.285) (-775.586) * (-755.647) (-758.669) [-764.695] (-764.645) -- 0:00:36
863500 -- (-771.562) [-767.686] (-769.384) (-767.144) * (-754.125) [-756.532] (-754.914) (-764.205) -- 0:00:36
864000 -- (-761.851) (-776.507) [-762.934] (-773.202) * [-762.917] (-771.099) (-768.491) (-763.472) -- 0:00:36
864500 -- (-765.630) (-764.560) [-770.412] (-768.726) * (-776.122) (-761.925) [-762.580] (-761.973) -- 0:00:36
865000 -- (-772.845) (-765.457) (-757.470) [-759.746] * (-768.310) (-765.588) (-760.312) [-753.545] -- 0:00:36
Average standard deviation of split frequencies: 0.006916
865500 -- (-760.353) [-769.108] (-762.024) (-758.520) * (-767.807) (-760.273) [-757.584] (-754.951) -- 0:00:35
866000 -- (-756.234) (-769.174) (-757.854) [-763.106] * (-768.677) [-758.308] (-761.257) (-759.347) -- 0:00:35
866500 -- (-759.401) (-761.391) (-754.903) [-754.409] * (-761.833) (-769.860) (-770.917) [-761.131] -- 0:00:35
867000 -- [-752.899] (-768.391) (-767.398) (-763.990) * [-756.667] (-764.626) (-764.583) (-756.356) -- 0:00:35
867500 -- [-754.553] (-763.635) (-754.814) (-763.114) * (-773.057) (-767.423) [-759.616] (-755.766) -- 0:00:35
868000 -- (-754.372) [-754.116] (-761.794) (-776.438) * [-760.443] (-761.381) (-756.412) (-762.454) -- 0:00:35
868500 -- (-766.912) (-761.315) (-766.440) [-761.989] * [-770.477] (-766.713) (-760.092) (-758.332) -- 0:00:35
869000 -- (-770.651) [-757.514] (-763.828) (-761.634) * (-774.841) [-760.259] (-769.464) (-761.501) -- 0:00:34
869500 -- (-767.812) (-768.376) [-758.664] (-768.711) * [-772.339] (-756.871) (-754.221) (-759.787) -- 0:00:34
870000 -- (-761.369) [-761.619] (-768.381) (-770.528) * (-765.600) (-766.052) (-769.221) [-765.549] -- 0:00:34
Average standard deviation of split frequencies: 0.006911
870500 -- (-765.156) (-767.620) (-762.155) [-764.230] * (-759.480) (-759.350) [-766.766] (-764.923) -- 0:00:34
871000 -- (-756.810) [-766.771] (-764.401) (-759.629) * (-755.268) [-754.659] (-763.979) (-763.514) -- 0:00:34
871500 -- (-767.004) (-765.417) [-759.571] (-764.933) * (-774.429) (-766.322) [-754.159] (-771.645) -- 0:00:34
872000 -- (-769.183) (-766.145) (-755.353) [-764.218] * (-768.970) (-760.387) (-765.232) [-763.954] -- 0:00:34
872500 -- (-768.319) (-779.752) (-764.499) [-753.660] * (-759.747) (-761.491) (-759.886) [-764.895] -- 0:00:34
873000 -- [-755.773] (-766.652) (-760.762) (-765.988) * (-764.773) (-756.129) (-763.905) [-761.560] -- 0:00:33
873500 -- (-766.930) [-758.495] (-766.173) (-764.280) * [-763.336] (-755.214) (-758.284) (-767.932) -- 0:00:33
874000 -- (-763.491) (-770.854) (-770.193) [-760.392] * (-766.227) [-765.190] (-763.790) (-771.962) -- 0:00:33
874500 -- [-762.413] (-760.615) (-756.991) (-755.731) * (-766.432) (-765.189) (-772.068) [-762.902] -- 0:00:33
875000 -- (-754.938) (-767.034) [-760.897] (-767.458) * [-762.113] (-767.387) (-772.676) (-768.600) -- 0:00:33
Average standard deviation of split frequencies: 0.006964
875500 -- [-751.432] (-774.401) (-760.751) (-761.908) * [-760.854] (-763.187) (-762.680) (-767.651) -- 0:00:33
876000 -- (-761.333) [-767.068] (-768.146) (-763.205) * (-771.364) [-759.458] (-774.996) (-762.354) -- 0:00:33
876500 -- (-773.478) (-756.721) (-767.774) [-761.313] * (-760.362) [-760.844] (-770.730) (-765.803) -- 0:00:32
877000 -- (-759.441) (-766.039) [-761.236] (-772.520) * [-762.250] (-758.041) (-769.949) (-768.257) -- 0:00:32
877500 -- (-763.011) (-762.842) [-755.037] (-771.141) * (-768.265) (-769.083) (-775.737) [-761.355] -- 0:00:32
878000 -- [-764.835] (-765.257) (-755.377) (-771.747) * (-759.877) (-762.041) (-761.476) [-759.731] -- 0:00:32
878500 -- (-775.792) (-777.198) [-757.929] (-766.446) * [-753.109] (-762.637) (-766.874) (-758.345) -- 0:00:32
879000 -- (-760.651) (-765.904) (-773.371) [-753.793] * [-759.962] (-762.055) (-769.053) (-771.600) -- 0:00:32
879500 -- (-769.665) (-757.010) (-762.903) [-764.011] * (-761.781) [-762.420] (-764.343) (-767.935) -- 0:00:32
880000 -- [-757.504] (-771.124) (-759.340) (-772.113) * [-764.361] (-767.380) (-774.826) (-761.475) -- 0:00:32
Average standard deviation of split frequencies: 0.006455
880500 -- [-759.243] (-766.085) (-767.921) (-764.991) * (-768.025) (-769.016) (-757.883) [-759.669] -- 0:00:31
881000 -- (-768.429) (-766.449) (-757.180) [-761.881] * (-762.649) (-769.105) (-761.944) [-755.689] -- 0:00:31
881500 -- (-763.642) [-762.674] (-768.483) (-764.020) * (-757.968) (-777.392) [-760.570] (-761.025) -- 0:00:31
882000 -- (-760.652) (-764.329) (-762.018) [-762.227] * (-766.661) (-786.052) (-763.912) [-759.988] -- 0:00:31
882500 -- (-768.664) (-766.161) (-764.493) [-761.925] * (-760.969) (-768.770) [-759.266] (-761.188) -- 0:00:31
883000 -- (-766.671) (-771.191) (-774.882) [-757.932] * (-764.428) [-762.229] (-760.348) (-768.869) -- 0:00:31
883500 -- (-762.577) (-769.753) [-763.733] (-758.926) * (-759.514) [-770.665] (-771.058) (-768.149) -- 0:00:31
884000 -- [-759.309] (-765.853) (-766.799) (-763.724) * (-760.226) (-759.048) [-761.460] (-766.175) -- 0:00:30
884500 -- (-755.868) (-757.782) (-771.446) [-759.812] * (-776.288) [-757.916] (-760.658) (-759.731) -- 0:00:30
885000 -- [-755.049] (-755.475) (-766.849) (-763.618) * (-772.441) [-764.656] (-763.433) (-772.432) -- 0:00:30
Average standard deviation of split frequencies: 0.006166
885500 -- (-769.967) [-759.520] (-761.835) (-770.418) * (-759.879) (-759.306) [-756.613] (-762.313) -- 0:00:30
886000 -- (-760.858) (-761.469) [-759.106] (-763.132) * (-756.114) (-766.274) [-758.330] (-760.588) -- 0:00:30
886500 -- (-761.559) (-764.430) [-761.825] (-773.906) * (-762.439) [-756.931] (-769.999) (-774.825) -- 0:00:30
887000 -- (-772.235) (-759.540) (-771.904) [-758.512] * (-761.659) [-762.333] (-765.045) (-768.423) -- 0:00:30
887500 -- (-765.757) (-763.560) (-762.056) [-764.528] * (-760.887) [-754.173] (-763.351) (-772.824) -- 0:00:30
888000 -- (-770.144) (-756.923) (-761.525) [-755.722] * (-759.931) (-756.343) (-756.057) [-759.665] -- 0:00:29
888500 -- (-772.663) [-760.635] (-762.522) (-766.956) * (-757.128) (-767.171) (-763.917) [-755.373] -- 0:00:29
889000 -- (-762.152) (-759.629) [-761.774] (-766.568) * (-761.141) (-764.433) (-767.925) [-759.633] -- 0:00:29
889500 -- [-752.441] (-763.892) (-769.527) (-759.130) * (-762.041) [-765.686] (-761.187) (-758.774) -- 0:00:29
890000 -- (-761.290) (-764.255) (-761.666) [-763.667] * [-766.836] (-760.607) (-769.596) (-760.206) -- 0:00:29
Average standard deviation of split frequencies: 0.006258
890500 -- (-762.851) (-766.697) [-761.034] (-769.887) * (-768.463) (-754.376) [-755.121] (-759.924) -- 0:00:29
891000 -- (-763.913) (-765.283) (-762.893) [-759.507] * (-767.834) (-760.780) [-760.332] (-760.511) -- 0:00:29
891500 -- (-763.641) [-765.032] (-768.233) (-758.381) * (-759.367) (-764.925) (-762.221) [-765.182] -- 0:00:28
892000 -- [-760.955] (-760.004) (-763.124) (-756.798) * [-760.312] (-767.591) (-771.658) (-767.774) -- 0:00:28
892500 -- [-754.222] (-766.232) (-758.819) (-753.280) * (-758.722) (-752.728) [-751.295] (-760.270) -- 0:00:28
893000 -- [-752.799] (-762.243) (-758.427) (-757.715) * [-756.624] (-754.947) (-761.656) (-762.183) -- 0:00:28
893500 -- [-757.452] (-759.184) (-760.638) (-761.754) * (-768.422) (-755.902) (-767.935) [-765.934] -- 0:00:28
894000 -- [-757.686] (-776.550) (-765.196) (-762.519) * (-765.738) [-764.827] (-765.930) (-762.553) -- 0:00:28
894500 -- (-765.204) (-762.156) (-767.522) [-755.118] * [-760.018] (-753.181) (-759.702) (-756.485) -- 0:00:28
895000 -- (-762.670) (-765.123) (-773.959) [-759.583] * [-760.938] (-767.827) (-764.825) (-770.797) -- 0:00:28
Average standard deviation of split frequencies: 0.006375
895500 -- (-762.050) (-773.380) (-760.528) [-763.361] * (-766.430) [-759.100] (-770.528) (-768.256) -- 0:00:27
896000 -- (-768.723) (-761.597) [-758.239] (-764.708) * (-759.873) (-761.168) (-761.022) [-762.658] -- 0:00:27
896500 -- (-757.239) (-769.394) [-761.627] (-765.366) * (-774.691) (-777.789) (-760.435) [-766.496] -- 0:00:27
897000 -- (-760.755) [-768.540] (-761.178) (-753.758) * (-772.527) [-762.395] (-757.536) (-762.527) -- 0:00:27
897500 -- [-761.440] (-757.454) (-765.866) (-760.791) * [-754.320] (-756.034) (-772.195) (-755.133) -- 0:00:27
898000 -- [-753.230] (-759.749) (-767.819) (-764.917) * (-763.944) [-760.977] (-765.090) (-758.440) -- 0:00:27
898500 -- [-754.809] (-755.673) (-762.673) (-757.769) * (-759.984) (-764.726) [-762.618] (-760.658) -- 0:00:27
899000 -- (-764.445) (-751.284) (-761.535) [-769.166] * (-764.804) (-754.506) [-763.275] (-757.838) -- 0:00:26
899500 -- [-754.506] (-765.203) (-776.253) (-763.093) * (-759.986) [-765.537] (-776.112) (-768.668) -- 0:00:26
900000 -- [-753.979] (-764.897) (-765.195) (-757.031) * [-758.171] (-763.586) (-766.889) (-764.554) -- 0:00:26
Average standard deviation of split frequencies: 0.006527
900500 -- (-761.945) [-763.021] (-762.983) (-763.193) * [-760.987] (-759.014) (-765.493) (-765.676) -- 0:00:26
901000 -- [-756.023] (-758.055) (-769.494) (-764.668) * [-763.032] (-768.059) (-764.039) (-762.934) -- 0:00:26
901500 -- [-757.673] (-762.080) (-767.205) (-756.112) * (-764.803) [-757.769] (-763.042) (-766.748) -- 0:00:26
902000 -- (-757.228) (-759.886) [-754.991] (-759.047) * [-759.704] (-764.905) (-762.866) (-757.638) -- 0:00:26
902500 -- (-760.930) [-756.399] (-761.544) (-765.430) * (-758.544) (-759.747) (-767.975) [-762.288] -- 0:00:26
903000 -- (-759.635) (-767.274) [-763.170] (-758.740) * (-771.632) [-761.192] (-763.873) (-761.158) -- 0:00:25
903500 -- (-763.227) (-762.201) [-762.558] (-756.828) * (-762.911) [-756.909] (-758.976) (-763.259) -- 0:00:25
904000 -- (-766.278) (-772.139) (-756.533) [-757.058] * (-762.350) (-755.378) [-757.182] (-767.594) -- 0:00:25
904500 -- [-765.170] (-759.975) (-760.624) (-764.482) * [-756.764] (-757.267) (-759.468) (-762.511) -- 0:00:25
905000 -- (-770.021) (-764.334) [-754.894] (-758.806) * [-765.413] (-761.511) (-754.841) (-761.061) -- 0:00:25
Average standard deviation of split frequencies: 0.006183
905500 -- (-772.038) (-759.590) (-757.488) [-753.185] * (-760.950) (-762.555) (-760.284) [-759.018] -- 0:00:25
906000 -- (-770.853) (-769.992) (-765.214) [-764.494] * (-754.776) [-770.148] (-770.090) (-765.452) -- 0:00:25
906500 -- (-762.448) [-756.517] (-767.758) (-764.561) * (-758.793) (-766.917) [-757.349] (-759.808) -- 0:00:24
907000 -- (-781.320) (-760.745) [-758.512] (-764.094) * (-770.094) (-757.379) (-770.431) [-763.604] -- 0:00:24
907500 -- (-765.869) (-753.792) (-760.506) [-759.255] * (-763.259) (-758.248) [-754.935] (-757.173) -- 0:00:24
908000 -- [-763.900] (-765.800) (-763.127) (-765.159) * (-766.802) (-754.883) [-754.480] (-751.388) -- 0:00:24
908500 -- (-756.656) [-768.198] (-763.336) (-763.222) * [-759.468] (-761.747) (-760.339) (-765.734) -- 0:00:24
909000 -- (-757.718) (-767.685) (-763.369) [-757.646] * (-757.901) [-758.169] (-763.175) (-777.492) -- 0:00:24
909500 -- (-761.896) [-761.809] (-756.001) (-763.741) * (-765.336) (-761.083) [-762.416] (-766.604) -- 0:00:24
910000 -- (-763.757) (-766.347) (-768.701) [-761.981] * (-767.030) (-761.664) [-760.920] (-762.045) -- 0:00:24
Average standard deviation of split frequencies: 0.006212
910500 -- (-767.700) [-760.225] (-763.683) (-770.465) * (-768.524) (-767.305) (-761.144) [-754.440] -- 0:00:23
911000 -- (-757.264) (-763.930) (-768.680) [-759.526] * [-758.175] (-769.349) (-759.741) (-758.307) -- 0:00:23
911500 -- (-758.588) (-767.219) (-764.080) [-757.173] * [-758.387] (-775.054) (-757.855) (-765.586) -- 0:00:23
912000 -- (-763.093) (-769.207) [-766.538] (-761.228) * (-762.792) [-757.423] (-759.071) (-761.001) -- 0:00:23
912500 -- (-768.560) (-776.416) (-778.039) [-763.243] * (-764.058) (-771.037) (-762.164) [-758.417] -- 0:00:23
913000 -- (-764.124) [-767.628] (-767.721) (-771.679) * (-756.653) (-766.056) (-763.095) [-761.737] -- 0:00:23
913500 -- [-758.182] (-763.533) (-764.116) (-766.172) * (-756.261) [-757.566] (-760.233) (-768.561) -- 0:00:23
914000 -- (-754.356) (-757.252) [-757.549] (-770.353) * (-757.482) [-762.164] (-760.280) (-759.317) -- 0:00:22
914500 -- (-775.176) [-766.244] (-795.662) (-764.120) * (-759.444) (-753.574) (-763.281) [-758.370] -- 0:00:22
915000 -- (-753.787) (-761.739) [-762.823] (-760.709) * (-753.306) (-763.831) (-766.880) [-760.983] -- 0:00:22
Average standard deviation of split frequencies: 0.006206
915500 -- [-760.654] (-761.615) (-768.477) (-764.257) * (-759.973) (-763.665) (-763.399) [-760.199] -- 0:00:22
916000 -- (-760.828) (-774.493) [-756.978] (-766.643) * [-758.039] (-773.741) (-761.045) (-768.559) -- 0:00:22
916500 -- (-766.049) [-770.806] (-761.837) (-757.173) * (-765.946) (-758.986) [-759.286] (-767.712) -- 0:00:22
917000 -- (-762.044) (-765.717) [-769.832] (-764.077) * (-770.363) (-760.511) [-763.751] (-767.141) -- 0:00:22
917500 -- (-766.144) (-758.422) (-759.793) [-757.077] * (-760.809) (-760.902) [-755.450] (-767.931) -- 0:00:22
918000 -- (-775.897) (-762.590) [-755.932] (-766.858) * (-769.038) [-752.813] (-762.037) (-764.565) -- 0:00:21
918500 -- [-759.246] (-760.399) (-785.357) (-770.167) * [-761.796] (-769.683) (-762.092) (-755.996) -- 0:00:21
919000 -- (-760.531) (-762.075) [-757.638] (-772.946) * (-762.007) [-754.336] (-763.904) (-762.278) -- 0:00:21
919500 -- (-763.755) [-763.608] (-756.707) (-769.092) * (-767.273) (-759.758) [-755.964] (-761.153) -- 0:00:21
920000 -- (-768.140) (-766.387) [-759.233] (-763.037) * (-764.400) [-755.207] (-760.741) (-759.616) -- 0:00:21
Average standard deviation of split frequencies: 0.006385
920500 -- (-762.245) (-763.119) (-756.231) [-761.023] * (-770.702) (-765.362) (-764.775) [-760.712] -- 0:00:21
921000 -- (-763.651) (-768.058) [-758.925] (-761.171) * (-762.840) [-756.458] (-765.035) (-760.493) -- 0:00:21
921500 -- (-757.107) (-768.273) (-769.952) [-760.130] * (-769.774) (-765.668) [-760.281] (-757.897) -- 0:00:20
922000 -- (-765.915) [-758.780] (-761.023) (-764.830) * (-761.945) (-760.390) [-756.549] (-765.349) -- 0:00:20
922500 -- (-770.086) (-766.009) (-765.078) [-757.726] * (-765.472) (-770.448) [-752.323] (-755.674) -- 0:00:20
923000 -- (-764.009) (-764.203) [-756.188] (-765.521) * (-755.944) (-764.892) [-757.201] (-763.700) -- 0:00:20
923500 -- (-757.691) (-757.442) [-761.564] (-761.513) * (-764.791) (-773.036) [-756.681] (-770.612) -- 0:00:20
924000 -- (-768.394) (-761.895) [-762.977] (-769.345) * (-761.049) (-757.321) [-757.980] (-771.013) -- 0:00:20
924500 -- [-770.818] (-759.551) (-765.731) (-765.043) * (-769.210) (-757.186) (-761.388) [-762.466] -- 0:00:20
925000 -- (-753.523) (-760.297) (-774.950) [-761.423] * (-765.229) (-759.251) [-762.485] (-769.430) -- 0:00:20
Average standard deviation of split frequencies: 0.005899
925500 -- (-765.743) (-763.288) [-763.784] (-760.315) * (-779.918) [-754.749] (-754.026) (-766.945) -- 0:00:19
926000 -- [-755.546] (-762.008) (-756.998) (-759.727) * (-779.222) (-761.677) (-766.465) [-759.188] -- 0:00:19
926500 -- (-772.038) [-761.857] (-755.217) (-768.242) * (-759.248) (-766.486) (-759.657) [-757.663] -- 0:00:19
927000 -- (-760.979) (-758.552) (-760.311) [-753.255] * (-773.302) [-755.900] (-754.457) (-765.119) -- 0:00:19
927500 -- (-772.187) [-761.231] (-769.317) (-773.903) * (-768.148) [-757.352] (-763.454) (-770.764) -- 0:00:19
928000 -- (-763.559) (-762.680) (-764.295) [-759.717] * (-756.684) (-764.332) [-755.528] (-780.982) -- 0:00:19
928500 -- (-765.327) (-768.137) [-757.155] (-774.885) * [-764.309] (-763.839) (-768.609) (-766.124) -- 0:00:19
929000 -- (-763.916) [-759.724] (-771.095) (-765.743) * [-756.984] (-761.131) (-763.749) (-759.296) -- 0:00:18
929500 -- (-756.200) (-761.433) (-764.870) [-751.947] * [-759.127] (-764.556) (-764.548) (-755.365) -- 0:00:18
930000 -- (-773.165) (-752.988) [-760.704] (-759.337) * (-766.458) [-758.166] (-766.847) (-760.996) -- 0:00:18
Average standard deviation of split frequencies: 0.005929
930500 -- (-776.617) [-755.760] (-775.623) (-760.761) * [-756.502] (-759.679) (-766.793) (-768.842) -- 0:00:18
931000 -- (-760.902) [-754.228] (-769.782) (-756.313) * (-763.420) (-759.616) (-760.509) [-764.961] -- 0:00:18
931500 -- (-764.734) [-763.970] (-759.410) (-757.571) * (-769.738) (-763.876) (-770.582) [-766.533] -- 0:00:18
932000 -- [-759.194] (-758.001) (-756.565) (-765.569) * (-780.717) [-755.156] (-763.255) (-759.938) -- 0:00:18
932500 -- [-755.689] (-760.123) (-766.286) (-760.045) * (-766.368) [-760.573] (-761.809) (-764.704) -- 0:00:18
933000 -- [-758.038] (-767.028) (-768.812) (-765.179) * [-762.083] (-761.743) (-759.455) (-758.276) -- 0:00:17
933500 -- (-755.526) (-763.850) [-764.800] (-761.112) * [-768.112] (-758.410) (-760.221) (-777.404) -- 0:00:17
934000 -- (-759.599) (-756.802) [-764.739] (-760.416) * (-756.468) (-762.916) [-751.766] (-769.740) -- 0:00:17
934500 -- [-756.614] (-763.326) (-772.557) (-766.666) * (-752.024) (-765.014) (-771.126) [-752.522] -- 0:00:17
935000 -- [-754.752] (-761.584) (-768.493) (-760.400) * (-771.993) (-758.973) [-755.362] (-764.115) -- 0:00:17
Average standard deviation of split frequencies: 0.005984
935500 -- (-760.378) [-759.432] (-757.602) (-765.895) * (-769.583) [-760.935] (-767.346) (-773.582) -- 0:00:17
936000 -- (-765.352) (-755.879) [-757.225] (-771.422) * (-755.957) (-761.180) (-763.480) [-758.031] -- 0:00:17
936500 -- (-775.471) (-765.189) (-772.174) [-760.524] * (-770.497) (-765.312) [-757.168] (-766.241) -- 0:00:16
937000 -- (-767.442) (-757.231) [-762.971] (-757.157) * (-774.859) (-761.280) (-756.465) [-767.121] -- 0:00:16
937500 -- (-765.105) (-765.949) (-756.135) [-757.969] * (-761.088) (-770.851) (-759.772) [-760.452] -- 0:00:16
938000 -- (-761.258) (-768.042) [-762.896] (-763.206) * (-767.920) [-766.375] (-764.046) (-766.863) -- 0:00:16
938500 -- (-758.656) [-757.822] (-764.331) (-771.778) * [-754.409] (-768.562) (-780.277) (-760.275) -- 0:00:16
939000 -- (-776.498) (-761.032) [-760.510] (-761.823) * (-754.626) (-762.546) (-781.145) [-760.967] -- 0:00:16
939500 -- (-762.107) [-756.059] (-754.340) (-771.425) * (-756.552) (-767.026) [-760.724] (-778.276) -- 0:00:16
940000 -- (-756.413) (-760.277) (-762.654) [-763.083] * [-752.150] (-775.023) (-757.793) (-766.021) -- 0:00:16
Average standard deviation of split frequencies: 0.005925
940500 -- [-754.699] (-755.360) (-762.327) (-761.572) * [-765.611] (-765.486) (-766.464) (-756.683) -- 0:00:15
941000 -- [-766.321] (-757.332) (-770.022) (-759.620) * (-767.746) (-767.620) [-761.113] (-764.211) -- 0:00:15
941500 -- (-778.957) (-764.329) (-756.744) [-758.489] * (-762.524) [-766.090] (-765.040) (-761.759) -- 0:00:15
942000 -- (-764.829) (-762.120) [-764.154] (-760.288) * (-765.401) (-764.107) (-762.580) [-758.294] -- 0:00:15
942500 -- (-760.299) [-761.073] (-769.205) (-763.297) * (-764.558) (-766.546) [-760.241] (-760.897) -- 0:00:15
943000 -- (-754.841) (-760.646) [-758.306] (-769.024) * [-764.037] (-762.206) (-764.407) (-763.282) -- 0:00:15
943500 -- (-767.012) (-760.120) (-766.518) [-762.095] * (-764.328) (-763.017) [-760.023] (-765.573) -- 0:00:15
944000 -- [-758.499] (-753.121) (-769.271) (-760.374) * [-754.013] (-761.364) (-756.303) (-760.557) -- 0:00:14
944500 -- (-764.769) (-769.181) [-760.520] (-776.499) * (-757.952) (-765.914) [-758.396] (-776.711) -- 0:00:14
945000 -- [-758.598] (-768.519) (-762.845) (-772.761) * (-765.392) (-761.793) (-764.394) [-754.518] -- 0:00:14
Average standard deviation of split frequencies: 0.005921
945500 -- (-773.004) (-768.404) (-775.125) [-777.706] * (-756.736) (-762.708) (-764.576) [-757.678] -- 0:00:14
946000 -- (-760.469) (-761.432) (-756.783) [-760.461] * (-756.643) [-754.873] (-756.898) (-764.841) -- 0:00:14
946500 -- (-754.241) (-761.758) [-761.436] (-764.994) * (-760.523) [-754.533] (-759.888) (-762.891) -- 0:00:14
947000 -- (-771.547) (-762.332) [-765.022] (-763.760) * (-757.969) [-763.447] (-761.945) (-767.949) -- 0:00:14
947500 -- (-757.804) [-753.618] (-765.709) (-757.927) * (-764.358) (-769.880) [-758.043] (-763.557) -- 0:00:14
948000 -- (-765.845) [-760.744] (-770.210) (-764.472) * (-767.872) (-766.602) (-760.318) [-755.792] -- 0:00:13
948500 -- (-766.691) (-777.347) (-760.588) [-758.363] * (-758.690) (-764.355) (-769.662) [-768.570] -- 0:00:13
949000 -- (-758.749) (-763.966) (-756.940) [-755.032] * (-751.050) (-771.534) [-764.703] (-759.630) -- 0:00:13
949500 -- (-756.704) (-768.248) (-766.271) [-754.984] * [-760.413] (-759.809) (-765.587) (-756.837) -- 0:00:13
950000 -- (-756.191) (-752.159) (-758.763) [-762.649] * (-759.271) (-762.536) [-765.542] (-755.162) -- 0:00:13
Average standard deviation of split frequencies: 0.005921
950500 -- (-761.555) (-760.890) [-767.363] (-757.911) * (-775.886) (-756.036) (-762.883) [-757.188] -- 0:00:13
951000 -- [-753.923] (-760.805) (-766.922) (-771.113) * (-758.064) (-763.310) [-758.485] (-764.218) -- 0:00:13
951500 -- (-758.091) (-756.196) [-754.041] (-766.650) * (-775.488) [-759.507] (-760.334) (-773.736) -- 0:00:12
952000 -- (-754.254) (-767.256) [-750.375] (-757.501) * (-767.713) (-763.001) [-761.275] (-762.954) -- 0:00:12
952500 -- (-758.749) (-757.779) [-753.167] (-770.246) * (-758.579) [-757.386] (-762.499) (-765.728) -- 0:00:12
953000 -- (-759.041) [-757.359] (-758.468) (-766.075) * [-760.752] (-760.227) (-757.387) (-773.164) -- 0:00:12
953500 -- (-762.692) (-763.322) [-758.598] (-765.180) * (-760.114) [-758.209] (-761.853) (-767.983) -- 0:00:12
954000 -- (-765.194) (-756.118) (-767.822) [-756.413] * (-762.691) (-763.349) (-759.846) [-763.769] -- 0:00:12
954500 -- [-764.993] (-759.025) (-775.847) (-755.374) * (-760.524) (-764.769) (-756.763) [-763.798] -- 0:00:12
955000 -- (-766.927) [-755.496] (-767.148) (-767.199) * [-756.011] (-759.335) (-771.950) (-764.356) -- 0:00:12
Average standard deviation of split frequencies: 0.005569
955500 -- [-758.065] (-765.964) (-753.914) (-754.142) * (-761.489) (-756.337) [-763.160] (-757.413) -- 0:00:11
956000 -- (-763.695) (-761.205) (-765.580) [-759.350] * (-759.723) (-760.319) (-762.781) [-755.177] -- 0:00:11
956500 -- (-754.838) (-757.553) (-765.989) [-759.135] * [-757.532] (-763.894) (-762.991) (-767.305) -- 0:00:11
957000 -- (-757.503) [-757.236] (-763.493) (-755.399) * (-775.270) (-772.468) (-763.277) [-763.949] -- 0:00:11
957500 -- (-762.004) (-769.177) [-758.283] (-760.852) * (-772.080) (-766.864) (-766.042) [-756.496] -- 0:00:11
958000 -- (-756.400) [-759.059] (-763.449) (-765.943) * (-761.185) [-761.785] (-759.887) (-752.501) -- 0:00:11
958500 -- [-763.263] (-760.095) (-759.592) (-762.314) * (-765.610) (-762.047) (-776.982) [-761.281] -- 0:00:11
959000 -- [-757.437] (-763.992) (-768.007) (-761.801) * (-758.444) (-767.416) (-767.290) [-765.278] -- 0:00:10
959500 -- (-760.811) (-759.886) (-766.688) [-765.406] * [-756.888] (-770.061) (-757.786) (-768.309) -- 0:00:10
960000 -- (-773.066) (-759.269) (-766.208) [-762.450] * (-766.275) (-774.899) [-755.593] (-759.152) -- 0:00:10
Average standard deviation of split frequencies: 0.005369
960500 -- (-759.132) (-768.238) [-765.301] (-760.050) * (-763.407) (-764.699) [-755.878] (-756.469) -- 0:00:10
961000 -- (-769.033) (-769.171) [-758.429] (-760.302) * (-768.702) (-769.301) [-762.571] (-763.725) -- 0:00:10
961500 -- (-765.021) [-764.241] (-768.442) (-766.059) * (-768.222) (-762.002) [-756.070] (-761.265) -- 0:00:10
962000 -- (-768.449) (-765.716) [-766.915] (-758.347) * (-775.590) [-759.694] (-765.526) (-760.805) -- 0:00:10
962500 -- [-755.813] (-759.482) (-767.767) (-764.134) * (-773.583) [-761.069] (-758.326) (-757.764) -- 0:00:10
963000 -- [-757.429] (-772.141) (-762.034) (-759.547) * (-770.321) [-756.755] (-759.794) (-762.132) -- 0:00:09
963500 -- (-760.333) (-769.214) [-767.633] (-759.923) * (-765.273) (-755.549) (-764.959) [-771.766] -- 0:00:09
964000 -- (-762.980) [-757.460] (-764.706) (-763.037) * (-766.441) (-762.818) (-769.007) [-766.467] -- 0:00:09
964500 -- (-770.071) (-759.613) (-758.720) [-758.655] * (-767.914) [-753.991] (-756.088) (-771.307) -- 0:00:09
965000 -- (-763.237) [-753.508] (-758.194) (-763.401) * (-775.401) (-761.869) (-770.385) [-760.832] -- 0:00:09
Average standard deviation of split frequencies: 0.005368
965500 -- (-753.654) [-753.013] (-768.943) (-766.410) * [-770.840] (-759.679) (-761.475) (-770.856) -- 0:00:09
966000 -- (-761.781) [-760.191] (-770.010) (-765.937) * (-763.411) (-758.657) [-761.523] (-776.212) -- 0:00:09
966500 -- (-758.842) (-760.938) [-766.137] (-769.795) * (-759.413) [-759.434] (-762.357) (-778.302) -- 0:00:08
967000 -- (-760.241) (-764.538) (-767.174) [-755.479] * (-764.881) (-766.287) [-760.334] (-764.815) -- 0:00:08
967500 -- (-764.053) (-761.276) [-764.999] (-759.660) * (-761.419) (-769.750) [-762.782] (-764.214) -- 0:00:08
968000 -- (-761.578) (-761.421) (-761.521) [-758.806] * (-764.456) (-768.279) [-760.124] (-758.294) -- 0:00:08
968500 -- [-767.697] (-765.577) (-761.464) (-755.693) * (-763.140) [-765.825] (-760.033) (-760.561) -- 0:00:08
969000 -- (-772.147) (-771.323) (-771.327) [-754.748] * (-762.155) (-773.583) (-759.111) [-759.586] -- 0:00:08
969500 -- (-767.353) (-770.438) [-773.443] (-755.844) * (-760.214) (-765.055) (-760.741) [-755.666] -- 0:00:08
970000 -- (-765.811) (-761.951) [-766.168] (-756.033) * (-771.957) (-765.620) (-771.913) [-762.200] -- 0:00:08
Average standard deviation of split frequencies: 0.005085
970500 -- (-778.876) [-767.052] (-756.626) (-758.059) * (-767.470) (-761.027) [-765.573] (-767.646) -- 0:00:07
971000 -- (-767.207) (-768.658) [-762.053] (-755.390) * (-765.375) (-763.515) [-755.673] (-763.743) -- 0:00:07
971500 -- [-762.113] (-762.673) (-760.031) (-761.149) * (-762.621) (-767.229) [-757.197] (-761.732) -- 0:00:07
972000 -- (-765.771) (-759.470) (-765.782) [-758.191] * (-755.447) (-763.799) (-764.866) [-762.827] -- 0:00:07
972500 -- (-776.274) (-759.622) (-759.134) [-756.505] * (-766.767) (-763.140) (-756.783) [-761.262] -- 0:00:07
973000 -- (-765.440) [-761.907] (-766.777) (-763.628) * (-760.481) (-766.566) [-755.819] (-767.075) -- 0:00:07
973500 -- [-759.038] (-765.124) (-763.647) (-765.396) * (-768.335) (-755.988) [-762.579] (-761.579) -- 0:00:07
974000 -- [-763.646] (-765.818) (-764.126) (-769.395) * [-760.096] (-769.155) (-774.124) (-764.950) -- 0:00:06
974500 -- (-755.645) (-760.211) (-772.407) [-762.409] * [-761.913] (-767.165) (-767.255) (-766.282) -- 0:00:06
975000 -- (-764.529) (-763.984) [-758.007] (-755.780) * (-767.884) (-762.933) [-756.491] (-769.254) -- 0:00:06
Average standard deviation of split frequencies: 0.005114
975500 -- (-763.322) (-772.580) [-755.585] (-759.345) * (-780.061) [-762.036] (-760.848) (-759.991) -- 0:00:06
976000 -- (-765.800) (-757.409) [-758.964] (-766.911) * [-756.820] (-765.260) (-758.643) (-768.326) -- 0:00:06
976500 -- (-767.084) [-761.054] (-765.122) (-769.309) * [-760.576] (-762.588) (-760.877) (-765.072) -- 0:00:06
977000 -- (-767.870) [-763.611] (-773.261) (-762.254) * (-765.078) [-755.823] (-760.021) (-763.594) -- 0:00:06
977500 -- [-757.008] (-771.618) (-758.865) (-764.210) * (-772.477) (-754.391) [-764.331] (-755.637) -- 0:00:06
978000 -- [-758.342] (-765.488) (-761.953) (-768.251) * (-764.007) [-755.750] (-770.297) (-773.941) -- 0:00:05
978500 -- [-755.684] (-771.828) (-761.595) (-773.360) * (-767.438) [-762.983] (-772.038) (-758.061) -- 0:00:05
979000 -- (-760.172) [-755.161] (-768.798) (-766.522) * (-767.647) [-768.397] (-762.538) (-763.806) -- 0:00:05
979500 -- [-766.889] (-759.622) (-767.657) (-766.953) * (-753.090) (-776.002) (-769.723) [-757.256] -- 0:00:05
980000 -- [-757.681] (-756.337) (-756.668) (-766.913) * (-760.690) (-768.221) [-758.459] (-765.587) -- 0:00:05
Average standard deviation of split frequencies: 0.004892
980500 -- (-766.832) (-768.627) [-762.145] (-764.632) * (-762.469) (-765.683) [-758.244] (-758.459) -- 0:00:05
981000 -- (-759.566) [-757.204] (-768.820) (-777.247) * (-770.097) [-757.995] (-767.156) (-756.481) -- 0:00:05
981500 -- (-766.476) [-762.189] (-763.932) (-757.831) * [-760.571] (-757.200) (-760.996) (-757.896) -- 0:00:04
982000 -- (-760.164) (-762.609) [-756.615] (-760.422) * [-766.884] (-763.774) (-761.761) (-766.090) -- 0:00:04
982500 -- (-775.625) [-759.762] (-764.673) (-757.588) * (-769.392) (-755.747) [-757.119] (-763.436) -- 0:00:04
983000 -- (-772.691) [-753.209] (-764.749) (-763.421) * (-758.364) [-768.941] (-765.320) (-766.667) -- 0:00:04
983500 -- (-769.440) (-767.730) (-765.390) [-758.204] * [-755.347] (-761.550) (-767.116) (-760.910) -- 0:00:04
984000 -- [-759.905] (-765.475) (-770.726) (-758.994) * (-763.751) (-768.185) [-766.388] (-764.663) -- 0:00:04
984500 -- (-767.024) [-759.677] (-766.604) (-763.588) * (-763.960) [-755.574] (-769.560) (-763.089) -- 0:00:04
985000 -- (-756.461) [-754.304] (-762.794) (-760.003) * (-767.872) (-762.176) (-769.004) [-757.732] -- 0:00:04
Average standard deviation of split frequencies: 0.004837
985500 -- [-759.636] (-758.575) (-772.866) (-761.130) * (-765.002) (-766.084) (-769.760) [-763.837] -- 0:00:03
986000 -- (-770.590) (-768.864) (-760.962) [-756.567] * (-772.773) [-760.411] (-761.082) (-771.146) -- 0:00:03
986500 -- (-760.021) (-763.782) [-758.989] (-763.453) * (-764.823) (-759.231) (-767.865) [-751.932] -- 0:00:03
987000 -- (-763.761) (-757.458) [-754.163] (-763.062) * (-766.896) (-763.760) [-758.005] (-771.974) -- 0:00:03
987500 -- (-754.231) (-759.655) [-755.040] (-763.235) * (-758.208) (-769.098) (-766.943) [-763.150] -- 0:00:03
988000 -- [-756.586] (-767.646) (-756.814) (-767.244) * (-753.875) (-776.475) [-756.310] (-778.036) -- 0:00:03
988500 -- [-754.678] (-760.297) (-757.714) (-758.658) * [-758.987] (-765.724) (-758.486) (-756.969) -- 0:00:03
989000 -- (-766.162) (-759.421) [-755.478] (-762.887) * [-754.472] (-766.204) (-762.388) (-757.044) -- 0:00:02
989500 -- (-765.681) (-761.910) [-756.637] (-765.294) * (-769.613) (-766.361) [-764.614] (-758.219) -- 0:00:02
990000 -- (-776.011) [-758.320] (-764.088) (-763.857) * (-769.008) (-760.553) [-768.656] (-771.620) -- 0:00:02
Average standard deviation of split frequencies: 0.004870
990500 -- (-763.606) (-762.284) [-757.134] (-768.574) * [-756.662] (-766.410) (-770.390) (-764.328) -- 0:00:02
991000 -- (-764.032) (-760.377) [-758.699] (-771.140) * [-758.708] (-767.186) (-779.771) (-766.473) -- 0:00:02
991500 -- (-760.999) (-761.727) [-762.148] (-762.379) * [-774.224] (-767.342) (-762.834) (-769.462) -- 0:00:02
992000 -- [-766.734] (-765.275) (-759.348) (-755.369) * (-763.121) (-770.223) (-764.568) [-761.078] -- 0:00:02
992500 -- (-764.412) [-764.180] (-775.181) (-753.955) * (-761.679) (-753.647) [-760.851] (-772.350) -- 0:00:02
993000 -- (-773.484) (-764.345) (-763.316) [-758.557] * [-760.710] (-756.925) (-772.227) (-765.947) -- 0:00:01
993500 -- (-763.978) (-768.294) [-761.561] (-763.714) * [-758.393] (-764.696) (-765.291) (-763.568) -- 0:00:01
994000 -- (-765.548) [-765.014] (-764.567) (-765.805) * (-760.951) [-765.420] (-760.560) (-761.210) -- 0:00:01
994500 -- (-771.171) (-761.646) [-755.871] (-757.671) * (-759.299) (-758.672) (-768.966) [-756.996] -- 0:00:01
995000 -- (-757.144) (-768.989) (-757.414) [-753.423] * (-759.435) [-757.625] (-767.712) (-762.505) -- 0:00:01
Average standard deviation of split frequencies: 0.005095
995500 -- (-758.522) (-758.464) [-757.165] (-769.119) * (-764.578) (-760.650) [-765.533] (-768.848) -- 0:00:01
996000 -- (-761.084) (-761.693) (-763.587) [-769.962] * (-763.801) (-770.370) (-768.951) [-764.478] -- 0:00:01
996500 -- (-761.651) (-760.341) [-764.415] (-763.168) * [-758.135] (-770.688) (-758.157) (-767.947) -- 0:00:00
997000 -- (-757.535) [-757.762] (-760.627) (-757.525) * [-756.772] (-771.229) (-772.886) (-762.749) -- 0:00:00
997500 -- (-761.265) (-764.584) (-755.201) [-757.095] * (-765.103) (-762.009) (-766.592) [-757.501] -- 0:00:00
998000 -- (-759.588) (-761.714) [-758.323] (-770.098) * (-776.701) (-762.161) [-763.413] (-766.069) -- 0:00:00
998500 -- [-758.322] (-760.610) (-766.311) (-761.371) * (-758.371) [-757.253] (-761.084) (-753.305) -- 0:00:00
999000 -- (-771.489) [-759.829] (-768.901) (-769.599) * (-767.670) (-762.948) [-760.202] (-762.322) -- 0:00:00
999500 -- [-767.401] (-765.004) (-768.124) (-766.709) * [-761.774] (-765.037) (-765.656) (-767.949) -- 0:00:00
1000000 -- (-759.665) (-767.751) [-761.513] (-758.084) * (-766.122) (-763.815) [-758.333] (-761.259) -- 0:00:00
Average standard deviation of split frequencies: 0.005043
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -759.665207 -- 16.126261
Chain 1 -- -759.665211 -- 16.126261
Chain 2 -- -767.750669 -- 16.215821
Chain 2 -- -767.750673 -- 16.215821
Chain 3 -- -761.513456 -- 21.357290
Chain 3 -- -761.513453 -- 21.357290
Chain 4 -- -758.083839 -- 19.879840
Chain 4 -- -758.083846 -- 19.879840
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -766.122323 -- 13.737399
Chain 1 -- -766.122327 -- 13.737399
Chain 2 -- -763.815462 -- 13.817598
Chain 2 -- -763.815461 -- 13.817598
Chain 3 -- -758.332590 -- 22.660688
Chain 3 -- -758.332604 -- 22.660688
Chain 4 -- -761.259081 -- 19.669464
Chain 4 -- -761.259079 -- 19.669464
Analysis completed in 4 mins 27 seconds
Analysis used 267.40 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -746.71
Likelihood of best state for "cold" chain of run 2 was -747.68
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
58.1 % ( 48 %) Dirichlet(Revmat{all})
73.5 % ( 73 %) Slider(Revmat{all})
40.0 % ( 34 %) Dirichlet(Pi{all})
38.3 % ( 23 %) Slider(Pi{all})
34.3 % ( 21 %) Multiplier(Alpha{1,2})
47.1 % ( 22 %) Multiplier(Alpha{3})
60.5 % ( 28 %) Slider(Pinvar{all})
24.1 % ( 29 %) ExtSPR(Tau{all},V{all})
9.6 % ( 9 %) ExtTBR(Tau{all},V{all})
32.2 % ( 31 %) NNI(Tau{all},V{all})
29.1 % ( 33 %) ParsSPR(Tau{all},V{all})
27.2 % ( 36 %) Multiplier(V{all})
53.6 % ( 51 %) Nodeslider(V{all})
26.4 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
58.4 % ( 42 %) Dirichlet(Revmat{all})
74.4 % ( 60 %) Slider(Revmat{all})
39.0 % ( 27 %) Dirichlet(Pi{all})
38.6 % ( 30 %) Slider(Pi{all})
34.2 % ( 26 %) Multiplier(Alpha{1,2})
46.7 % ( 29 %) Multiplier(Alpha{3})
60.4 % ( 37 %) Slider(Pinvar{all})
24.1 % ( 27 %) ExtSPR(Tau{all},V{all})
9.6 % ( 9 %) ExtTBR(Tau{all},V{all})
32.4 % ( 26 %) NNI(Tau{all},V{all})
28.8 % ( 33 %) ParsSPR(Tau{all},V{all})
27.0 % ( 22 %) Multiplier(V{all})
53.4 % ( 59 %) Nodeslider(V{all})
26.1 % ( 20 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.73 0.50 0.33
2 | 166645 0.74 0.52
3 | 167036 165968 0.76
4 | 166526 166451 167374
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.73 0.50 0.33
2 | 166421 0.75 0.53
3 | 166208 166149 0.76
4 | 167405 167211 166606
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -758.02
| 2 2 2 |
| 1 |
| 1 |
| 1 2 2 2 1 1 2 * |
|1 22 2 11 1 1 2 1 1 |
| * 2 1 1 1 2 * * 1|
|2 1 * 2 1 2 1 2 1 1 1 2 2 |
| * 1 * 2 2 1 1 2 1 1 2 1 |
| 1 11 2 2 2 2 2 2 2 112 |
| 22 2 1 1 22 1 2 1 2|
| 1 1 2 1 1 1 2 1 2 2 2 |
| 1 2 * 1 2 2 2 1 2 1 2 |
| 2 11 1 |
| |
| 1 2 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -762.47
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -754.58 -770.94
2 -755.00 -768.95
--------------------------------------
TOTAL -754.77 -770.38
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.307742 0.047509 0.915263 1.745533 1.290413 1256.47 1378.73 1.000
r(A<->C){all} 0.155407 0.002582 0.065043 0.256972 0.151876 573.62 664.92 1.003
r(A<->G){all} 0.237986 0.004746 0.117070 0.375971 0.230027 527.79 663.48 1.001
r(A<->T){all} 0.101513 0.002006 0.021453 0.187784 0.096931 838.97 844.86 1.003
r(C<->G){all} 0.025833 0.000314 0.000015 0.059717 0.022725 967.44 994.91 1.000
r(C<->T){all} 0.450892 0.006478 0.282467 0.595929 0.451552 551.36 554.72 1.001
r(G<->T){all} 0.028368 0.000342 0.000009 0.064008 0.024809 668.99 879.63 1.002
pi(A){all} 0.226339 0.000622 0.176831 0.273778 0.225487 896.00 1106.35 1.000
pi(C){all} 0.266336 0.000708 0.210521 0.315732 0.265825 732.94 845.64 1.000
pi(G){all} 0.250408 0.000721 0.199227 0.304458 0.250191 908.79 1204.89 1.000
pi(T){all} 0.256916 0.000688 0.204267 0.306279 0.256460 1094.34 1116.63 1.000
alpha{1,2} 0.107439 0.000545 0.069203 0.156872 0.104910 1354.59 1362.35 1.000
alpha{3} 1.831512 0.450959 0.721324 3.178297 1.717340 1342.80 1421.90 1.000
pinvar{all} 0.379773 0.007002 0.207156 0.534650 0.384286 1170.89 1228.97 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
12 -- C12
Key to taxon bipartitions (saved to file "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------------
1 -- .***********
2 -- .*..........
3 -- ..*.........
4 -- ...*........
5 -- ....*.......
6 -- .....*......
7 -- ......*.....
8 -- .......*....
9 -- ........*...
10 -- .........*..
11 -- ..........*.
12 -- ...........*
13 -- ......**....
14 -- .....*******
15 -- ...*********
16 -- ..........**
17 -- .....***.*..
18 -- ........*.**
19 -- ...**.......
20 -- .**.........
21 -- ......**.*..
22 -- ..**********
23 -- .*.*********
24 -- .....***....
25 -- .....***.***
26 -- ...*.*******
27 -- ....********
28 -- .....*...*..
29 -- ......******
------------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
13 3001 0.999667 0.000471 0.999334 1.000000 2
14 2998 0.998668 0.001884 0.997335 1.000000 2
15 2964 0.987342 0.000000 0.987342 0.987342 2
16 2912 0.970020 0.000000 0.970020 0.970020 2
17 2005 0.667888 0.001413 0.666889 0.668887 2
18 1913 0.637242 0.003298 0.634910 0.639574 2
19 1863 0.620586 0.000471 0.620253 0.620919 2
20 1138 0.379081 0.004711 0.375750 0.382412 2
21 1124 0.374417 0.001884 0.373085 0.375750 2
22 953 0.317455 0.010835 0.309793 0.325117 2
23 890 0.296469 0.016959 0.284477 0.308461 2
24 871 0.290140 0.005182 0.286476 0.293804 2
25 740 0.246502 0.002827 0.244504 0.248501 2
26 572 0.190540 0.009422 0.183877 0.197202 2
27 565 0.188208 0.009893 0.181213 0.195203 2
28 494 0.164557 0.011306 0.156562 0.172552 2
29 313 0.104264 0.005182 0.100600 0.107928 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.039762 0.000454 0.004940 0.079400 0.036035 1.000 2
length{all}[2] 0.009522 0.000108 0.000003 0.029869 0.006191 1.000 2
length{all}[3] 0.009664 0.000096 0.000009 0.028579 0.006617 1.000 2
length{all}[4] 0.087090 0.001511 0.023621 0.166052 0.081004 1.000 2
length{all}[5] 0.029157 0.000529 0.000005 0.075034 0.023852 1.000 2
length{all}[6] 0.072068 0.001313 0.013047 0.144741 0.066633 1.000 2
length{all}[7] 0.070853 0.001303 0.013075 0.140100 0.064497 1.000 2
length{all}[8] 0.071338 0.001304 0.014288 0.145088 0.065174 1.000 2
length{all}[9] 0.146708 0.003289 0.049674 0.256342 0.140223 1.000 2
length{all}[10] 0.053568 0.000981 0.002671 0.116141 0.047844 1.000 2
length{all}[11] 0.109979 0.002310 0.028686 0.203393 0.102226 1.000 2
length{all}[12] 0.063163 0.001248 0.005364 0.133800 0.056463 1.001 2
length{all}[13] 0.124748 0.002811 0.036017 0.230582 0.116424 1.000 2
length{all}[14] 0.116846 0.002833 0.027704 0.224024 0.108529 1.000 2
length{all}[15] 0.064099 0.001132 0.011075 0.132208 0.057711 1.000 2
length{all}[16] 0.078012 0.002097 0.009328 0.168805 0.070218 1.000 2
length{all}[17] 0.047555 0.001122 0.000109 0.113390 0.039826 1.000 2
length{all}[18] 0.066683 0.001924 0.000201 0.146799 0.057149 1.000 2
length{all}[19] 0.034254 0.000756 0.000028 0.087788 0.027870 0.999 2
length{all}[20] 0.011310 0.000125 0.000011 0.034600 0.007605 0.999 2
length{all}[21] 0.028661 0.000559 0.000041 0.078449 0.022035 0.999 2
length{all}[22] 0.009180 0.000086 0.000038 0.028086 0.006015 0.999 2
length{all}[23] 0.009407 0.000093 0.000006 0.028287 0.006363 1.005 2
length{all}[24] 0.028362 0.000699 0.000098 0.077657 0.021860 1.003 2
length{all}[25] 0.044145 0.001122 0.000034 0.108064 0.035473 1.002 2
length{all}[26] 0.019759 0.000414 0.000032 0.059963 0.013827 1.002 2
length{all}[27] 0.020394 0.000373 0.000097 0.058605 0.015134 0.999 2
length{all}[28] 0.020210 0.000398 0.000149 0.053446 0.014308 1.000 2
length{all}[29] 0.030517 0.000697 0.000402 0.078825 0.023582 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005043
Maximum standard deviation of split frequencies = 0.016959
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
|
+ /-------------- C4 (4)
| /--------------------62-------------------+
| | \-------------- C5 (5)
| |
| | /---------------------------- C6 (6)
| | |
\------99-----+ | /-------------- C7 (7)
| /------67-----+-----100-----+
| | | \-------------- C8 (8)
| | |
| | \---------------------------- C10 (10)
\-----100-----+
| /---------------------------- C9 (9)
| |
\------64-----+ /-------------- C11 (11)
\------97-----+
\-------------- C12 (12)
Phylogram (based on average branch lengths):
/------ C1 (1)
|
|- C2 (2)
|
|- C3 (3)
|
+ /-------------- C4 (4)
| /----+
| | \---- C5 (5)
| |
| | /------------ C6 (6)
| | |
\---------+ | /----------- C7 (7)
| /------+--------------------+
| | | \------------ C8 (8)
| | |
| | \--------- C10 (10)
\------------------+
| /------------------------ C9 (9)
| |
\----------+ /------------------ C11 (11)
\-----------+
\---------- C12 (12)
|-------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (480 trees sampled):
50 % credible set contains 29 trees
90 % credible set contains 222 trees
95 % credible set contains 330 trees
99 % credible set contains 450 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 12 ls = 231
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Reading seq #12: C12
Sequences read..
Counting site patterns.. 0:00
66 patterns at 77 / 77 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11 12
528 bytes for distance
64416 bytes for conP
8976 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, ((4, 5), ((6, (7, 8), 10), (9, (11, 12))))); MP score: 86
257664 bytes for conP, adjusted
0.025548 0.007052 0.007052 0.055376 0.030160 0.097259 0.017967 0.104970 0.026939 0.069914 0.144160 0.067811 0.076843 0.068754 0.051259 0.160013 0.059409 0.101674 0.069533 0.300000 1.300000
ntime & nrate & np: 19 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 21
lnL0 = -871.843578
Iterating by ming2
Initial: fx= 871.843578
x= 0.02555 0.00705 0.00705 0.05538 0.03016 0.09726 0.01797 0.10497 0.02694 0.06991 0.14416 0.06781 0.07684 0.06875 0.05126 0.16001 0.05941 0.10167 0.06953 0.30000 1.30000
1 h-m-p 0.0000 0.0001 209.1267 ++ 867.988080 m 0.0001 26 | 2/21
2 h-m-p 0.0000 0.0003 375.7431 +YCYYC 858.245584 4 0.0003 57 | 2/21
3 h-m-p 0.0000 0.0001 411.9736 +YYCYCCC 855.357973 6 0.0001 91 | 2/21
4 h-m-p 0.0001 0.0004 131.2891 +YYCCCC 853.751490 5 0.0003 124 | 2/21
5 h-m-p 0.0002 0.0016 157.3918 ++ 846.185807 m 0.0016 148 | 2/21
6 h-m-p -0.0000 -0.0000 371.9679
h-m-p: -2.91254206e-20 -1.45627103e-19 3.71967902e+02 846.185807
.. | 2/21
7 h-m-p 0.0000 0.0028 1316.5229 +YYYCCC 839.172939 5 0.0000 201 | 2/21
8 h-m-p 0.0004 0.0020 160.8237 +CYYCCC 821.660851 5 0.0017 234 | 2/21
9 h-m-p 0.0002 0.0008 143.9474 ++ 812.677956 m 0.0008 258 | 2/21
10 h-m-p 0.0000 0.0002 4078.0177 ++ 741.308594 m 0.0002 282 | 2/21
11 h-m-p -0.0000 -0.0000 89103.0152
h-m-p: -6.79005268e-22 -3.39502634e-21 8.91030152e+04 741.308594
.. | 2/21
12 h-m-p 0.0000 0.0017 978.6657 +YYCYCC 736.155144 5 0.0001 335 | 2/21
13 h-m-p 0.0003 0.0016 148.4945 +YYYCYYCCC 710.600134 8 0.0014 372 | 2/21
14 h-m-p 0.0002 0.0009 58.3687 CCCCC 710.229799 4 0.0002 404 | 2/21
15 h-m-p 0.0004 0.0038 37.7191 +YYYCCCCC 709.359841 7 0.0015 440 | 2/21
16 h-m-p 0.0021 0.0107 20.0593 YCCC 709.201647 3 0.0011 469 | 2/21
17 h-m-p 0.0009 0.0202 25.9651 +YCC 708.204945 2 0.0071 497 | 2/21
18 h-m-p 0.0013 0.0063 92.9000 +YCCC 706.308672 3 0.0040 527 | 2/21
19 h-m-p 0.0013 0.0065 95.0173 CCCC 705.497199 3 0.0018 557 | 2/21
20 h-m-p 0.0004 0.0021 67.1406 YCCC 705.187349 3 0.0009 586 | 2/21
21 h-m-p 0.0040 0.0201 13.7839 YCCC 705.079698 3 0.0023 615 | 2/21
22 h-m-p 0.0081 0.0649 3.9571 CCC 705.069468 2 0.0016 643 | 2/21
23 h-m-p 0.0047 0.2047 1.3547 CC 705.062809 1 0.0050 669 | 2/21
24 h-m-p 0.0061 0.2546 1.1056 YC 705.046387 1 0.0112 694 | 2/21
25 h-m-p 0.0025 0.1123 5.0518 +CY 704.967850 1 0.0100 721 | 2/21
26 h-m-p 0.0024 0.0320 21.1885 +YCCC 704.738449 3 0.0066 751 | 2/21
27 h-m-p 0.0036 0.0179 25.6989 YCC 704.656487 2 0.0021 778 | 2/21
28 h-m-p 0.0255 0.1275 0.8171 -YC 704.655087 1 0.0027 804 | 2/21
29 h-m-p 0.0054 2.0458 0.4160 ++YC 704.563204 1 0.2002 850 | 2/21
30 h-m-p 0.0033 0.0344 25.3053 YCC 704.413994 2 0.0052 896 | 2/21
31 h-m-p 0.0112 0.0560 9.5000 YC 704.394017 1 0.0021 921 | 2/21
32 h-m-p 0.1755 6.8346 0.1114 CC 704.391147 1 0.0644 947 | 2/21
33 h-m-p 0.0018 0.8357 3.9164 ++CCC 704.322917 2 0.0405 996 | 2/21
34 h-m-p 1.6000 8.0000 0.0272 YCC 704.281586 2 3.0969 1023 | 2/21
35 h-m-p 1.6000 8.0000 0.0077 +YC 704.184070 1 4.0095 1068 | 2/21
36 h-m-p 0.3799 8.0000 0.0812 +YCC 704.164987 2 1.1950 1115 | 2/21
37 h-m-p 1.6000 8.0000 0.0056 YC 704.164538 1 0.9919 1159 | 2/21
38 h-m-p 1.6000 8.0000 0.0008 YC 704.164502 1 1.0336 1203 | 2/21
39 h-m-p 1.6000 8.0000 0.0001 Y 704.164499 0 1.1897 1246 | 2/21
40 h-m-p 1.6000 8.0000 0.0000 Y 704.164499 0 1.1126 1289 | 2/21
41 h-m-p 1.6000 8.0000 0.0000 Y 704.164499 0 0.9735 1332 | 2/21
42 h-m-p 1.6000 8.0000 0.0000 C 704.164499 0 1.6000 1375 | 2/21
43 h-m-p 1.6000 8.0000 0.0000 Y 704.164499 0 0.4000 1418 | 2/21
44 h-m-p 0.4926 8.0000 0.0000 ---------------Y 704.164499 0 0.0000 1476
Out..
lnL = -704.164499
1477 lfun, 1477 eigenQcodon, 28063 P(t)
Time used: 0:07
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, ((4, 5), ((6, (7, 8), 10), (9, (11, 12))))); MP score: 86
0.025548 0.007052 0.007052 0.055376 0.030160 0.097259 0.017967 0.104970 0.026939 0.069914 0.144160 0.067811 0.076843 0.068754 0.051259 0.160013 0.059409 0.101674 0.069533 2.778386 0.822315 0.590611
ntime & nrate & np: 19 2 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.232896
np = 22
lnL0 = -765.814709
Iterating by ming2
Initial: fx= 765.814709
x= 0.02555 0.00705 0.00705 0.05538 0.03016 0.09726 0.01797 0.10497 0.02694 0.06991 0.14416 0.06781 0.07684 0.06875 0.05126 0.16001 0.05941 0.10167 0.06953 2.77839 0.82232 0.59061
1 h-m-p 0.0000 0.0001 144.2739 ++ 763.908413 m 0.0001 27 | 2/22
2 h-m-p 0.0001 0.0008 176.1723 ++ 755.261077 m 0.0008 52 | 2/22
3 h-m-p 0.0000 0.0000 1963.5989
h-m-p: 2.28042676e-21 1.14021338e-20 1.96359894e+03 755.261077
.. | 2/22
4 h-m-p 0.0000 0.0036 359.2071 ++CYYCC 753.006074 4 0.0001 108 | 2/22
5 h-m-p 0.0004 0.0033 94.4736 ++ 722.526194 m 0.0033 133 | 3/22
6 h-m-p 0.0000 0.0001 1573.0538 ++ 713.939988 m 0.0001 158 | 3/22
7 h-m-p 0.0000 0.0000 1624.9215 YCYCCC 712.720867 5 0.0000 191 | 3/22
8 h-m-p 0.0008 0.0040 9.7895 YCCC 712.649431 3 0.0015 221 | 2/22
9 h-m-p 0.0004 0.0019 35.7929 CCC 712.478270 2 0.0004 250 | 2/22
10 h-m-p 0.0016 0.0078 4.9371 CC 712.453547 1 0.0024 277 | 2/22
11 h-m-p 0.0042 0.0880 2.8619 YC 712.426518 1 0.0077 303 | 2/22
12 h-m-p 0.0020 0.0327 10.9268 YC 712.380995 1 0.0037 329 | 2/22
13 h-m-p 0.0034 0.0474 11.7738 CCC 712.330719 2 0.0042 358 | 2/22
14 h-m-p 0.0040 0.0480 12.4438 CCC 712.288767 2 0.0037 387 | 2/22
15 h-m-p 0.0047 0.0603 9.6938 CCC 712.247128 2 0.0056 416 | 2/22
16 h-m-p 0.0290 0.1450 1.3699 --------------.. | 2/22
17 h-m-p 0.0000 0.0006 261.5257 ++CCCCC 709.364984 4 0.0002 488 | 2/22
18 h-m-p 0.0001 0.0007 72.6262 ++ 706.753323 m 0.0007 513 | 2/22
19 h-m-p 0.0001 0.0004 204.1320 +YCYCCC 705.204092 5 0.0002 547 | 2/22
20 h-m-p 0.0001 0.0005 176.3425 YCCCCC 704.302134 5 0.0002 581 | 2/22
21 h-m-p 0.0004 0.0020 29.0819 CYCCC 704.085509 4 0.0006 613 | 2/22
22 h-m-p 0.0055 0.0592 3.1394 CC 704.079943 1 0.0011 640 | 2/22
23 h-m-p 0.0017 0.0330 2.0810 YC 704.077722 1 0.0012 666 | 2/22
24 h-m-p 0.0032 0.5099 0.8026 CC 704.075989 1 0.0042 693 | 2/22
25 h-m-p 0.0032 0.3293 1.0323 +YC 704.070417 1 0.0101 740 | 2/22
26 h-m-p 0.0018 0.2096 5.6974 +YC 704.022935 1 0.0153 767 | 2/22
27 h-m-p 0.0034 0.0233 25.7498 CC 703.972378 1 0.0036 794 | 2/22
28 h-m-p 0.0083 0.0508 11.1661 CC 703.958416 1 0.0024 821 | 2/22
29 h-m-p 0.0152 0.1667 1.7327 YC 703.957054 1 0.0019 847 | 2/22
30 h-m-p 0.0060 0.3134 0.5474 YC 703.956699 1 0.0025 873 | 2/22
31 h-m-p 0.0055 1.0812 0.2496 C 703.956404 0 0.0050 918 | 2/22
32 h-m-p 0.0080 1.2948 0.1565 YC 703.955155 1 0.0155 964 | 2/22
33 h-m-p 0.0031 0.6553 0.7768 ++YCC 703.888586 2 0.0964 1014 | 2/22
34 h-m-p 0.0060 0.0323 12.4823 CC 703.866437 1 0.0021 1061 | 2/22
35 h-m-p 0.0143 0.1330 1.7970 YC 703.864338 1 0.0020 1087 | 2/22
36 h-m-p 0.0146 0.4352 0.2452 C 703.864162 0 0.0035 1112 | 2/22
37 h-m-p 0.0114 5.6986 0.1872 ++CC 703.852685 1 0.2609 1161 | 2/22
38 h-m-p 0.0032 0.0629 15.0934 CC 703.843054 1 0.0028 1208 | 2/22
39 h-m-p 1.6000 8.0000 0.0247 YC 703.836629 1 0.9952 1234 | 2/22
40 h-m-p 1.6000 8.0000 0.0059 YC 703.835515 1 0.9347 1280 | 2/22
41 h-m-p 1.6000 8.0000 0.0027 YC 703.835403 1 0.9759 1326 | 2/22
42 h-m-p 1.6000 8.0000 0.0004 Y 703.835402 0 1.0528 1371 | 2/22
43 h-m-p 1.6000 8.0000 0.0000 Y 703.835402 0 0.9583 1416 | 2/22
44 h-m-p 1.6000 8.0000 0.0000 Y 703.835402 0 1.6000 1461 | 2/22
45 h-m-p 1.6000 8.0000 0.0000 Y 703.835402 0 0.4000 1506 | 2/22
46 h-m-p 0.8352 8.0000 0.0000 C 703.835402 0 0.2088 1551 | 2/22
47 h-m-p 0.1041 8.0000 0.0000 --------------.. | 2/22
48 h-m-p 0.0160 8.0000 0.0002 ---------C 703.835402 0 0.0000 1662
Out..
lnL = -703.835402
1663 lfun, 4989 eigenQcodon, 63194 P(t)
Time used: 0:23
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, ((4, 5), ((6, (7, 8), 10), (9, (11, 12))))); MP score: 86
initial w for M2:NSpselection reset.
0.025548 0.007052 0.007052 0.055376 0.030160 0.097259 0.017967 0.104970 0.026939 0.069914 0.144160 0.067811 0.076843 0.068754 0.051259 0.160013 0.059409 0.101674 0.069533 2.819983 0.862503 0.107410 0.336572 2.818396
ntime & nrate & np: 19 3 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.862945
np = 24
lnL0 = -775.315081
Iterating by ming2
Initial: fx= 775.315081
x= 0.02555 0.00705 0.00705 0.05538 0.03016 0.09726 0.01797 0.10497 0.02694 0.06991 0.14416 0.06781 0.07684 0.06875 0.05126 0.16001 0.05941 0.10167 0.06953 2.81998 0.86250 0.10741 0.33657 2.81840
1 h-m-p 0.0000 0.0001 153.0954 ++ 772.607849 m 0.0001 29 | 2/24
2 h-m-p 0.0001 0.0018 122.1277 ++ 762.002821 m 0.0018 56 | 2/24
3 h-m-p 0.0000 0.0002 1446.2667 +YYYYCYCCCC 750.844581 9 0.0001 97 | 2/24
4 h-m-p 0.0000 0.0001 1081.8567 ++ 746.410506 m 0.0001 124 | 3/24
5 h-m-p 0.0007 0.0034 27.3217 ++ 742.629562 m 0.0034 151 | 3/24
6 h-m-p 0.0002 0.0011 119.8478 +YYCCC 741.250872 4 0.0008 185 | 3/24
7 h-m-p 0.0001 0.0007 282.5963 ++ 735.940188 m 0.0007 212 | 3/24
8 h-m-p 0.0000 0.0000 45.4236
h-m-p: 1.15522098e-19 5.77610490e-19 4.54236073e+01 735.940188
.. | 3/24
9 h-m-p 0.0001 0.0290 548.3723 +YCCCCC 728.297607 5 0.0002 273 | 3/24
10 h-m-p 0.0024 0.0120 45.5181 YYCCC 726.099066 4 0.0032 306 | 3/24
11 h-m-p 0.0009 0.0046 30.1099 ++ 723.897098 m 0.0046 333 | 3/24
12 h-m-p 0.0015 0.0100 92.2953 +YYYC 718.338221 3 0.0056 364 | 2/24
13 h-m-p 0.0003 0.0014 446.0092 YCCCC 718.016342 4 0.0001 398 | 2/24
14 h-m-p 0.0004 0.0121 154.8061 ++YYC 712.120194 2 0.0048 429 | 2/24
15 h-m-p 0.0022 0.0109 46.7976 CCCC 711.061476 3 0.0032 462 | 2/24
16 h-m-p 0.0083 0.0413 11.1264 CCC 710.939766 2 0.0029 493 | 2/24
17 h-m-p 0.0068 0.0692 4.7348 CYC 710.876307 2 0.0060 523 | 2/24
18 h-m-p 0.0081 0.1065 3.4783 CCC 710.822613 2 0.0085 554 | 2/24
19 h-m-p 0.0033 0.0748 8.9050 +CCCC 710.550539 3 0.0164 588 | 2/24
20 h-m-p 0.0038 0.0310 38.8569 +YCYCCC 709.122938 5 0.0171 624 | 2/24
21 h-m-p 0.0011 0.0056 171.0661 YCCCCC 708.232524 5 0.0026 660 | 2/24
22 h-m-p 0.0039 0.0197 18.9154 YCCC 708.148798 3 0.0026 692 | 2/24
23 h-m-p 0.0159 0.1067 3.0699 CCC 708.128331 2 0.0049 723 | 2/24
24 h-m-p 0.0058 0.1656 2.6076 YC 708.086043 1 0.0101 751 | 2/24
25 h-m-p 0.0027 0.0754 9.6130 +YC 707.705272 1 0.0226 780 | 2/24
26 h-m-p 0.0022 0.0108 59.2826 +YCCC 707.097317 3 0.0055 813 | 2/24
27 h-m-p 0.0081 0.0405 18.7695 CCC 707.022241 2 0.0025 844 | 2/24
28 h-m-p 0.0182 0.1012 2.5468 CC 707.010054 1 0.0038 873 | 2/24
29 h-m-p 0.0079 1.6309 1.2158 ++YCCC 706.377294 3 0.2986 907 | 2/24
30 h-m-p 0.0024 0.0118 47.9536 CCC 706.157866 2 0.0024 938 | 2/24
31 h-m-p 0.1489 3.7611 0.7677 +YCCCC 704.543737 4 1.5331 973 | 2/24
32 h-m-p 0.6693 3.3467 0.5864 CCCC 704.131335 3 0.7764 1028 | 2/24
33 h-m-p 1.6000 8.0000 0.1375 YC 704.059220 1 0.9318 1078 | 2/24
34 h-m-p 0.8820 8.0000 0.1452 YC 704.038977 1 1.6212 1128 | 2/24
35 h-m-p 0.6082 8.0000 0.3871 +CCC 703.974638 2 2.3341 1182 | 2/24
36 h-m-p 1.2959 8.0000 0.6972 CC 703.902555 1 1.6507 1233 | 2/24
37 h-m-p 1.6000 8.0000 0.4680 CCC 703.881922 2 1.3278 1286 | 2/24
38 h-m-p 1.0642 8.0000 0.5839 CC 703.868980 1 1.1748 1337 | 2/24
39 h-m-p 1.2914 8.0000 0.5312 YCC 703.854734 2 2.1317 1389 | 2/24
40 h-m-p 1.6000 8.0000 0.6508 CCC 703.842332 2 1.9633 1442 | 2/24
41 h-m-p 1.6000 8.0000 0.5924 CC 703.838268 1 1.3191 1493 | 2/24
42 h-m-p 1.6000 8.0000 0.4848 YC 703.837171 1 1.0946 1543 | 2/24
43 h-m-p 1.6000 8.0000 0.3271 YC 703.836837 1 1.2469 1593 | 2/24
44 h-m-p 1.1632 8.0000 0.3506 YC 703.836423 1 2.3252 1643 | 2/24
45 h-m-p 1.6000 8.0000 0.4849 YC 703.835800 1 2.7441 1693 | 2/24
46 h-m-p 1.6000 8.0000 0.6219 CC 703.835587 1 1.2765 1744 | 2/24
47 h-m-p 1.5759 8.0000 0.5038 C 703.835501 0 2.3207 1793 | 2/24
48 h-m-p 1.6000 8.0000 0.5410 C 703.835444 0 2.0787 1842 | 2/24
49 h-m-p 1.6000 8.0000 0.5477 C 703.835422 0 1.9196 1891 | 2/24
50 h-m-p 1.6000 8.0000 0.5504 C 703.835411 0 2.3125 1940 | 2/24
51 h-m-p 1.6000 8.0000 0.5395 C 703.835406 0 2.0517 1989 | 2/24
52 h-m-p 1.6000 8.0000 0.5651 C 703.835404 0 1.7850 2038 | 2/24
53 h-m-p 1.6000 8.0000 0.6150 C 703.835403 0 1.6000 2087 | 2/24
54 h-m-p 1.5058 8.0000 0.6535 Y 703.835402 0 2.4308 2136 | 2/24
55 h-m-p 1.6000 8.0000 0.5659 C 703.835402 0 1.5639 2185 | 2/24
56 h-m-p 1.5817 8.0000 0.5595 C 703.835402 0 2.1635 2234 | 2/24
57 h-m-p 1.6000 8.0000 0.6744 C 703.835402 0 2.0472 2283 | 2/24
58 h-m-p 1.6000 8.0000 0.6968 C 703.835402 0 2.1363 2332 | 2/24
59 h-m-p 1.6000 8.0000 0.9032 C 703.835402 0 2.3241 2381 | 2/24
60 h-m-p 1.6000 8.0000 1.0976 C 703.835402 0 1.7735 2430 | 2/24
61 h-m-p 1.0009 8.0000 1.9447 --------Y 703.835402 0 0.0000 2465 | 2/24
62 h-m-p 0.0160 8.0000 2.0573 -------------.. | 2/24
63 h-m-p 0.0160 8.0000 0.0024 ------Y 703.835402 0 0.0000 2536 | 2/24
64 h-m-p 0.0160 8.0000 0.0007 -C 703.835402 0 0.0010 2586 | 2/24
65 h-m-p 0.0160 8.0000 0.0005 -------------.. | 2/24
66 h-m-p 0.0160 8.0000 0.0006 ------C 703.835402 0 0.0000 2701
Out..
lnL = -703.835402
2702 lfun, 10808 eigenQcodon, 154014 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -715.938101 S = -696.338274 -12.231901
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 66 patterns 1:01
did 20 / 66 patterns 1:01
did 30 / 66 patterns 1:01
did 40 / 66 patterns 1:01
did 50 / 66 patterns 1:01
did 60 / 66 patterns 1:01
did 66 / 66 patterns 1:01
Time used: 1:01
Model 3: discrete
TREE # 1
(1, 2, 3, ((4, 5), ((6, (7, 8), 10), (9, (11, 12))))); MP score: 86
0.025548 0.007052 0.007052 0.055376 0.030160 0.097259 0.017967 0.104970 0.026939 0.069914 0.144160 0.067811 0.076843 0.068754 0.051259 0.160013 0.059409 0.101674 0.069533 2.819981 0.335590 0.845675 0.014311 0.036654 0.051658
ntime & nrate & np: 19 4 25
Bounds (np=25):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 11.566089
np = 25
lnL0 = -706.366746
Iterating by ming2
Initial: fx= 706.366746
x= 0.02555 0.00705 0.00705 0.05538 0.03016 0.09726 0.01797 0.10497 0.02694 0.06991 0.14416 0.06781 0.07684 0.06875 0.05126 0.16001 0.05941 0.10167 0.06953 2.81998 0.33559 0.84567 0.01431 0.03665 0.05166
1 h-m-p 0.0000 0.0001 124.8866 ++ 704.918608 m 0.0001 30 | 2/25
2 h-m-p 0.0001 0.0007 35.2324 ++ 704.444802 m 0.0007 58 | 3/25
3 h-m-p 0.0011 0.0084 20.3907 CCC 704.325835 2 0.0009 90 | 3/25
4 h-m-p 0.0011 0.0057 13.8894 YCCC 704.188883 3 0.0022 123 | 3/25
5 h-m-p 0.0001 0.0006 70.2799 +CYC 703.998156 2 0.0005 155 | 3/25
6 h-m-p 0.0000 0.0002 39.5869 ++ 703.940839 m 0.0002 183 | 4/25
7 h-m-p 0.0012 0.0100 7.2334 YCC 703.924344 2 0.0009 214 | 4/25
8 h-m-p 0.0018 0.0356 3.5406 CCC 703.914416 2 0.0014 246 | 4/25
9 h-m-p 0.0046 0.1189 1.1023 +YCC 703.855336 2 0.0138 278 | 4/25
10 h-m-p 0.0024 0.0756 6.2916 +CCC 703.557818 2 0.0087 311 | 4/25
11 h-m-p 0.0034 0.0226 15.9058 CCC 703.337312 2 0.0027 343 | 4/25
12 h-m-p 0.0125 0.0867 3.4662 YC 703.325960 1 0.0020 372 | 4/25
13 h-m-p 0.0054 0.3099 1.2966 YC 703.323352 1 0.0029 401 | 4/25
14 h-m-p 0.0077 0.5979 0.4930 CC 703.320059 1 0.0101 431 | 4/25
15 h-m-p 0.0027 0.3892 1.8655 +YC 703.285548 1 0.0228 482 | 4/25
16 h-m-p 0.0030 0.0541 14.0675 YC 703.208200 1 0.0066 511 | 4/25
17 h-m-p 0.0100 0.0651 9.2210 YC 703.175381 1 0.0044 540 | 4/25
18 h-m-p 0.0132 0.0658 2.1285 CC 703.171427 1 0.0029 570 | 4/25
19 h-m-p 0.0053 0.2783 1.1414 C 703.168231 0 0.0052 598 | 4/25
20 h-m-p 0.0029 0.2675 2.0610 +CC 703.155374 1 0.0120 629 | 4/25
21 h-m-p 0.0019 0.0805 12.8442 +YCCC 703.064853 3 0.0133 663 | 4/25
22 h-m-p 0.0059 0.0293 24.2049 CCC 703.042544 2 0.0018 695 | 4/25
23 h-m-p 0.4569 8.0000 0.0971 +YCC 703.009606 2 1.3541 727 | 4/25
24 h-m-p 0.9712 8.0000 0.1354 CCC 702.987299 2 1.4595 780 | 4/25
25 h-m-p 1.6000 8.0000 0.1191 YC 702.978688 1 0.8796 830 | 4/25
26 h-m-p 1.6000 8.0000 0.0268 CC 702.973319 1 1.8203 881 | 4/25
27 h-m-p 1.6000 8.0000 0.0271 C 702.971675 0 1.5272 930 | 4/25
28 h-m-p 1.6000 8.0000 0.0018 YC 702.971515 1 1.1799 980 | 4/25
29 h-m-p 1.6000 8.0000 0.0008 C 702.971496 0 1.7024 1029 | 4/25
30 h-m-p 1.6000 8.0000 0.0003 Y 702.971495 0 1.2406 1078 | 4/25
31 h-m-p 1.6000 8.0000 0.0001 C 702.971495 0 1.3464 1127 | 4/25
32 h-m-p 1.6000 8.0000 0.0000 Y 702.971495 0 1.0386 1176 | 4/25
33 h-m-p 1.6000 8.0000 0.0000 Y 702.971495 0 0.9434 1225 | 4/25
34 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 4/25
35 h-m-p 0.0160 8.0000 0.0001 --------C 702.971495 0 0.0000 1345
Out..
lnL = -702.971495
1346 lfun, 5384 eigenQcodon, 76722 P(t)
Time used: 1:20
Model 7: beta
TREE # 1
(1, 2, 3, ((4, 5), ((6, (7, 8), 10), (9, (11, 12))))); MP score: 86
0.025548 0.007052 0.007052 0.055376 0.030160 0.097259 0.017967 0.104970 0.026939 0.069914 0.144160 0.067811 0.076843 0.068754 0.051259 0.160013 0.059409 0.101674 0.069533 2.786709 0.637551 1.244267
ntime & nrate & np: 19 1 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.309556
np = 22
lnL0 = -733.670065
Iterating by ming2
Initial: fx= 733.670065
x= 0.02555 0.00705 0.00705 0.05538 0.03016 0.09726 0.01797 0.10497 0.02694 0.06991 0.14416 0.06781 0.07684 0.06875 0.05126 0.16001 0.05941 0.10167 0.06953 2.78671 0.63755 1.24427
1 h-m-p 0.0000 0.0001 132.2839 ++ 731.932881 m 0.0001 27 | 2/22
2 h-m-p 0.0001 0.0018 70.9141 ++ 728.642236 m 0.0018 52 | 2/22
3 h-m-p 0.0001 0.0007 430.6329 +YYCCCC 724.149142 5 0.0005 86 | 2/22
4 h-m-p 0.0000 0.0001 582.7219 ++ 721.725887 m 0.0001 111 | 2/22
5 h-m-p 0.0001 0.0005 651.6374 +YYYYCCC 713.519163 6 0.0004 145 | 2/22
6 h-m-p 0.0002 0.0011 24.9550 ++ 713.164743 m 0.0011 170 | 2/22
7 h-m-p 0.0024 0.0485 12.0232 +CCCCC 712.091470 4 0.0155 204 | 2/22
8 h-m-p 0.0020 0.0100 61.5094 YCCCC 710.826622 4 0.0041 236 | 2/22
9 h-m-p 0.0031 0.0153 62.5908 CCCCC 709.267368 4 0.0051 269 | 2/22
10 h-m-p 0.0030 0.0152 35.2598 YYCC 708.851906 3 0.0027 298 | 2/22
11 h-m-p 0.0057 0.0285 9.5006 CCC 708.784270 2 0.0022 327 | 2/22
12 h-m-p 0.0066 0.0872 3.1788 CCC 708.701530 2 0.0073 356 | 2/22
13 h-m-p 0.0103 0.0916 2.2458 +YYCC 707.842229 3 0.0370 386 | 2/22
14 h-m-p 0.0021 0.0156 39.8004 YCCC 706.145600 3 0.0039 416 | 2/22
15 h-m-p 0.0014 0.0069 60.7083 YCCCCC 704.234732 5 0.0027 450 | 2/22
16 h-m-p 0.0023 0.0116 20.0008 YCC 704.022265 2 0.0016 478 | 2/22
17 h-m-p 0.0064 0.0320 4.8500 YC 703.989836 1 0.0027 504 | 2/22
18 h-m-p 0.0071 0.1143 1.8342 YC 703.978730 1 0.0041 530 | 2/22
19 h-m-p 0.0069 0.4108 1.0797 +YCCC 703.847701 3 0.0528 561 | 2/22
20 h-m-p 0.0018 0.0203 31.6332 +YCC 703.417504 2 0.0058 590 | 2/22
21 h-m-p 0.0042 0.0208 22.6459 YC 703.308436 1 0.0022 616 | 2/22
22 h-m-p 0.1592 8.0000 0.3084 YC 703.167708 1 0.3923 642 | 2/22
23 h-m-p 1.3215 8.0000 0.0915 CYC 703.083698 2 1.2503 690 | 2/22
24 h-m-p 1.6000 8.0000 0.0343 YCC 703.045187 2 1.2309 738 | 2/22
25 h-m-p 1.6000 8.0000 0.0197 YC 703.037408 1 1.0051 784 | 2/22
26 h-m-p 0.8079 8.0000 0.0245 CC 703.034278 1 1.1904 831 | 2/22
27 h-m-p 1.4823 8.0000 0.0196 CC 703.032265 1 1.2213 878 | 2/22
28 h-m-p 1.6000 8.0000 0.0074 YC 703.031133 1 1.2181 924 | 2/22
29 h-m-p 1.6000 8.0000 0.0031 C 703.030840 0 1.7182 969 | 2/22
30 h-m-p 0.7529 8.0000 0.0070 +YC 703.030103 1 4.0726 1016 | 2/22
31 h-m-p 1.3850 8.0000 0.0205 YC 703.029032 1 2.3456 1062 | 2/22
32 h-m-p 1.6000 8.0000 0.0115 C 703.028682 0 1.7437 1107 | 2/22
33 h-m-p 1.6000 8.0000 0.0115 ++ 703.026836 m 8.0000 1152 | 2/22
34 h-m-p 0.3110 8.0000 0.2968 +YYY 703.022745 2 1.2439 1200 | 2/22
35 h-m-p 1.6000 8.0000 0.0327 CC 703.021296 1 1.7399 1247 | 2/22
36 h-m-p 1.6000 8.0000 0.0039 YC 703.021235 1 0.8725 1293 | 2/22
37 h-m-p 1.3371 8.0000 0.0025 Y 703.021233 0 0.9885 1338 | 2/22
38 h-m-p 1.6000 8.0000 0.0015 Y 703.021233 0 0.9787 1383 | 2/22
39 h-m-p 1.6000 8.0000 0.0003 Y 703.021233 0 0.9256 1428 | 2/22
40 h-m-p 1.6000 8.0000 0.0000 Y 703.021233 0 1.0218 1473 | 2/22
41 h-m-p 1.6000 8.0000 0.0000 --Y 703.021233 0 0.0250 1520
Out..
lnL = -703.021233
1521 lfun, 16731 eigenQcodon, 288990 P(t)
Time used: 2:31
Model 8: beta&w>1
TREE # 1
(1, 2, 3, ((4, 5), ((6, (7, 8), 10), (9, (11, 12))))); MP score: 86
initial w for M8:NSbetaw>1 reset.
0.025548 0.007052 0.007052 0.055376 0.030160 0.097259 0.017967 0.104970 0.026939 0.069914 0.144160 0.067811 0.076843 0.068754 0.051259 0.160013 0.059409 0.101674 0.069533 2.787071 0.900000 0.681712 1.353905 2.843187
ntime & nrate & np: 19 2 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.610781
np = 24
lnL0 = -745.324090
Iterating by ming2
Initial: fx= 745.324090
x= 0.02555 0.00705 0.00705 0.05538 0.03016 0.09726 0.01797 0.10497 0.02694 0.06991 0.14416 0.06781 0.07684 0.06875 0.05126 0.16001 0.05941 0.10167 0.06953 2.78707 0.90000 0.68171 1.35390 2.84319
1 h-m-p 0.0000 0.0001 193.9940 ++ 740.843958 m 0.0001 29 | 2/24
2 h-m-p 0.0001 0.0003 270.5040 ++ 730.968239 m 0.0003 56 | 3/24
3 h-m-p 0.0005 0.0025 59.9014 +YCYCCC 729.132717 5 0.0014 92 | 3/24
4 h-m-p 0.0000 0.0002 549.6547 ++ 726.104246 m 0.0002 119 | 3/24
5 h-m-p 0.0000 0.0001 1275.2095 ++ 720.221048 m 0.0001 146 | 3/24
6 h-m-p -0.0000 -0.0000 17354.5098
h-m-p: -8.74019123e-22 -4.37009561e-21 1.73545098e+04 720.221048
.. | 3/24
7 h-m-p 0.0000 0.0062 552.5913 ++CYYCC 714.309653 4 0.0001 206 | 3/24
8 h-m-p 0.0011 0.0054 65.3098 YCCC 710.004556 3 0.0026 238 | 3/24
9 h-m-p 0.0004 0.0018 105.4121 +YYCYCCC 705.711199 6 0.0012 275 | 3/24
10 h-m-p 0.0051 0.0257 8.4212 YCC 705.630620 2 0.0022 305 | 3/24
11 h-m-p 0.0042 0.0732 4.4296 CC 705.592290 1 0.0039 334 | 3/24
12 h-m-p 0.0032 0.1115 5.3892 +YC 705.499962 1 0.0091 363 | 3/24
13 h-m-p 0.0025 0.0567 19.6245 +C 705.080264 0 0.0100 391 | 3/24
14 h-m-p 0.0020 0.0147 96.0415 YCCC 704.348745 3 0.0041 423 | 3/24
15 h-m-p 0.0021 0.0106 94.3054 CCCC 703.954084 3 0.0023 456 | 3/24
16 h-m-p 0.0032 0.0158 12.9637 YCC 703.911534 2 0.0019 486 | 3/24
17 h-m-p 0.0097 0.0921 2.5954 CC 703.899563 1 0.0034 515 | 3/24
18 h-m-p 0.0074 0.1816 1.2003 C 703.881532 0 0.0074 542 | 3/24
19 h-m-p 0.0045 0.0599 1.9572 +CCCC 703.659855 3 0.0232 576 | 3/24
20 h-m-p 0.0023 0.0119 19.4803 CCCC 703.413681 3 0.0026 609 | 3/24
21 h-m-p 0.0016 0.0079 11.6423 YCC 703.373323 2 0.0009 639 | 3/24
22 h-m-p 0.0022 0.0155 5.0796 YC 703.358550 1 0.0015 667 | 3/24
23 h-m-p 0.0059 0.1149 1.2745 CC 703.357044 1 0.0017 696 | 3/24
24 h-m-p 0.0049 0.4170 0.4310 YC 703.354345 1 0.0105 724 | 3/24
25 h-m-p 0.0023 0.4458 2.0073 ++YC 703.316058 1 0.0277 775 | 3/24
26 h-m-p 0.0022 0.0320 24.9719 YCCC 703.225905 3 0.0050 807 | 3/24
27 h-m-p 0.0227 0.1135 0.8534 -CC 703.225223 1 0.0021 837 | 3/24
28 h-m-p 0.0798 8.0000 0.0222 ++CCC 703.144004 2 1.7384 891 | 3/24
29 h-m-p 1.6000 8.0000 0.0107 CCCC 703.062703 3 2.6033 945 | 3/24
30 h-m-p 1.1178 8.0000 0.0249 CCC 703.029665 2 1.1720 997 | 3/24
31 h-m-p 0.9093 8.0000 0.0320 CC 703.026224 1 0.8267 1047 | 3/24
32 h-m-p 1.2038 8.0000 0.0220 YC 703.025985 1 0.6351 1096 | 3/24
33 h-m-p 1.6000 8.0000 0.0080 +YC 703.025643 1 4.1199 1146 | 3/24
34 h-m-p 1.0787 8.0000 0.0305 ++ 703.023102 m 8.0000 1194 | 3/24
35 h-m-p 1.6000 8.0000 0.1042 YC 703.022002 1 1.1822 1243 | 3/24
36 h-m-p 1.6000 8.0000 0.0229 YC 703.021965 1 0.7755 1292 | 3/24
37 h-m-p 1.6000 8.0000 0.0004 Y 703.021964 0 0.8348 1340 | 3/24
38 h-m-p 0.4489 8.0000 0.0007 Y 703.021964 0 0.9048 1388 | 3/24
39 h-m-p 1.6000 8.0000 0.0001 +Y 703.021964 0 5.4309 1437 | 3/24
40 h-m-p 0.9187 8.0000 0.0004 ++ 703.021964 m 8.0000 1485 | 3/24
41 h-m-p 0.0207 8.0000 0.1486 +++++ 703.021948 m 8.0000 1536 | 3/24
42 h-m-p 0.0167 0.0834 7.7886 ++ 703.021880 m 0.0834 1584 | 4/24
43 h-m-p 0.3205 8.0000 0.0350 +YC 703.021493 1 0.9942 1613 | 4/24
44 h-m-p 1.6000 8.0000 0.0004 Y 703.021493 0 0.9647 1660 | 4/24
45 h-m-p 1.6000 8.0000 0.0000 Y 703.021493 0 0.8573 1707 | 4/24
46 h-m-p 1.6000 8.0000 0.0000 C 703.021493 0 1.6000 1754 | 4/24
47 h-m-p 1.6000 8.0000 0.0000 --------C 703.021493 0 0.0000 1809
Out..
lnL = -703.021493
1810 lfun, 21720 eigenQcodon, 378290 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -717.626878 S = -696.478044 -14.605323
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 66 patterns 4:05
did 20 / 66 patterns 4:05
did 30 / 66 patterns 4:05
did 40 / 66 patterns 4:05
did 50 / 66 patterns 4:05
did 60 / 66 patterns 4:06
did 66 / 66 patterns 4:06
Time used: 4:06
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=77
D_melanogaster_CG34136-PA MWPNFLAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
D_sechellia_CG34136-PA MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
D_simulans_CG34136-PA MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
D_yakuba_CG34136-PA MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
D_erecta_CG34136-PA MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
D_takahashii_CG34136-PA MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
D_biarmipes_CG34136-PA MWPNFVAVISLLCLAFFAWANAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
D_suzukii_CG34136-PA MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
D_eugracilis_CG34136-PA MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
D_ficusphila_CG34136-PA MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
D_rhopaloa_CG34136-PA MWPNFVAVFSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
D_elegans_CG34136-PA MWPNFVAVISMLCLAFFTWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
*****:**.*:******:**:*****************************
D_melanogaster_CG34136-PA VLMMRRCRHLRVPTAPRLGDVLKRKKK
D_sechellia_CG34136-PA VLMMRRCRHLRVPTAPRLGDVLKRKKK
D_simulans_CG34136-PA VLMMRRCRHLRVPTAPRLGDVLKRKKK
D_yakuba_CG34136-PA VLMMRRCRHLRVPTAPRLGDVLKRKKK
D_erecta_CG34136-PA VLMMRRCRHLRVPTAPRLGDVLKRKKK
D_takahashii_CG34136-PA VLMMRRCRHLRVPTAPRLGDVLKRKKK
D_biarmipes_CG34136-PA VLMMRRCRHLRVPTAPRLGDVLKRKKK
D_suzukii_CG34136-PA VLMMRRCRHLRVPTAPRLGDVLKRKKK
D_eugracilis_CG34136-PA VLMMRRCRHLRVPTAPRLGDVLKRKKK
D_ficusphila_CG34136-PA VLMMRRCRHLRVPTAPRLGDVLKRKKK
D_rhopaloa_CG34136-PA VLMMRRCRHLRVPTAPRLGDVLKRKKK
D_elegans_CG34136-PA VLMMRRCRHLRVPTAPRLGDVLKRKKK
***************************
>D_melanogaster_CG34136-PA ATGTGGCCCAACTTTTTGGCTGTCGTTTCCCTACTGTGCCTTGCATTCTT CGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAT TGATGCCGAAAGTGCCTCAATGGCACTGCCTGCGCTACTTTAAGCATGAT GTCCTGATGATGCGCCGCTGTCGCCACTTGCGAGTCCCTACAGCGCCACG ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA >D_sechellia_CG34136-PA ATGTGGCCCAACTTTGTAGCTGTCGTTTCCCTACTGTGCCTTGCATTCTT CGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAT TGATGCCGAAAGTGCCTCAATGGCACTGCCTGCGCTACTTTAAGCATGAT GTCCTGATGATGCGTCGCTGTCGCCACTTGCGAGTCCCTACAGCGCCACG ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA >D_simulans_CG34136-PA ATGTGGCCCAACTTTGTAGCTGTCGTTTCCCTACTGTGCCTTGCATTCTT CGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAT TGATGCCGAAAGTGCCTCAATGGCACTGCCTGCGCTACTTTAAGCATGAT GTCCTGATGATGCGTCGCTGTCGCCACTTGCGAGTCCCTACAGCGCCACG ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA >D_yakuba_CG34136-PA ATGTGGCCCAACTTTGTAGCTGTCGTTTCCCTACTGTGTCTTGCATTCTT CGCATGGGCAAAAGCTGGACCAGTGCCAATTGTGAATGAGCACCAACAAT TGATGCCAAAAGTGCCTCAATGGCACTGTCTGCGATACTTTAAACATGAT GTCCTGATGATGCGTCGCTGTCGCCATTTGCGAGTTCCTACGGCGCCGCG ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA >D_erecta_CG34136-PA ATGTGGCCCAACTTTGTAGCTGTCGTTTCCCTACTGTGCCTTGCATTCTT CGCCTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAT TGATGCCGAAAGTGCCTCAATGGCACTGTCTGCGCTACTTTAAGCACGAT GTCCTGATGATGCGTCGCTGTCGCCATTTGCGAGTTCCTACGGCGCCGCG ACTGGGCGATGTCCTTAAGCGAAAGAAGAAA >D_takahashii_CG34136-PA ATGTGGCCCAACTTTGTAGCCGTCATTTCACTGCTGTGCCTTGCATTCTT CGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAC TGATGCCCAAGGTCCCCCAATGGCACTGTCTGCGCTACTTTAAACATGAT GTCCTGATGATGCGCCGCTGTCGCCACTTGCGAGTCCCTACGGCACCGCG ACTGGGCGATGTCCTCAAGCGAAAGAAGAAA >D_biarmipes_CG34136-PA ATGTGGCCCAACTTCGTGGCAGTCATTTCCCTGCTGTGCCTTGCATTCTT TGCTTGGGCGAACGCTGGACCCGTGCCAATTGTGAATGAGCACCAACAAC TGATGCCCAAGGTACCCCAATGGCACTGTCTGCGCTACTTTAAGCATGAC GTCCTGATGATGCGCCGCTGTCGCCATTTGCGAGTCCCTACTGCACCTCG ACTGGGCGATGTCCTTAAGCGTAAGAAGAAA >D_suzukii_CG34136-PA ATGTGGCCCAACTTCGTGGCAGTCATTTCCCTGCTGTGCCTTGCATTCTT TGCTTGGGCAAAAGCTGGACCTGTGCCAATAGTGAATGAGCACCAACAAC TGATGCCCAAGGTACCCCAATGGCATTGTCTGCGCTACTTTAAGCATGAC GTCCTGATGATGCGCCGCTGTCGCCATTTGCGAGTCCCAACGGCGCCTCG ACTAGGAGATGTCCTTAAGCGTAAGAAGAAA >D_eugracilis_CG34136-PA ATGTGGCCCAACTTTGTAGCCGTCATTTCCCTGCTATGCCTTGCATTCTT CGCTTGGGCAAAAGCTGGACCCGTGCCAATTGTGAATGAGCACCAACAAC TAATGCCGAAAGTTCCTCAATGGCATTGTCTACGCTACTTTAAGCACGAT GTCCTGATGATGCGACGTTGTCGCCATTTAAGAGTCCCTACGGCGCCGCG ACTGGGAGATGTCCTTAAGCGCAAGAAGAAA >D_ficusphila_CG34136-PA ATGTGGCCCAACTTTGTAGCCGTCATTTCCCTGCTGTGCCTTGCATTCTT TGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAC TGATGCCCAAGGTTCCCCAATGGCACTGTCTACGCTACTTTAAGCACGAT GTCCTGATGATGCGTCGCTGTCGCCATCTGCGAGTCCCTACGGCGCCGCG ACTGGGCGATGTCCTCAAGCGCAAGAAGAAA >D_rhopaloa_CG34136-PA ATGTGGCCCAACTTTGTTGCCGTCTTTTCCCTGCTGTGCCTTGCATTCTT TGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAC TGATGCCCAAAGTCCCTCAATGGCATTGCCTGCGCTACTTCAAGCATGAT GTCCTGATGATGCGACGTTGCCGGCATTTGCGAGTCCCTACGGCGCCGCG TCTGGGGGATGTTCTTAAGCGAAAGAAGAAA >D_elegans_CG34136-PA ATGTGGCCCAACTTTGTTGCCGTCATTTCCATGCTATGCCTTGCATTCTT TACTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAGCACCAACAAC TGATGCCCAAAGTCCCTCAATGGCATTGTCTGCGCTACTTCAAGCACGAT GTCCTGATGATGCGACGTTGTCGCCATTTGCGAGTCCCTACGGCGCCGCG TTTGGGCGATGTCCTCAAGCGAAAGAAGAAA
>D_melanogaster_CG34136-PA MWPNFLAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD VLMMRRCRHLRVPTAPRLGDVLKRKKK >D_sechellia_CG34136-PA MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD VLMMRRCRHLRVPTAPRLGDVLKRKKK >D_simulans_CG34136-PA MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD VLMMRRCRHLRVPTAPRLGDVLKRKKK >D_yakuba_CG34136-PA MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD VLMMRRCRHLRVPTAPRLGDVLKRKKK >D_erecta_CG34136-PA MWPNFVAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD VLMMRRCRHLRVPTAPRLGDVLKRKKK >D_takahashii_CG34136-PA MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD VLMMRRCRHLRVPTAPRLGDVLKRKKK >D_biarmipes_CG34136-PA MWPNFVAVISLLCLAFFAWANAGPVPIVNEHQQLMPKVPQWHCLRYFKHD VLMMRRCRHLRVPTAPRLGDVLKRKKK >D_suzukii_CG34136-PA MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD VLMMRRCRHLRVPTAPRLGDVLKRKKK >D_eugracilis_CG34136-PA MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD VLMMRRCRHLRVPTAPRLGDVLKRKKK >D_ficusphila_CG34136-PA MWPNFVAVISLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD VLMMRRCRHLRVPTAPRLGDVLKRKKK >D_rhopaloa_CG34136-PA MWPNFVAVFSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD VLMMRRCRHLRVPTAPRLGDVLKRKKK >D_elegans_CG34136-PA MWPNFVAVISMLCLAFFTWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD VLMMRRCRHLRVPTAPRLGDVLKRKKK
#NEXUS
[ID: 9049187946]
begin taxa;
dimensions ntax=12;
taxlabels
D_melanogaster_CG34136-PA
D_sechellia_CG34136-PA
D_simulans_CG34136-PA
D_yakuba_CG34136-PA
D_erecta_CG34136-PA
D_takahashii_CG34136-PA
D_biarmipes_CG34136-PA
D_suzukii_CG34136-PA
D_eugracilis_CG34136-PA
D_ficusphila_CG34136-PA
D_rhopaloa_CG34136-PA
D_elegans_CG34136-PA
;
end;
begin trees;
translate
1 D_melanogaster_CG34136-PA,
2 D_sechellia_CG34136-PA,
3 D_simulans_CG34136-PA,
4 D_yakuba_CG34136-PA,
5 D_erecta_CG34136-PA,
6 D_takahashii_CG34136-PA,
7 D_biarmipes_CG34136-PA,
8 D_suzukii_CG34136-PA,
9 D_eugracilis_CG34136-PA,
10 D_ficusphila_CG34136-PA,
11 D_rhopaloa_CG34136-PA,
12 D_elegans_CG34136-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0360346,2:0.006190637,3:0.006616618,((4:0.0810036,5:0.02385171)0.621:0.02786951,((6:0.06663336,(7:0.06449654,8:0.06517356)1.000:0.1164237,10:0.04784375)0.668:0.03982561,(9:0.1402234,(11:0.1022262,12:0.05646255)0.970:0.07021844)0.637:0.05714946)0.999:0.1085293)0.987:0.05771053);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0360346,2:0.006190637,3:0.006616618,((4:0.0810036,5:0.02385171):0.02786951,((6:0.06663336,(7:0.06449654,8:0.06517356):0.1164237,10:0.04784375):0.03982561,(9:0.1402234,(11:0.1022262,12:0.05646255):0.07021844):0.05714946):0.1085293):0.05771053);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -754.58 -770.94
2 -755.00 -768.95
--------------------------------------
TOTAL -754.77 -770.38
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/128/CG34136-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.307742 0.047509 0.915263 1.745533 1.290413 1256.47 1378.73 1.000
r(A<->C){all} 0.155407 0.002582 0.065043 0.256972 0.151876 573.62 664.92 1.003
r(A<->G){all} 0.237986 0.004746 0.117070 0.375971 0.230027 527.79 663.48 1.001
r(A<->T){all} 0.101513 0.002006 0.021453 0.187784 0.096931 838.97 844.86 1.003
r(C<->G){all} 0.025833 0.000314 0.000015 0.059717 0.022725 967.44 994.91 1.000
r(C<->T){all} 0.450892 0.006478 0.282467 0.595929 0.451552 551.36 554.72 1.001
r(G<->T){all} 0.028368 0.000342 0.000009 0.064008 0.024809 668.99 879.63 1.002
pi(A){all} 0.226339 0.000622 0.176831 0.273778 0.225487 896.00 1106.35 1.000
pi(C){all} 0.266336 0.000708 0.210521 0.315732 0.265825 732.94 845.64 1.000
pi(G){all} 0.250408 0.000721 0.199227 0.304458 0.250191 908.79 1204.89 1.000
pi(T){all} 0.256916 0.000688 0.204267 0.306279 0.256460 1094.34 1116.63 1.000
alpha{1,2} 0.107439 0.000545 0.069203 0.156872 0.104910 1354.59 1362.35 1.000
alpha{3} 1.831512 0.450959 0.721324 3.178297 1.717340 1342.80 1421.90 1.000
pinvar{all} 0.379773 0.007002 0.207156 0.534650 0.384286 1170.89 1228.97 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/128/CG34136-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 12 ls = 77
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 3 2 2
TTC 2 2 2 2 2 2 | TCC 1 1 1 1 1 0 | TAC 1 1 1 1 1 1 | TGC 2 2 2 0 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 2 2 2 2 1 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 2 1 | Pro CCT 3 3 3 2 3 2 | His CAT 1 1 1 2 1 1 | Arg CGT 0 1 1 1 1 0
CTC 1 1 1 1 0 1 | CCC 1 1 1 1 1 3 | CAC 3 3 3 2 3 3 | CGC 4 3 3 2 3 4
CTA 1 1 1 1 1 0 | CCA 2 2 2 3 1 1 | Gln CAA 3 3 3 3 3 3 | CGA 3 3 3 4 3 3
CTG 4 4 4 4 4 6 | CCG 1 1 1 1 2 1 | CAG 0 0 0 0 0 0 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 0 0 0 0 0 0 | ACC 0 0 0 0 0 0 | AAC 1 1 1 1 1 1 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 1 1 1 0 0 0 | Lys AAA 3 3 3 4 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 0 0 0 1 1 1 | AAG 4 4 4 3 4 4 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 2 2 0 | Ala GCT 3 3 3 2 2 2 | Asp GAT 2 2 2 2 2 2 | Gly GGT 0 0 0 0 0 0
GTC 4 4 4 3 3 5 | GCC 0 0 0 0 1 1 | GAC 0 0 0 0 0 0 | GGC 1 1 1 1 1 1
GTA 0 1 1 1 1 1 | GCA 2 2 2 3 2 3 | Glu GAA 0 0 0 0 0 0 | GGA 1 1 1 1 1 1
GTG 3 3 3 3 3 2 | GCG 1 1 1 1 1 0 | GAG 1 1 1 1 1 1 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 3 3 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 2 2 2 2 0 2
TTC 2 2 2 1 2 2 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 3 1
Leu TTA 0 0 1 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 0 0 1 2 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 1 2 1 | Pro CCT 2 2 2 2 3 3 | His CAT 2 3 2 1 3 2 | Arg CGT 1 1 1 1 2 2
CTC 0 0 0 1 0 1 | CCC 4 3 2 3 2 2 | CAC 2 1 2 3 1 2 | CGC 4 4 3 4 1 2
CTA 0 1 3 1 0 1 | CCA 1 2 1 1 1 1 | Gln CAA 3 3 3 3 3 3 | CGA 2 2 2 2 3 3
CTG 6 5 3 6 6 3 | CCG 0 0 2 1 1 1 | CAG 0 0 0 0 0 0 | CGG 0 0 0 0 1 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 1 2 2 1 2 | Thr ACT 1 0 0 0 0 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 0 0 0 0 0 0 | ACC 0 0 0 0 0 0 | AAC 2 1 1 1 1 1 | AGC 0 0 0 0 0 0
ATA 0 1 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 2 3 2 3 3 | Arg AGA 0 0 1 0 0 0
Met ATG 4 4 4 4 4 5 | ACG 0 1 1 1 1 1 | AAG 5 5 4 5 4 4 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 1 1 2 1 | Ala GCT 2 2 2 2 2 1 | Asp GAT 1 1 2 2 2 2 | Gly GGT 0 0 0 0 0 0
GTC 4 4 4 4 4 5 | GCC 0 0 1 1 1 1 | GAC 1 1 0 0 0 0 | GGC 1 0 0 1 0 1
GTA 1 1 1 1 0 0 | GCA 3 3 2 2 2 2 | Glu GAA 0 0 0 0 0 0 | GGA 1 2 2 1 1 1
GTG 3 3 2 2 2 2 | GCG 1 1 1 1 1 1 | GAG 1 1 1 1 1 1 | GGG 0 0 0 0 1 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG34136-PA
position 1: T:0.19481 C:0.36364 A:0.19481 G:0.24675
position 2: T:0.35065 C:0.19481 A:0.25974 G:0.19481
position 3: T:0.20779 C:0.27273 A:0.20779 G:0.31169
Average T:0.25108 C:0.27706 A:0.22078 G:0.25108
#2: D_sechellia_CG34136-PA
position 1: T:0.18182 C:0.36364 A:0.19481 G:0.25974
position 2: T:0.35065 C:0.19481 A:0.25974 G:0.19481
position 3: T:0.22078 C:0.25974 A:0.22078 G:0.29870
Average T:0.25108 C:0.27273 A:0.22511 G:0.25108
#3: D_simulans_CG34136-PA
position 1: T:0.18182 C:0.36364 A:0.19481 G:0.25974
position 2: T:0.35065 C:0.19481 A:0.25974 G:0.19481
position 3: T:0.22078 C:0.25974 A:0.22078 G:0.29870
Average T:0.25108 C:0.27273 A:0.22511 G:0.25108
#4: D_yakuba_CG34136-PA
position 1: T:0.18182 C:0.36364 A:0.19481 G:0.25974
position 2: T:0.35065 C:0.19481 A:0.25974 G:0.19481
position 3: T:0.24675 C:0.19481 A:0.25974 G:0.29870
Average T:0.25974 C:0.25108 A:0.23810 G:0.25108
#5: D_erecta_CG34136-PA
position 1: T:0.18182 C:0.36364 A:0.19481 G:0.25974
position 2: T:0.35065 C:0.19481 A:0.25974 G:0.19481
position 3: T:0.24675 C:0.23377 A:0.19481 G:0.32468
Average T:0.25974 C:0.26407 A:0.21645 G:0.25974
#6: D_takahashii_CG34136-PA
position 1: T:0.16883 C:0.37662 A:0.20779 G:0.24675
position 2: T:0.35065 C:0.19481 A:0.25974 G:0.19481
position 3: T:0.19481 C:0.29870 A:0.20779 G:0.29870
Average T:0.23810 C:0.29004 A:0.22511 G:0.24675
#7: D_biarmipes_CG34136-PA
position 1: T:0.16883 C:0.37662 A:0.20779 G:0.24675
position 2: T:0.35065 C:0.19481 A:0.25974 G:0.19481
position 3: T:0.23377 C:0.29870 A:0.15584 G:0.31169
Average T:0.25108 C:0.29004 A:0.20779 G:0.25108
#8: D_suzukii_CG34136-PA
position 1: T:0.16883 C:0.37662 A:0.20779 G:0.24675
position 2: T:0.35065 C:0.19481 A:0.25974 G:0.19481
position 3: T:0.22078 C:0.24675 A:0.22078 G:0.31169
Average T:0.24675 C:0.27273 A:0.22944 G:0.25108
#9: D_eugracilis_CG34136-PA
position 1: T:0.16883 C:0.36364 A:0.22078 G:0.24675
position 2: T:0.35065 C:0.19481 A:0.25974 G:0.19481
position 3: T:0.24675 C:0.23377 A:0.24675 G:0.27273
Average T:0.25541 C:0.26407 A:0.24242 G:0.23810
#10: D_ficusphila_CG34136-PA
position 1: T:0.15584 C:0.38961 A:0.20779 G:0.24675
position 2: T:0.35065 C:0.19481 A:0.25974 G:0.19481
position 3: T:0.23377 C:0.28571 A:0.16883 G:0.31169
Average T:0.24675 C:0.29004 A:0.21212 G:0.25108
#11: D_rhopaloa_CG34136-PA
position 1: T:0.18182 C:0.37662 A:0.19481 G:0.24675
position 2: T:0.35065 C:0.19481 A:0.25974 G:0.19481
position 3: T:0.27273 C:0.22078 A:0.16883 G:0.33766
Average T:0.26840 C:0.26407 A:0.20779 G:0.25974
#12: D_elegans_CG34136-PA
position 1: T:0.18182 C:0.35065 A:0.23377 G:0.23377
position 2: T:0.35065 C:0.19481 A:0.25974 G:0.19481
position 3: T:0.25974 C:0.25974 A:0.18182 G:0.29870
Average T:0.26407 C:0.26840 A:0.22511 G:0.24242
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 26 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 20
TTC 23 | TCC 11 | TAC 12 | TGC 16
Leu L TTA 1 | TCA 1 | *** * TAA 0 | *** * TGA 0
TTG 17 | TCG 0 | TAG 0 | Trp W TGG 36
------------------------------------------------------------------------------
Leu L CTT 17 | Pro P CCT 30 | His H CAT 20 | Arg R CGT 12
CTC 7 | CCC 24 | CAC 28 | CGC 37
CTA 11 | CCA 18 | Gln Q CAA 36 | CGA 33
CTG 55 | CCG 12 | CAG 0 | CGG 1
------------------------------------------------------------------------------
Ile I ATT 17 | Thr T ACT 2 | Asn N AAT 12 | Ser S AGT 0
ATC 0 | ACC 0 | AAC 13 | AGC 0
ATA 1 | ACA 3 | Lys K AAA 33 | Arg R AGA 1
Met M ATG 49 | ACG 8 | AAG 50 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 26 | Asp D GAT 22 | Gly G GGT 0
GTC 48 | GCC 6 | GAC 2 | GGC 9
GTA 9 | GCA 28 | Glu E GAA 0 | GGA 14
GTG 31 | GCG 11 | GAG 12 | GGG 1
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17641 C:0.36905 A:0.20455 G:0.25000
position 2: T:0.35065 C:0.19481 A:0.25974 G:0.19481
position 3: T:0.23377 C:0.25541 A:0.20455 G:0.30628
Average T:0.25361 C:0.27309 A:0.22294 G:0.25036
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG34136-PA
D_sechellia_CG34136-PA 0.1560 (0.0057 0.0367)
D_simulans_CG34136-PA 0.1560 (0.0057 0.0367)-1.0000 (0.0000 0.0000)
D_yakuba_CG34136-PA 0.0207 (0.0057 0.2777)-1.0000 (0.0000 0.2271)-1.0000 (0.0000 0.2271)
D_erecta_CG34136-PA 0.0280 (0.0057 0.2048)-1.0000 (0.0000 0.1587)-1.0000 (0.0000 0.1587)-1.0000 (0.0000 0.1580)
D_takahashii_CG34136-PA 0.0379 (0.0115 0.3040) 0.0189 (0.0057 0.3031) 0.0189 (0.0057 0.3031) 0.0161 (0.0057 0.3568) 0.0160 (0.0057 0.3585)
D_biarmipes_CG34136-PA 0.0380 (0.0173 0.4553) 0.0220 (0.0115 0.5225) 0.0220 (0.0115 0.5225) 0.0181 (0.0115 0.6352) 0.0220 (0.0115 0.5225) 0.0173 (0.0057 0.3313)
D_suzukii_CG34136-PA 0.0220 (0.0115 0.5232) 0.0096 (0.0057 0.5968) 0.0096 (0.0057 0.5968) 0.0080 (0.0057 0.7216) 0.0103 (0.0057 0.5582)-1.0000 (0.0000 0.4187) 0.0315 (0.0057 0.1818)
D_eugracilis_CG34136-PA 0.0205 (0.0115 0.5615) 0.0110 (0.0057 0.5226) 0.0110 (0.0057 0.5226) 0.0096 (0.0057 0.5948) 0.0147 (0.0057 0.3910)-1.0000 (0.0000 0.5197) 0.0089 (0.0057 0.6414)-1.0000 (0.0000 0.5990)
D_ficusphila_CG34136-PA 0.0275 (0.0115 0.4196) 0.0160 (0.0057 0.3585) 0.0160 (0.0057 0.3585) 0.0138 (0.0057 0.4161) 0.0189 (0.0057 0.3031)-1.0000 (0.0000 0.2261) 0.0160 (0.0057 0.3595)-1.0000 (0.0000 0.3881)-1.0000 (0.0000 0.3313)
D_rhopaloa_CG34136-PA 0.0307 (0.0144 0.4690) 0.0118 (0.0057 0.4843) 0.0118 (0.0057 0.4843) 0.0091 (0.0057 0.6306) 0.0118 (0.0057 0.4843) 0.0128 (0.0057 0.4486) 0.0193 (0.0115 0.5960) 0.0110 (0.0057 0.5196) 0.0127 (0.0057 0.4524) 0.0128 (0.0057 0.4486)
D_elegans_CG34136-PA 0.0672 (0.0289 0.4308) 0.0452 (0.0202 0.4457) 0.0452 (0.0202 0.4457) 0.0395 (0.0202 0.5117) 0.0527 (0.0202 0.3826) 0.0314 (0.0115 0.3658) 0.0301 (0.0172 0.5726) 0.0215 (0.0115 0.5334) 0.0337 (0.0114 0.3396) 0.0371 (0.0115 0.3090) 0.0939 (0.0173 0.1839)
Model 0: one-ratio
TREE # 1: (1, 2, 3, ((4, 5), ((6, (7, 8), 10), (9, (11, 12))))); MP score: 86
lnL(ntime: 19 np: 21): -704.164499 +0.000000
13..1 13..2 13..3 13..14 14..15 15..4 15..5 14..16 16..17 17..6 17..18 18..7 18..8 17..10 16..19 19..9 19..20 20..11 20..12
0.042803 0.000004 0.000004 0.063730 0.016503 0.093453 0.036307 0.116727 0.036038 0.086600 0.147430 0.079477 0.074889 0.077403 0.060019 0.181366 0.061764 0.123475 0.063363 2.778386 0.028621
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.36136
(1: 0.042803, 2: 0.000004, 3: 0.000004, ((4: 0.093453, 5: 0.036307): 0.016503, ((6: 0.086600, (7: 0.079477, 8: 0.074889): 0.147430, 10: 0.077403): 0.036038, (9: 0.181366, (11: 0.123475, 12: 0.063363): 0.061764): 0.060019): 0.116727): 0.063730);
(D_melanogaster_CG34136-PA: 0.042803, D_sechellia_CG34136-PA: 0.000004, D_simulans_CG34136-PA: 0.000004, ((D_yakuba_CG34136-PA: 0.093453, D_erecta_CG34136-PA: 0.036307): 0.016503, ((D_takahashii_CG34136-PA: 0.086600, (D_biarmipes_CG34136-PA: 0.079477, D_suzukii_CG34136-PA: 0.074889): 0.147430, D_ficusphila_CG34136-PA: 0.077403): 0.036038, (D_eugracilis_CG34136-PA: 0.181366, (D_rhopaloa_CG34136-PA: 0.123475, D_elegans_CG34136-PA: 0.063363): 0.061764): 0.060019): 0.116727): 0.063730);
Detailed output identifying parameters
kappa (ts/tv) = 2.77839
omega (dN/dS) = 0.02862
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.043 156.3 74.7 0.0286 0.0012 0.0416 0.2 3.1
13..2 0.000 156.3 74.7 0.0286 0.0000 0.0000 0.0 0.0
13..3 0.000 156.3 74.7 0.0286 0.0000 0.0000 0.0 0.0
13..14 0.064 156.3 74.7 0.0286 0.0018 0.0620 0.3 4.6
14..15 0.017 156.3 74.7 0.0286 0.0005 0.0161 0.1 1.2
15..4 0.093 156.3 74.7 0.0286 0.0026 0.0909 0.4 6.8
15..5 0.036 156.3 74.7 0.0286 0.0010 0.0353 0.2 2.6
14..16 0.117 156.3 74.7 0.0286 0.0032 0.1135 0.5 8.5
16..17 0.036 156.3 74.7 0.0286 0.0010 0.0351 0.2 2.6
17..6 0.087 156.3 74.7 0.0286 0.0024 0.0842 0.4 6.3
17..18 0.147 156.3 74.7 0.0286 0.0041 0.1434 0.6 10.7
18..7 0.079 156.3 74.7 0.0286 0.0022 0.0773 0.3 5.8
18..8 0.075 156.3 74.7 0.0286 0.0021 0.0728 0.3 5.4
17..10 0.077 156.3 74.7 0.0286 0.0022 0.0753 0.3 5.6
16..19 0.060 156.3 74.7 0.0286 0.0017 0.0584 0.3 4.4
19..9 0.181 156.3 74.7 0.0286 0.0050 0.1764 0.8 13.2
19..20 0.062 156.3 74.7 0.0286 0.0017 0.0601 0.3 4.5
20..11 0.123 156.3 74.7 0.0286 0.0034 0.1201 0.5 9.0
20..12 0.063 156.3 74.7 0.0286 0.0018 0.0616 0.3 4.6
tree length for dN: 0.0379
tree length for dS: 1.3240
Time used: 0:07
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, ((4, 5), ((6, (7, 8), 10), (9, (11, 12))))); MP score: 86
lnL(ntime: 19 np: 22): -703.835402 +0.000000
13..1 13..2 13..3 13..14 14..15 15..4 15..5 14..16 16..17 17..6 17..18 18..7 18..8 17..10 16..19 19..9 19..20 20..11 20..12
0.042937 0.000004 0.000004 0.063936 0.016710 0.093740 0.036385 0.116517 0.036177 0.086510 0.147172 0.079212 0.074830 0.077379 0.060160 0.180978 0.062012 0.124449 0.063061 2.819983 0.984415 0.020320
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.36217
(1: 0.042937, 2: 0.000004, 3: 0.000004, ((4: 0.093740, 5: 0.036385): 0.016710, ((6: 0.086510, (7: 0.079212, 8: 0.074830): 0.147172, 10: 0.077379): 0.036177, (9: 0.180978, (11: 0.124449, 12: 0.063061): 0.062012): 0.060160): 0.116517): 0.063936);
(D_melanogaster_CG34136-PA: 0.042937, D_sechellia_CG34136-PA: 0.000004, D_simulans_CG34136-PA: 0.000004, ((D_yakuba_CG34136-PA: 0.093740, D_erecta_CG34136-PA: 0.036385): 0.016710, ((D_takahashii_CG34136-PA: 0.086510, (D_biarmipes_CG34136-PA: 0.079212, D_suzukii_CG34136-PA: 0.074830): 0.147172, D_ficusphila_CG34136-PA: 0.077379): 0.036177, (D_eugracilis_CG34136-PA: 0.180978, (D_rhopaloa_CG34136-PA: 0.124449, D_elegans_CG34136-PA: 0.063061): 0.062012): 0.060160): 0.116517): 0.063936);
Detailed output identifying parameters
kappa (ts/tv) = 2.81998
dN/dS (w) for site classes (K=2)
p: 0.98441 0.01559
w: 0.02032 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.043 156.2 74.8 0.0356 0.0015 0.0411 0.2 3.1
13..2 0.000 156.2 74.8 0.0356 0.0000 0.0000 0.0 0.0
13..3 0.000 156.2 74.8 0.0356 0.0000 0.0000 0.0 0.0
13..14 0.064 156.2 74.8 0.0356 0.0022 0.0612 0.3 4.6
14..15 0.017 156.2 74.8 0.0356 0.0006 0.0160 0.1 1.2
15..4 0.094 156.2 74.8 0.0356 0.0032 0.0898 0.5 6.7
15..5 0.036 156.2 74.8 0.0356 0.0012 0.0348 0.2 2.6
14..16 0.117 156.2 74.8 0.0356 0.0040 0.1116 0.6 8.4
16..17 0.036 156.2 74.8 0.0356 0.0012 0.0347 0.2 2.6
17..6 0.087 156.2 74.8 0.0356 0.0029 0.0829 0.5 6.2
17..18 0.147 156.2 74.8 0.0356 0.0050 0.1410 0.8 10.5
18..7 0.079 156.2 74.8 0.0356 0.0027 0.0759 0.4 5.7
18..8 0.075 156.2 74.8 0.0356 0.0026 0.0717 0.4 5.4
17..10 0.077 156.2 74.8 0.0356 0.0026 0.0741 0.4 5.5
16..19 0.060 156.2 74.8 0.0356 0.0021 0.0576 0.3 4.3
19..9 0.181 156.2 74.8 0.0356 0.0062 0.1733 1.0 13.0
19..20 0.062 156.2 74.8 0.0356 0.0021 0.0594 0.3 4.4
20..11 0.124 156.2 74.8 0.0356 0.0042 0.1192 0.7 8.9
20..12 0.063 156.2 74.8 0.0356 0.0021 0.0604 0.3 4.5
Time used: 0:23
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, ((4, 5), ((6, (7, 8), 10), (9, (11, 12))))); MP score: 86
lnL(ntime: 19 np: 24): -703.835402 +0.000000
13..1 13..2 13..3 13..14 14..15 15..4 15..5 14..16 16..17 17..6 17..18 18..7 18..8 17..10 16..19 19..9 19..20 20..11 20..12
0.042937 0.000004 0.000004 0.063936 0.016710 0.093740 0.036385 0.116517 0.036177 0.086510 0.147172 0.079212 0.074830 0.077379 0.060160 0.180979 0.062012 0.124449 0.063061 2.819981 0.984415 0.015585 0.020320 11.113412
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.36217
(1: 0.042937, 2: 0.000004, 3: 0.000004, ((4: 0.093740, 5: 0.036385): 0.016710, ((6: 0.086510, (7: 0.079212, 8: 0.074830): 0.147172, 10: 0.077379): 0.036177, (9: 0.180979, (11: 0.124449, 12: 0.063061): 0.062012): 0.060160): 0.116517): 0.063936);
(D_melanogaster_CG34136-PA: 0.042937, D_sechellia_CG34136-PA: 0.000004, D_simulans_CG34136-PA: 0.000004, ((D_yakuba_CG34136-PA: 0.093740, D_erecta_CG34136-PA: 0.036385): 0.016710, ((D_takahashii_CG34136-PA: 0.086510, (D_biarmipes_CG34136-PA: 0.079212, D_suzukii_CG34136-PA: 0.074830): 0.147172, D_ficusphila_CG34136-PA: 0.077379): 0.036177, (D_eugracilis_CG34136-PA: 0.180979, (D_rhopaloa_CG34136-PA: 0.124449, D_elegans_CG34136-PA: 0.063061): 0.062012): 0.060160): 0.116517): 0.063936);
Detailed output identifying parameters
kappa (ts/tv) = 2.81998
dN/dS (w) for site classes (K=3)
p: 0.98442 0.01558 0.00000
w: 0.02032 1.00000 11.11341
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.043 156.2 74.8 0.0356 0.0015 0.0411 0.2 3.1
13..2 0.000 156.2 74.8 0.0356 0.0000 0.0000 0.0 0.0
13..3 0.000 156.2 74.8 0.0356 0.0000 0.0000 0.0 0.0
13..14 0.064 156.2 74.8 0.0356 0.0022 0.0612 0.3 4.6
14..15 0.017 156.2 74.8 0.0356 0.0006 0.0160 0.1 1.2
15..4 0.094 156.2 74.8 0.0356 0.0032 0.0898 0.5 6.7
15..5 0.036 156.2 74.8 0.0356 0.0012 0.0348 0.2 2.6
14..16 0.117 156.2 74.8 0.0356 0.0040 0.1116 0.6 8.4
16..17 0.036 156.2 74.8 0.0356 0.0012 0.0347 0.2 2.6
17..6 0.087 156.2 74.8 0.0356 0.0029 0.0829 0.5 6.2
17..18 0.147 156.2 74.8 0.0356 0.0050 0.1410 0.8 10.5
18..7 0.079 156.2 74.8 0.0356 0.0027 0.0759 0.4 5.7
18..8 0.075 156.2 74.8 0.0356 0.0026 0.0717 0.4 5.4
17..10 0.077 156.2 74.8 0.0356 0.0026 0.0741 0.4 5.5
16..19 0.060 156.2 74.8 0.0356 0.0021 0.0576 0.3 4.3
19..9 0.181 156.2 74.8 0.0356 0.0062 0.1733 1.0 13.0
19..20 0.062 156.2 74.8 0.0356 0.0021 0.0594 0.3 4.4
20..11 0.124 156.2 74.8 0.0356 0.0042 0.1192 0.7 8.9
20..12 0.063 156.2 74.8 0.0356 0.0021 0.0604 0.3 4.5
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG34136-PA)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.161 0.105 0.094 0.092 0.091 0.091 0.091 0.091 0.091 0.091
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.011 0.986
sum of density on p0-p1 = 1.000000
Time used: 1:01
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, ((4, 5), ((6, (7, 8), 10), (9, (11, 12))))); MP score: 86
lnL(ntime: 19 np: 25): -702.971495 +0.000000
13..1 13..2 13..3 13..14 14..15 15..4 15..5 14..16 16..17 17..6 17..18 18..7 18..8 17..10 16..19 19..9 19..20 20..11 20..12
0.043069 0.000004 0.000004 0.064143 0.016616 0.094067 0.036492 0.117295 0.036234 0.086972 0.148007 0.079484 0.075097 0.077664 0.060307 0.181932 0.062587 0.124722 0.062957 2.786709 0.448768 0.394242 0.000001 0.000001 0.196851
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.36765
(1: 0.043069, 2: 0.000004, 3: 0.000004, ((4: 0.094067, 5: 0.036492): 0.016616, ((6: 0.086972, (7: 0.079484, 8: 0.075097): 0.148007, 10: 0.077664): 0.036234, (9: 0.181932, (11: 0.124722, 12: 0.062957): 0.062587): 0.060307): 0.117295): 0.064143);
(D_melanogaster_CG34136-PA: 0.043069, D_sechellia_CG34136-PA: 0.000004, D_simulans_CG34136-PA: 0.000004, ((D_yakuba_CG34136-PA: 0.094067, D_erecta_CG34136-PA: 0.036492): 0.016616, ((D_takahashii_CG34136-PA: 0.086972, (D_biarmipes_CG34136-PA: 0.079484, D_suzukii_CG34136-PA: 0.075097): 0.148007, D_ficusphila_CG34136-PA: 0.077664): 0.036234, (D_eugracilis_CG34136-PA: 0.181932, (D_rhopaloa_CG34136-PA: 0.124722, D_elegans_CG34136-PA: 0.062957): 0.062587): 0.060307): 0.117295): 0.064143);
Detailed output identifying parameters
kappa (ts/tv) = 2.78671
dN/dS (w) for site classes (K=3)
p: 0.44877 0.39424 0.15699
w: 0.00000 0.00000 0.19685
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.043 156.3 74.7 0.0309 0.0013 0.0417 0.2 3.1
13..2 0.000 156.3 74.7 0.0309 0.0000 0.0000 0.0 0.0
13..3 0.000 156.3 74.7 0.0309 0.0000 0.0000 0.0 0.0
13..14 0.064 156.3 74.7 0.0309 0.0019 0.0621 0.3 4.6
14..15 0.017 156.3 74.7 0.0309 0.0005 0.0161 0.1 1.2
15..4 0.094 156.3 74.7 0.0309 0.0028 0.0910 0.4 6.8
15..5 0.036 156.3 74.7 0.0309 0.0011 0.0353 0.2 2.6
14..16 0.117 156.3 74.7 0.0309 0.0035 0.1135 0.5 8.5
16..17 0.036 156.3 74.7 0.0309 0.0011 0.0351 0.2 2.6
17..6 0.087 156.3 74.7 0.0309 0.0026 0.0842 0.4 6.3
17..18 0.148 156.3 74.7 0.0309 0.0044 0.1433 0.7 10.7
18..7 0.079 156.3 74.7 0.0309 0.0024 0.0769 0.4 5.7
18..8 0.075 156.3 74.7 0.0309 0.0022 0.0727 0.4 5.4
17..10 0.078 156.3 74.7 0.0309 0.0023 0.0752 0.4 5.6
16..19 0.060 156.3 74.7 0.0309 0.0018 0.0584 0.3 4.4
19..9 0.182 156.3 74.7 0.0309 0.0054 0.1761 0.9 13.2
19..20 0.063 156.3 74.7 0.0309 0.0019 0.0606 0.3 4.5
20..11 0.125 156.3 74.7 0.0309 0.0037 0.1207 0.6 9.0
20..12 0.063 156.3 74.7 0.0309 0.0019 0.0609 0.3 4.6
Naive Empirical Bayes (NEB) analysis
Time used: 1:20
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, ((4, 5), ((6, (7, 8), 10), (9, (11, 12))))); MP score: 86
lnL(ntime: 19 np: 22): -703.021233 +0.000000
13..1 13..2 13..3 13..14 14..15 15..4 15..5 14..16 16..17 17..6 17..18 18..7 18..8 17..10 16..19 19..9 19..20 20..11 20..12
0.043041 0.000004 0.000004 0.064105 0.016613 0.094006 0.036466 0.117208 0.036214 0.086908 0.147907 0.079437 0.075047 0.077608 0.060273 0.181804 0.062524 0.124667 0.062933 2.787071 0.076280 1.981393
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.36677
(1: 0.043041, 2: 0.000004, 3: 0.000004, ((4: 0.094006, 5: 0.036466): 0.016613, ((6: 0.086908, (7: 0.079437, 8: 0.075047): 0.147907, 10: 0.077608): 0.036214, (9: 0.181804, (11: 0.124667, 12: 0.062933): 0.062524): 0.060273): 0.117208): 0.064105);
(D_melanogaster_CG34136-PA: 0.043041, D_sechellia_CG34136-PA: 0.000004, D_simulans_CG34136-PA: 0.000004, ((D_yakuba_CG34136-PA: 0.094006, D_erecta_CG34136-PA: 0.036466): 0.016613, ((D_takahashii_CG34136-PA: 0.086908, (D_biarmipes_CG34136-PA: 0.079437, D_suzukii_CG34136-PA: 0.075047): 0.147907, D_ficusphila_CG34136-PA: 0.077608): 0.036214, (D_eugracilis_CG34136-PA: 0.181804, (D_rhopaloa_CG34136-PA: 0.124667, D_elegans_CG34136-PA: 0.062933): 0.062524): 0.060273): 0.117208): 0.064105);
Detailed output identifying parameters
kappa (ts/tv) = 2.78707
Parameters in M7 (beta):
p = 0.07628 q = 1.98139
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00015 0.00136 0.00896 0.04790 0.24748
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.043 156.3 74.7 0.0306 0.0013 0.0417 0.2 3.1
13..2 0.000 156.3 74.7 0.0306 0.0000 0.0000 0.0 0.0
13..3 0.000 156.3 74.7 0.0306 0.0000 0.0000 0.0 0.0
13..14 0.064 156.3 74.7 0.0306 0.0019 0.0621 0.3 4.6
14..15 0.017 156.3 74.7 0.0306 0.0005 0.0161 0.1 1.2
15..4 0.094 156.3 74.7 0.0306 0.0028 0.0910 0.4 6.8
15..5 0.036 156.3 74.7 0.0306 0.0011 0.0353 0.2 2.6
14..16 0.117 156.3 74.7 0.0306 0.0035 0.1135 0.5 8.5
16..17 0.036 156.3 74.7 0.0306 0.0011 0.0351 0.2 2.6
17..6 0.087 156.3 74.7 0.0306 0.0026 0.0842 0.4 6.3
17..18 0.148 156.3 74.7 0.0306 0.0044 0.1432 0.7 10.7
18..7 0.079 156.3 74.7 0.0306 0.0024 0.0769 0.4 5.7
18..8 0.075 156.3 74.7 0.0306 0.0022 0.0727 0.3 5.4
17..10 0.078 156.3 74.7 0.0306 0.0023 0.0752 0.4 5.6
16..19 0.060 156.3 74.7 0.0306 0.0018 0.0584 0.3 4.4
19..9 0.182 156.3 74.7 0.0306 0.0054 0.1761 0.8 13.2
19..20 0.063 156.3 74.7 0.0306 0.0019 0.0606 0.3 4.5
20..11 0.125 156.3 74.7 0.0306 0.0037 0.1207 0.6 9.0
20..12 0.063 156.3 74.7 0.0306 0.0019 0.0609 0.3 4.6
Time used: 2:31
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, ((4, 5), ((6, (7, 8), 10), (9, (11, 12))))); MP score: 86
lnL(ntime: 19 np: 24): -703.021493 +0.000000
13..1 13..2 13..3 13..14 14..15 15..4 15..5 14..16 16..17 17..6 17..18 18..7 18..8 17..10 16..19 19..9 19..20 20..11 20..12
0.043041 0.000004 0.000004 0.064105 0.016613 0.094007 0.036466 0.117209 0.036214 0.086909 0.147908 0.079438 0.075048 0.077609 0.060274 0.181805 0.062524 0.124668 0.062933 2.787089 0.999990 0.076281 1.981616 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.36678
(1: 0.043041, 2: 0.000004, 3: 0.000004, ((4: 0.094007, 5: 0.036466): 0.016613, ((6: 0.086909, (7: 0.079438, 8: 0.075048): 0.147908, 10: 0.077609): 0.036214, (9: 0.181805, (11: 0.124668, 12: 0.062933): 0.062524): 0.060274): 0.117209): 0.064105);
(D_melanogaster_CG34136-PA: 0.043041, D_sechellia_CG34136-PA: 0.000004, D_simulans_CG34136-PA: 0.000004, ((D_yakuba_CG34136-PA: 0.094007, D_erecta_CG34136-PA: 0.036466): 0.016613, ((D_takahashii_CG34136-PA: 0.086909, (D_biarmipes_CG34136-PA: 0.079438, D_suzukii_CG34136-PA: 0.075048): 0.147908, D_ficusphila_CG34136-PA: 0.077609): 0.036214, (D_eugracilis_CG34136-PA: 0.181805, (D_rhopaloa_CG34136-PA: 0.124668, D_elegans_CG34136-PA: 0.062933): 0.062524): 0.060274): 0.117209): 0.064105);
Detailed output identifying parameters
kappa (ts/tv) = 2.78709
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.07628 q = 1.98162
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00015 0.00136 0.00896 0.04789 0.24745 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.043 156.3 74.7 0.0306 0.0013 0.0417 0.2 3.1
13..2 0.000 156.3 74.7 0.0306 0.0000 0.0000 0.0 0.0
13..3 0.000 156.3 74.7 0.0306 0.0000 0.0000 0.0 0.0
13..14 0.064 156.3 74.7 0.0306 0.0019 0.0621 0.3 4.6
14..15 0.017 156.3 74.7 0.0306 0.0005 0.0161 0.1 1.2
15..4 0.094 156.3 74.7 0.0306 0.0028 0.0910 0.4 6.8
15..5 0.036 156.3 74.7 0.0306 0.0011 0.0353 0.2 2.6
14..16 0.117 156.3 74.7 0.0306 0.0035 0.1135 0.5 8.5
16..17 0.036 156.3 74.7 0.0306 0.0011 0.0351 0.2 2.6
17..6 0.087 156.3 74.7 0.0306 0.0026 0.0842 0.4 6.3
17..18 0.148 156.3 74.7 0.0306 0.0044 0.1432 0.7 10.7
18..7 0.079 156.3 74.7 0.0306 0.0024 0.0769 0.4 5.7
18..8 0.075 156.3 74.7 0.0306 0.0022 0.0727 0.3 5.4
17..10 0.078 156.3 74.7 0.0306 0.0023 0.0752 0.4 5.6
16..19 0.060 156.3 74.7 0.0306 0.0018 0.0584 0.3 4.4
19..9 0.182 156.3 74.7 0.0306 0.0054 0.1761 0.8 13.2
19..20 0.063 156.3 74.7 0.0306 0.0019 0.0606 0.3 4.5
20..11 0.125 156.3 74.7 0.0306 0.0037 0.1207 0.6 9.0
20..12 0.063 156.3 74.7 0.0306 0.0019 0.0609 0.3 4.6
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG34136-PA)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.002 0.011 0.038 0.090 0.170 0.278 0.410
ws: 0.166 0.105 0.094 0.091 0.091 0.091 0.091 0.091 0.091 0.091
Time used: 4:06
Model 1: NearlyNeutral -703.835402 Model 2: PositiveSelection -703.835402 Model 0: one-ratio -704.164499 Model 3: discrete -702.971495 Model 7: beta -703.021233 Model 8: beta&w>1 -703.021493 Model 0 vs 1 0.6581939999998667 Model 2 vs 1 0.0 Model 8 vs 7 5.199999998239946E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
