--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Mon Oct 31 19:37:21 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/128/CG34135-PC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1397.97 -1416.91
2 -1397.73 -1415.30
--------------------------------------
TOTAL -1397.84 -1416.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.576089 0.040436 1.181268 1.948034 1.559422 1152.11 1276.67 1.000
r(A<->C){all} 0.098913 0.001038 0.039216 0.162479 0.096602 737.94 823.77 1.000
r(A<->G){all} 0.221962 0.002158 0.133351 0.314957 0.219489 574.55 667.95 1.000
r(A<->T){all} 0.171376 0.002830 0.068286 0.269458 0.169705 554.55 569.91 1.000
r(C<->G){all} 0.051327 0.000308 0.020564 0.087596 0.049935 876.27 1066.24 1.000
r(C<->T){all} 0.360973 0.002830 0.260173 0.464100 0.360128 679.42 752.86 1.000
r(G<->T){all} 0.095450 0.000855 0.038454 0.152650 0.092364 910.66 971.12 1.000
pi(A){all} 0.173138 0.000282 0.141803 0.206391 0.172728 1294.15 1305.32 1.001
pi(C){all} 0.314535 0.000428 0.273723 0.354166 0.314167 1154.10 1223.84 1.000
pi(G){all} 0.278350 0.000424 0.240417 0.321302 0.277967 1193.27 1334.14 1.000
pi(T){all} 0.233977 0.000363 0.197657 0.272579 0.233701 1007.43 1022.75 1.000
alpha{1,2} 0.074869 0.000116 0.054041 0.095729 0.074391 1404.65 1452.82 1.000
alpha{3} 2.588000 0.626118 1.257271 4.189710 2.460149 1184.46 1280.65 1.000
pinvar{all} 0.384506 0.002871 0.281405 0.488287 0.385063 1309.37 1376.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1271.471055
Model 2: PositiveSelection -1271.469716
Model 0: one-ratio -1271.53949
Model 3: discrete -1271.469716
Model 7: beta -1271.469025
Model 8: beta&w>1 -1271.470364
Model 0 vs 1 0.13686999999981708
Model 2 vs 1 0.0026779999998325366
Model 8 vs 7 0.0026779999998325366
>C1
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C2
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C3
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C4
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C5
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C6
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C7
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C8
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C9
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C10
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C11
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C12
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C13
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=13, Len=138
C1 MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
C2 MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
C3 MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
C4 MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
C5 MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
C6 MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
C7 MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
C8 MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
C9 MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
C10 MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
C11 MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
C12 MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
C13 MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
**************************************************
C1 FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
C2 FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
C3 FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
C4 FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
C5 FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
C6 FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
C7 FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
C8 FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
C9 FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
C10 FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
C11 FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
C12 FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
C13 FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
**************************************************
C1 SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
C2 SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
C3 SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
C4 SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
C5 SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
C6 SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
C7 SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
C8 SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
C9 SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
C10 SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
C11 SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
C12 SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
C13 SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
**************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 13 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 138 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 138 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [21528]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [21528]--->[21528]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/128/CG34135-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.670 Mb, Max= 31.248 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C2
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C3
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C4
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C5
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C6
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C7
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C8
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C9
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C10
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C11
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C12
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C13
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
FORMAT of file /tmp/tmp1950579249564184300aln Not Supported[FATAL:T-COFFEE]
>C1
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C2
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C3
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C4
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C5
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C6
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C7
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C8
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C9
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C10
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C11
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C12
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C13
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:138 S:100 BS:138
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# SEQ_INDEX C13 12
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 0 6 100.00 C1 C7 100.00
TOP 6 0 100.00 C7 C1 100.00
BOT 0 7 100.00 C1 C8 100.00
TOP 7 0 100.00 C8 C1 100.00
BOT 0 8 100.00 C1 C9 100.00
TOP 8 0 100.00 C9 C1 100.00
BOT 0 9 100.00 C1 C10 100.00
TOP 9 0 100.00 C10 C1 100.00
BOT 0 10 100.00 C1 C11 100.00
TOP 10 0 100.00 C11 C1 100.00
BOT 0 11 100.00 C1 C12 100.00
TOP 11 0 100.00 C12 C1 100.00
BOT 0 12 100.00 C1 C13 100.00
TOP 12 0 100.00 C13 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 1 6 100.00 C2 C7 100.00
TOP 6 1 100.00 C7 C2 100.00
BOT 1 7 100.00 C2 C8 100.00
TOP 7 1 100.00 C8 C2 100.00
BOT 1 8 100.00 C2 C9 100.00
TOP 8 1 100.00 C9 C2 100.00
BOT 1 9 100.00 C2 C10 100.00
TOP 9 1 100.00 C10 C2 100.00
BOT 1 10 100.00 C2 C11 100.00
TOP 10 1 100.00 C11 C2 100.00
BOT 1 11 100.00 C2 C12 100.00
TOP 11 1 100.00 C12 C2 100.00
BOT 1 12 100.00 C2 C13 100.00
TOP 12 1 100.00 C13 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 2 6 100.00 C3 C7 100.00
TOP 6 2 100.00 C7 C3 100.00
BOT 2 7 100.00 C3 C8 100.00
TOP 7 2 100.00 C8 C3 100.00
BOT 2 8 100.00 C3 C9 100.00
TOP 8 2 100.00 C9 C3 100.00
BOT 2 9 100.00 C3 C10 100.00
TOP 9 2 100.00 C10 C3 100.00
BOT 2 10 100.00 C3 C11 100.00
TOP 10 2 100.00 C11 C3 100.00
BOT 2 11 100.00 C3 C12 100.00
TOP 11 2 100.00 C12 C3 100.00
BOT 2 12 100.00 C3 C13 100.00
TOP 12 2 100.00 C13 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 3 6 100.00 C4 C7 100.00
TOP 6 3 100.00 C7 C4 100.00
BOT 3 7 100.00 C4 C8 100.00
TOP 7 3 100.00 C8 C4 100.00
BOT 3 8 100.00 C4 C9 100.00
TOP 8 3 100.00 C9 C4 100.00
BOT 3 9 100.00 C4 C10 100.00
TOP 9 3 100.00 C10 C4 100.00
BOT 3 10 100.00 C4 C11 100.00
TOP 10 3 100.00 C11 C4 100.00
BOT 3 11 100.00 C4 C12 100.00
TOP 11 3 100.00 C12 C4 100.00
BOT 3 12 100.00 C4 C13 100.00
TOP 12 3 100.00 C13 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
BOT 4 6 100.00 C5 C7 100.00
TOP 6 4 100.00 C7 C5 100.00
BOT 4 7 100.00 C5 C8 100.00
TOP 7 4 100.00 C8 C5 100.00
BOT 4 8 100.00 C5 C9 100.00
TOP 8 4 100.00 C9 C5 100.00
BOT 4 9 100.00 C5 C10 100.00
TOP 9 4 100.00 C10 C5 100.00
BOT 4 10 100.00 C5 C11 100.00
TOP 10 4 100.00 C11 C5 100.00
BOT 4 11 100.00 C5 C12 100.00
TOP 11 4 100.00 C12 C5 100.00
BOT 4 12 100.00 C5 C13 100.00
TOP 12 4 100.00 C13 C5 100.00
BOT 5 6 100.00 C6 C7 100.00
TOP 6 5 100.00 C7 C6 100.00
BOT 5 7 100.00 C6 C8 100.00
TOP 7 5 100.00 C8 C6 100.00
BOT 5 8 100.00 C6 C9 100.00
TOP 8 5 100.00 C9 C6 100.00
BOT 5 9 100.00 C6 C10 100.00
TOP 9 5 100.00 C10 C6 100.00
BOT 5 10 100.00 C6 C11 100.00
TOP 10 5 100.00 C11 C6 100.00
BOT 5 11 100.00 C6 C12 100.00
TOP 11 5 100.00 C12 C6 100.00
BOT 5 12 100.00 C6 C13 100.00
TOP 12 5 100.00 C13 C6 100.00
BOT 6 7 100.00 C7 C8 100.00
TOP 7 6 100.00 C8 C7 100.00
BOT 6 8 100.00 C7 C9 100.00
TOP 8 6 100.00 C9 C7 100.00
BOT 6 9 100.00 C7 C10 100.00
TOP 9 6 100.00 C10 C7 100.00
BOT 6 10 100.00 C7 C11 100.00
TOP 10 6 100.00 C11 C7 100.00
BOT 6 11 100.00 C7 C12 100.00
TOP 11 6 100.00 C12 C7 100.00
BOT 6 12 100.00 C7 C13 100.00
TOP 12 6 100.00 C13 C7 100.00
BOT 7 8 100.00 C8 C9 100.00
TOP 8 7 100.00 C9 C8 100.00
BOT 7 9 100.00 C8 C10 100.00
TOP 9 7 100.00 C10 C8 100.00
BOT 7 10 100.00 C8 C11 100.00
TOP 10 7 100.00 C11 C8 100.00
BOT 7 11 100.00 C8 C12 100.00
TOP 11 7 100.00 C12 C8 100.00
BOT 7 12 100.00 C8 C13 100.00
TOP 12 7 100.00 C13 C8 100.00
BOT 8 9 100.00 C9 C10 100.00
TOP 9 8 100.00 C10 C9 100.00
BOT 8 10 100.00 C9 C11 100.00
TOP 10 8 100.00 C11 C9 100.00
BOT 8 11 100.00 C9 C12 100.00
TOP 11 8 100.00 C12 C9 100.00
BOT 8 12 100.00 C9 C13 100.00
TOP 12 8 100.00 C13 C9 100.00
BOT 9 10 100.00 C10 C11 100.00
TOP 10 9 100.00 C11 C10 100.00
BOT 9 11 100.00 C10 C12 100.00
TOP 11 9 100.00 C12 C10 100.00
BOT 9 12 100.00 C10 C13 100.00
TOP 12 9 100.00 C13 C10 100.00
BOT 10 11 100.00 C11 C12 100.00
TOP 11 10 100.00 C12 C11 100.00
BOT 10 12 100.00 C11 C13 100.00
TOP 12 10 100.00 C13 C11 100.00
BOT 11 12 100.00 C12 C13 100.00
TOP 12 11 100.00 C13 C12 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
AVG 6 C7 * 100.00
AVG 7 C8 * 100.00
AVG 8 C9 * 100.00
AVG 9 C10 * 100.00
AVG 10 C11 * 100.00
AVG 11 C12 * 100.00
AVG 12 C13 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG
C2 ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG
C3 ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG
C4 ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTTTGGG
C5 ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG
C6 ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATTATCCTGGG
C7 ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATTATCCTGGG
C8 ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTTATTATCCTGGG
C9 ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTTATTATCCTGGG
C10 ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATTATCTTGGG
C11 ATGCAAAATCTCTCCATATCCTGCTCACTGGTCTGCCTAATCATCCTGGG
C12 ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATTATTTTGGG
C13 ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG
******** ****************** ********** ** ** ****
C1 TAGTGCCGCCCTTGTGGGCGCCTTTGGCGTCTGCCAGCGCCAAATCAGCG
C2 TAGTGCCGCCCTTGTGGGCGCCTTTGGCGTCTGCCAGCGCCAAATCAGCG
C3 TAGTGCCGCCCTTGTGGGCGCCTTTGGCGTCTGCCAGCGCCAAATCAGCG
C4 CAGTGCTGCCCTCGTGGGCGCCTTTGGAGTCTGCCAGCGCCAAATCAGCG
C5 CAGTGCTGCCCTCGTAGGTGCCTTTGGCGTTTGCCAGCGCCAAATCAGTG
C6 CAGTGCTGCCCTCGTGGGAGCCTTTGGCGTCTGCCAGCGGCAAATCAGCG
C7 CAGTGCTGCTCTCGTGGGAGCCTTTGGCGTGTGCCAGCGCCAAATCAGCG
C8 CAGTGCTGCTCTGGTGGGAGCTTTTGGCGTCTGCCAGCGCCAAATCAGCG
C9 CAGTGCTGCTCTGGTGGGAGCTTTTGGCGTCTGCCAGCGCCAAATCAGCG
C10 CAGTGCTGCTCTCGTGGGAGCCTTTGGCGTTTGCCAGCGCCAAATTAGTG
C11 CAGCGCTGCTCTCGTGGGAGCATTTGGCGTTTGCCAGCGACAAATTAGCG
C12 CAGTGCTGCCCTCGTGGGAGCCTTCGGCGTCTGCCAGCGCCAAATCAGCG
C13 CAGTGCTGCTCTTGTGGGAGCCTTTGGCGTTTGCCAGCGCCAAATCAGCG
** ** ** ** **.** ** ** **.** ******** ***** ** *
C1 CCATTTTAATCACAGGAGTGATGTATTTACTGGCGGCGCTCTTTGCCCTC
C2 CCATTTTAATCACAGGAGTGATGTATTTACTGGCGGCGCTCTTTGCCCTC
C3 CCATTTTAATCACAGGAGTGATGTATTTACTGGCGGCGCTGTTTGCCCTC
C4 CCATTCTGATCACAGGAGTGATGTATTTACTAGCAGCTCTATTTGCCCTC
C5 CCATTCTGATCACAGGAGTGATGTATTTACTAGCAGCTCTCTTTGCCCTG
C6 CCATTCTGATCACAGGTGTGATGTACTTACTGGCAGCTCTGTTTGCCCTC
C7 CCATTCTGATCACAGGGGTGATGTATTTACTGGCGGCTCTCTTTGCCCTG
C8 CCATTCTCATCACAGGGGTTATGTATTTACTGGCGGCACTCTTTGCCCTC
C9 CCATTCTCATCACAGGGGTTATGTATTTACTGGCGGCACTCTTTGCCCTC
C10 CCATTCTGATCACAGGGGTGATGTATCTCCTGGCGGCTCTCTTCGCCCTC
C11 CCATACTCATTACTGGAGTGATGTATTTGCTGGCGGCTCTTTTCGCCCTG
C12 CCATACTCATCACAGGGGTGATGTATCTACTGGCGGCTCTCTTTGCCCTA
C13 CCATACTGATCACAGGGGTGATGTATCTACTGGCGGCTCTTTTCGCCCTC
****: * ** **:** ** ***** * **.**.** ** ** *****
C1 TTCACGCTCATGATCATTCACTTCAAGCGGCAGCAGGGACGTCCCATGCT
C2 TTCACGCTCATGATCATTCACTTCAAGCGGCAGCAGGGACGTCCCATGCT
C3 TTCACGCTCATGATCATTCACTTCAAGCGGCAGCAGGGACGTCCCATGCT
C4 TTCACGCTCATGATCATTCACTTCAAGCGGCAGCAGGGACGTCCCATGCT
C5 TTCACGCTCATGATCATCCACTTCAAGCGGCAGCAGGGACGTCCCATGCT
C6 TTTACGCTGATGATCATCCACTTCAAGCGGCAGCAGGGACGTCCCATGCT
C7 TTCACGCTGATGATCATCCACTTCAAGCGGCAGCAGGGACGTCCCATGCT
C8 TTCACTCTGATGATCATCCACTTCAAGCGACAGCAGGGACGCCCTATGCT
C9 TTCACTCTGATGATCATCCACTTCAAGCGACAGCAGGGACGCCCTATGCT
C10 TTTACACTGATGATCATCCACTTTAAACGGCAGCAGGGACGTCCAATGCT
C11 TTCACGCTGATGATCATCCATTTCAAGCGGCAGCAGGGGCGTCCCATGCT
C12 TTCACTCTGATGATCATCCATTTCAAGCGGCAGCAGGGACGTCCAATGCT
C13 TTCACGCTGATGATCATCCACTTCAAGCGGCAGCAGGGACGTCCAATGCT
** ** ** ******** ** ** **.**.********.** ** *****
C1 GGACAGCGACTACGATGGCACGGTGGATGGAATAGTGGCGCGACCAGGAG
C2 GGACAGCGACTACGATGGCACGGTGGACGGAATAGTGGCGCGACCAGGAG
C3 GGACAGCGACTACGATGGCACGGTGGACGGAATAGTGGCGCGACCAGGAG
C4 GGACAGCGACTACGATGGAACGGTGGACGGAATAGTGGCGCGACCAGGTG
C5 GGACAGCGACTACGATGGAACGGTGGACGGAATAGTGGCGCGACCAGGAG
C6 GGACAGCGACTACGATGGAACCGTGGACGGGATAGTGGCGCGACCAGGTG
C7 GGACAGCGACTACGATGGCACCGTGGACGGGATAGTTGCGCGACCAGGAG
C8 GGACAGCGACTACGATGGCACCGTGGACGGGATAGTGGCGCGACCAGGAG
C9 GGACAGCGACTACGATGGCACCGTGGACGGGATAGTGGCGCGACCAGGAG
C10 GGACAGCGACTACGATGGAACTGTGGATGGGATAGTGGCGCGACCGGGAG
C11 GGACAGCGACTACGATGGCACCGTGGACGGGATTGTGGCGCGTCCGGGTG
C12 GGACAGCGACTATGATGGAACCGTGGATGGGATTGTGGCGCGACCAGGAG
C13 GGACAGTGACTACGATGGAACCGTGGATGGAATTGTGGCGCGACCAGGAG
****** ***** *****.** ***** **.**:** *****:**.**:*
C1 GCGTGGCCATAATGGCCAAGCCGCTGCTGGGAGCACGCATCTTCCTCACC
C2 GCGTGGCCATAATGGCCAAGCCGCTGCTGGGAGCGCGCATCTTCCTCACC
C3 GCGTGGCCATAATGGCCAAGCCGCTGCTGGGAGCGCGCATCTTCCTCACC
C4 GCGTGGCCATCATGGCCAAGCCGCTGCTGGGAGCGCGCATCTTTCTCACC
C5 GCGTGGCCATAATGGCCAAGCCACTGCTGGGAGCGCGCATCTTCCTCACC
C6 GCGTGGCCATCATGGCCAAGCCCCTGCTTGGAGCACGCATCTTCCTCACC
C7 GCGTTGCCATCATGGCCAAGCCGCTGCTGGGCGCGCGCATCTTCCTCACC
C8 GCGTAGCCATCATGGCCAAGCCGCTTCTGGGGGCACGCATCTTCCTCACC
C9 GCGTAGCCATCATGGCCAAGCCGCTTCTGGGGGCACGCATCTTCCTCACC
C10 GCGTGGCTATCATGGCTAAGCCGCTTCTGGGAGCACGCATCTTCCTGACC
C11 GAGTGGCCATCATGGCCAAGCCGCTGCTGGGCGCCCGCATCTTCCTGACC
C12 GTGTGGCCATCATGGCTAAGCCGCTACTGGGGGCACGCATCTTCCTGACC
C13 GAGTGGCCATCATGGCCAAGCCGCTACTGGGGGCACGCATCTTCCTGACC
* ** ** **.***** ***** ** ** ** ** ******** ** ***
C1 TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTCTGCGCCATCAC
C2 TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTCTGCGCCATCAC
C3 TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTCTGCGCCATCAC
C4 TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTGTGCGCCATCAC
C5 TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTCTGCGCCATCAC
C6 TCGTGGAGCCTCGACTTGGGCTGGGGCGGGGTGGTGCTGTGCGCCATCAC
C7 TCGTGGAGCCTGGACTTGGGCTGGGGCGGGGTGGTGCTTTGCGCCATCAC
C8 TCGTGGAGCCTGGACTTGGGCTGGGGCGGGGTGGTGCTGTGTGCCATTAC
C9 TCGTGGAGCCTGGACTTGGGCTGGGGCGGGGTGGTGCTGTGTGCCATTAC
C10 TCGTGGAGTCTAGACCTGGGCTGGGGCGGGGTGGTGCTTTGCGCCATAAC
C11 TCGTGGAGCCTGGACTTGGGATGGGGCGGCGTGGTGCTGTGCGCCATCAC
C12 TCGTGGAGCCTTGATCTGGGTTGGGGCGGGGTGGTACTGTGCGCCATCAC
C13 TCTTGGAGCCTTGATCTGGGATGGGGCGGAGTGGTGCTGTGCGCCATCAC
** ***** ** ** **** ******** *****.** ** ***** **
C1 CTCGGTACTGTGGATCCTGCTCTCCAAAATCATGCGGTACAACCCCTTCT
C2 CTCGGTACTGTGGATCCTTCTCTCCAAGATCATGCGGTACAACCCCTTCT
C3 CTCGGTACTGTGGATCCTGCTCTCCAAGATCATGCGGTACAACCCCTTCT
C4 CTCGGTACTGTGGATCCTGCTCTCCAAGATCATGCGGTACAACCCCTTCT
C5 CTCTGTACTGTGGATCCTGCTCTCCAAGATCATGCGGTACAACCCCTTCT
C6 CTCGGTGCTGTGGATCCTGCTGTCCAAGATCATGCGCTACAACCCCTTCT
C7 CTCGGTGCTGTGGATCTTGCTTTCCAAGATCATGCGCTACAACCCCTTCT
C8 CTCGGTGCTGTGGATCCTGCTGTCCAAGATCATGCGCTATAACCCCTTCT
C9 CTCGGTGCTGTGGATCCTGCTGTCCAAGATCATGCGCTATAACCCCTTCT
C10 CTCGGTACTGTGGATTCTGCTCTCCAAGATCATGCGATACAACCCATTCT
C11 CTCGGTGCTGTGGATCCTGCTCTCCAAGATCATGCGCTACAACCCGTTCT
C12 CTCAGTTCTGTGGATCCTGCTCTCCAAGATCATGCGGTATAACCCGTTCT
C13 TTCCGTTCTGTGGATCCTGCTCTCCAAGATCATGCGGTACAACCCCTTCT
** ** ******** * ** *****.******** ** ***** ****
C1 CGGCGCTCATGATT
C2 CGGCGCTCATGATT
C3 CGGCGCTCATGATT
C4 CGGCGCTCATGATT
C5 CGGCGCTCATGATT
C6 CGGCGCTCATGATT
C7 CGGCGCTCATGATT
C8 CGGCGCTCATGATT
C9 CGGCGCTCATGATT
C10 CAGCGCTCATGATT
C11 CGGCGCTCATGATT
C12 CGGCGCTCATGATT
C13 CGGCGCTCATGATT
*.************
>C1
ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG
TAGTGCCGCCCTTGTGGGCGCCTTTGGCGTCTGCCAGCGCCAAATCAGCG
CCATTTTAATCACAGGAGTGATGTATTTACTGGCGGCGCTCTTTGCCCTC
TTCACGCTCATGATCATTCACTTCAAGCGGCAGCAGGGACGTCCCATGCT
GGACAGCGACTACGATGGCACGGTGGATGGAATAGTGGCGCGACCAGGAG
GCGTGGCCATAATGGCCAAGCCGCTGCTGGGAGCACGCATCTTCCTCACC
TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTCTGCGCCATCAC
CTCGGTACTGTGGATCCTGCTCTCCAAAATCATGCGGTACAACCCCTTCT
CGGCGCTCATGATT
>C2
ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG
TAGTGCCGCCCTTGTGGGCGCCTTTGGCGTCTGCCAGCGCCAAATCAGCG
CCATTTTAATCACAGGAGTGATGTATTTACTGGCGGCGCTCTTTGCCCTC
TTCACGCTCATGATCATTCACTTCAAGCGGCAGCAGGGACGTCCCATGCT
GGACAGCGACTACGATGGCACGGTGGACGGAATAGTGGCGCGACCAGGAG
GCGTGGCCATAATGGCCAAGCCGCTGCTGGGAGCGCGCATCTTCCTCACC
TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTCTGCGCCATCAC
CTCGGTACTGTGGATCCTTCTCTCCAAGATCATGCGGTACAACCCCTTCT
CGGCGCTCATGATT
>C3
ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG
TAGTGCCGCCCTTGTGGGCGCCTTTGGCGTCTGCCAGCGCCAAATCAGCG
CCATTTTAATCACAGGAGTGATGTATTTACTGGCGGCGCTGTTTGCCCTC
TTCACGCTCATGATCATTCACTTCAAGCGGCAGCAGGGACGTCCCATGCT
GGACAGCGACTACGATGGCACGGTGGACGGAATAGTGGCGCGACCAGGAG
GCGTGGCCATAATGGCCAAGCCGCTGCTGGGAGCGCGCATCTTCCTCACC
TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTCTGCGCCATCAC
CTCGGTACTGTGGATCCTGCTCTCCAAGATCATGCGGTACAACCCCTTCT
CGGCGCTCATGATT
>C4
ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTTTGGG
CAGTGCTGCCCTCGTGGGCGCCTTTGGAGTCTGCCAGCGCCAAATCAGCG
CCATTCTGATCACAGGAGTGATGTATTTACTAGCAGCTCTATTTGCCCTC
TTCACGCTCATGATCATTCACTTCAAGCGGCAGCAGGGACGTCCCATGCT
GGACAGCGACTACGATGGAACGGTGGACGGAATAGTGGCGCGACCAGGTG
GCGTGGCCATCATGGCCAAGCCGCTGCTGGGAGCGCGCATCTTTCTCACC
TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTGTGCGCCATCAC
CTCGGTACTGTGGATCCTGCTCTCCAAGATCATGCGGTACAACCCCTTCT
CGGCGCTCATGATT
>C5
ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG
CAGTGCTGCCCTCGTAGGTGCCTTTGGCGTTTGCCAGCGCCAAATCAGTG
CCATTCTGATCACAGGAGTGATGTATTTACTAGCAGCTCTCTTTGCCCTG
TTCACGCTCATGATCATCCACTTCAAGCGGCAGCAGGGACGTCCCATGCT
GGACAGCGACTACGATGGAACGGTGGACGGAATAGTGGCGCGACCAGGAG
GCGTGGCCATAATGGCCAAGCCACTGCTGGGAGCGCGCATCTTCCTCACC
TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTCTGCGCCATCAC
CTCTGTACTGTGGATCCTGCTCTCCAAGATCATGCGGTACAACCCCTTCT
CGGCGCTCATGATT
>C6
ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATTATCCTGGG
CAGTGCTGCCCTCGTGGGAGCCTTTGGCGTCTGCCAGCGGCAAATCAGCG
CCATTCTGATCACAGGTGTGATGTACTTACTGGCAGCTCTGTTTGCCCTC
TTTACGCTGATGATCATCCACTTCAAGCGGCAGCAGGGACGTCCCATGCT
GGACAGCGACTACGATGGAACCGTGGACGGGATAGTGGCGCGACCAGGTG
GCGTGGCCATCATGGCCAAGCCCCTGCTTGGAGCACGCATCTTCCTCACC
TCGTGGAGCCTCGACTTGGGCTGGGGCGGGGTGGTGCTGTGCGCCATCAC
CTCGGTGCTGTGGATCCTGCTGTCCAAGATCATGCGCTACAACCCCTTCT
CGGCGCTCATGATT
>C7
ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATTATCCTGGG
CAGTGCTGCTCTCGTGGGAGCCTTTGGCGTGTGCCAGCGCCAAATCAGCG
CCATTCTGATCACAGGGGTGATGTATTTACTGGCGGCTCTCTTTGCCCTG
TTCACGCTGATGATCATCCACTTCAAGCGGCAGCAGGGACGTCCCATGCT
GGACAGCGACTACGATGGCACCGTGGACGGGATAGTTGCGCGACCAGGAG
GCGTTGCCATCATGGCCAAGCCGCTGCTGGGCGCGCGCATCTTCCTCACC
TCGTGGAGCCTGGACTTGGGCTGGGGCGGGGTGGTGCTTTGCGCCATCAC
CTCGGTGCTGTGGATCTTGCTTTCCAAGATCATGCGCTACAACCCCTTCT
CGGCGCTCATGATT
>C8
ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTTATTATCCTGGG
CAGTGCTGCTCTGGTGGGAGCTTTTGGCGTCTGCCAGCGCCAAATCAGCG
CCATTCTCATCACAGGGGTTATGTATTTACTGGCGGCACTCTTTGCCCTC
TTCACTCTGATGATCATCCACTTCAAGCGACAGCAGGGACGCCCTATGCT
GGACAGCGACTACGATGGCACCGTGGACGGGATAGTGGCGCGACCAGGAG
GCGTAGCCATCATGGCCAAGCCGCTTCTGGGGGCACGCATCTTCCTCACC
TCGTGGAGCCTGGACTTGGGCTGGGGCGGGGTGGTGCTGTGTGCCATTAC
CTCGGTGCTGTGGATCCTGCTGTCCAAGATCATGCGCTATAACCCCTTCT
CGGCGCTCATGATT
>C9
ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTTATTATCCTGGG
CAGTGCTGCTCTGGTGGGAGCTTTTGGCGTCTGCCAGCGCCAAATCAGCG
CCATTCTCATCACAGGGGTTATGTATTTACTGGCGGCACTCTTTGCCCTC
TTCACTCTGATGATCATCCACTTCAAGCGACAGCAGGGACGCCCTATGCT
GGACAGCGACTACGATGGCACCGTGGACGGGATAGTGGCGCGACCAGGAG
GCGTAGCCATCATGGCCAAGCCGCTTCTGGGGGCACGCATCTTCCTCACC
TCGTGGAGCCTGGACTTGGGCTGGGGCGGGGTGGTGCTGTGTGCCATTAC
CTCGGTGCTGTGGATCCTGCTGTCCAAGATCATGCGCTATAACCCCTTCT
CGGCGCTCATGATT
>C10
ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATTATCTTGGG
CAGTGCTGCTCTCGTGGGAGCCTTTGGCGTTTGCCAGCGCCAAATTAGTG
CCATTCTGATCACAGGGGTGATGTATCTCCTGGCGGCTCTCTTCGCCCTC
TTTACACTGATGATCATCCACTTTAAACGGCAGCAGGGACGTCCAATGCT
GGACAGCGACTACGATGGAACTGTGGATGGGATAGTGGCGCGACCGGGAG
GCGTGGCTATCATGGCTAAGCCGCTTCTGGGAGCACGCATCTTCCTGACC
TCGTGGAGTCTAGACCTGGGCTGGGGCGGGGTGGTGCTTTGCGCCATAAC
CTCGGTACTGTGGATTCTGCTCTCCAAGATCATGCGATACAACCCATTCT
CAGCGCTCATGATT
>C11
ATGCAAAATCTCTCCATATCCTGCTCACTGGTCTGCCTAATCATCCTGGG
CAGCGCTGCTCTCGTGGGAGCATTTGGCGTTTGCCAGCGACAAATTAGCG
CCATACTCATTACTGGAGTGATGTATTTGCTGGCGGCTCTTTTCGCCCTG
TTCACGCTGATGATCATCCATTTCAAGCGGCAGCAGGGGCGTCCCATGCT
GGACAGCGACTACGATGGCACCGTGGACGGGATTGTGGCGCGTCCGGGTG
GAGTGGCCATCATGGCCAAGCCGCTGCTGGGCGCCCGCATCTTCCTGACC
TCGTGGAGCCTGGACTTGGGATGGGGCGGCGTGGTGCTGTGCGCCATCAC
CTCGGTGCTGTGGATCCTGCTCTCCAAGATCATGCGCTACAACCCGTTCT
CGGCGCTCATGATT
>C12
ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATTATTTTGGG
CAGTGCTGCCCTCGTGGGAGCCTTCGGCGTCTGCCAGCGCCAAATCAGCG
CCATACTCATCACAGGGGTGATGTATCTACTGGCGGCTCTCTTTGCCCTA
TTCACTCTGATGATCATCCATTTCAAGCGGCAGCAGGGACGTCCAATGCT
GGACAGCGACTATGATGGAACCGTGGATGGGATTGTGGCGCGACCAGGAG
GTGTGGCCATCATGGCTAAGCCGCTACTGGGGGCACGCATCTTCCTGACC
TCGTGGAGCCTTGATCTGGGTTGGGGCGGGGTGGTACTGTGCGCCATCAC
CTCAGTTCTGTGGATCCTGCTCTCCAAGATCATGCGGTATAACCCGTTCT
CGGCGCTCATGATT
>C13
ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG
CAGTGCTGCTCTTGTGGGAGCCTTTGGCGTTTGCCAGCGCCAAATCAGCG
CCATACTGATCACAGGGGTGATGTATCTACTGGCGGCTCTTTTCGCCCTC
TTCACGCTGATGATCATCCACTTCAAGCGGCAGCAGGGACGTCCAATGCT
GGACAGTGACTACGATGGAACCGTGGATGGAATTGTGGCGCGACCAGGAG
GAGTGGCCATCATGGCCAAGCCGCTACTGGGGGCACGCATCTTCCTGACC
TCTTGGAGCCTTGATCTGGGATGGGGCGGAGTGGTGCTGTGCGCCATCAC
TTCCGTTCTGTGGATCCTGCTCTCCAAGATCATGCGGTACAACCCCTTCT
CGGCGCTCATGATT
>C1
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C2
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C3
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C4
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C5
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C6
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C7
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C8
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C9
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C10
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C11
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C12
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
>C13
MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 13 taxa and 414 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Taxon 12 -> C12
Taxon 13 -> C13
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1477941792
Setting output file names to "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 78732112
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9398523135
Seed = 126113906
Swapseed = 1477941792
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 9 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 84 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2244.470885 -- -25.419252
Chain 2 -- -2289.933634 -- -25.419252
Chain 3 -- -2282.704156 -- -25.419252
Chain 4 -- -2258.428680 -- -25.419252
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2310.789707 -- -25.419252
Chain 2 -- -2290.568401 -- -25.419252
Chain 3 -- -2320.952811 -- -25.419252
Chain 4 -- -2341.282048 -- -25.419252
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2244.471] (-2289.934) (-2282.704) (-2258.429) * [-2310.790] (-2290.568) (-2320.953) (-2341.282)
500 -- [-1527.555] (-1543.356) (-1535.236) (-1543.555) * [-1534.786] (-1545.158) (-1556.504) (-1555.869) -- 0:00:00
1000 -- (-1489.559) (-1503.909) [-1489.074] (-1516.143) * (-1502.837) [-1492.986] (-1495.479) (-1517.826) -- 0:16:39
1500 -- (-1471.080) (-1462.433) (-1469.884) [-1476.553] * [-1453.769] (-1460.687) (-1465.259) (-1495.761) -- 0:11:05
2000 -- (-1456.549) (-1455.035) (-1447.869) [-1443.454] * (-1439.709) [-1424.439] (-1428.229) (-1492.695) -- 0:08:19
2500 -- (-1420.595) (-1438.969) [-1415.808] (-1430.013) * (-1428.581) (-1408.888) [-1403.116] (-1422.764) -- 0:06:39
3000 -- (-1406.842) (-1420.033) (-1404.567) [-1406.558] * (-1405.789) (-1408.724) [-1401.473] (-1402.690) -- 0:05:32
3500 -- [-1404.534] (-1418.406) (-1413.757) (-1409.791) * [-1407.207] (-1403.622) (-1418.687) (-1403.413) -- 0:04:44
4000 -- [-1404.818] (-1406.867) (-1408.292) (-1413.467) * [-1399.415] (-1416.857) (-1419.328) (-1412.389) -- 0:08:18
4500 -- (-1403.575) (-1408.827) (-1414.158) [-1402.872] * [-1404.337] (-1409.750) (-1417.963) (-1407.733) -- 0:07:22
5000 -- (-1400.597) [-1401.140] (-1407.773) (-1404.818) * (-1405.863) (-1404.578) (-1415.587) [-1408.974] -- 0:06:38
Average standard deviation of split frequencies: 0.087996
5500 -- (-1409.083) [-1396.492] (-1418.891) (-1409.330) * [-1406.062] (-1413.943) (-1408.290) (-1414.562) -- 0:06:01
6000 -- (-1407.384) (-1402.186) (-1403.574) [-1409.912] * (-1405.874) [-1403.906] (-1414.785) (-1409.614) -- 0:05:31
6500 -- (-1404.095) (-1402.094) (-1415.044) [-1396.247] * (-1405.865) [-1404.496] (-1404.847) (-1415.390) -- 0:07:38
7000 -- (-1406.201) [-1400.863] (-1415.091) (-1403.669) * [-1405.406] (-1410.541) (-1413.923) (-1407.252) -- 0:07:05
7500 -- (-1405.689) [-1402.831] (-1412.082) (-1404.142) * (-1400.789) [-1406.726] (-1417.926) (-1400.865) -- 0:06:37
8000 -- (-1405.641) (-1405.319) [-1403.636] (-1407.516) * (-1407.638) (-1409.856) (-1404.518) [-1404.725] -- 0:06:12
8500 -- (-1410.935) [-1406.586] (-1408.581) (-1407.751) * (-1409.388) (-1400.588) [-1405.894] (-1404.472) -- 0:07:46
9000 -- [-1406.111] (-1400.704) (-1414.147) (-1407.925) * (-1408.166) (-1401.466) (-1412.395) [-1403.506] -- 0:07:20
9500 -- (-1419.563) [-1403.617] (-1404.459) (-1413.226) * [-1402.425] (-1402.615) (-1412.776) (-1406.798) -- 0:06:57
10000 -- (-1422.159) (-1404.535) (-1398.494) [-1407.782] * [-1410.726] (-1417.291) (-1405.800) (-1400.473) -- 0:06:36
Average standard deviation of split frequencies: 0.075130
10500 -- (-1409.743) (-1407.874) (-1401.591) [-1406.332] * (-1408.383) (-1413.979) [-1406.163] (-1400.385) -- 0:07:51
11000 -- (-1422.179) [-1404.831] (-1412.873) (-1403.283) * (-1413.596) (-1400.288) (-1409.544) [-1412.988] -- 0:07:29
11500 -- (-1423.406) (-1412.201) [-1416.215] (-1403.368) * (-1410.721) (-1410.895) [-1401.010] (-1406.060) -- 0:07:09
12000 -- [-1407.466] (-1411.334) (-1413.039) (-1413.499) * [-1404.024] (-1407.536) (-1407.951) (-1406.308) -- 0:06:51
12500 -- [-1403.617] (-1414.082) (-1411.897) (-1412.812) * [-1406.739] (-1407.862) (-1412.156) (-1408.778) -- 0:06:35
13000 -- (-1411.519) (-1412.546) (-1413.760) [-1420.748] * (-1409.043) (-1417.186) [-1407.017] (-1409.653) -- 0:07:35
13500 -- (-1412.038) (-1425.234) [-1419.715] (-1409.481) * (-1407.768) (-1402.571) (-1403.917) [-1406.364] -- 0:07:18
14000 -- (-1414.612) (-1410.266) (-1419.249) [-1412.647] * (-1417.750) (-1401.079) [-1398.606] (-1409.824) -- 0:07:02
14500 -- [-1408.966] (-1407.744) (-1416.770) (-1418.891) * [-1406.271] (-1399.303) (-1414.525) (-1409.297) -- 0:06:47
15000 -- (-1409.083) [-1406.431] (-1414.583) (-1416.778) * (-1405.661) [-1398.042] (-1405.403) (-1411.777) -- 0:06:34
Average standard deviation of split frequencies: 0.044970
15500 -- (-1404.682) (-1403.431) [-1403.739] (-1413.710) * (-1410.043) (-1404.624) (-1404.412) [-1403.082] -- 0:07:24
16000 -- (-1411.031) (-1407.348) [-1402.543] (-1407.592) * (-1416.067) (-1407.234) [-1408.567] (-1410.169) -- 0:07:10
16500 -- [-1399.543] (-1414.486) (-1403.099) (-1412.162) * (-1415.702) (-1409.750) [-1397.630] (-1403.275) -- 0:06:57
17000 -- (-1403.264) (-1416.135) (-1415.066) [-1397.271] * (-1412.735) (-1409.691) [-1402.744] (-1412.549) -- 0:06:44
17500 -- (-1407.019) (-1407.742) [-1404.868] (-1412.303) * (-1402.777) (-1416.656) (-1412.244) [-1405.953] -- 0:06:33
18000 -- (-1407.152) (-1394.787) (-1401.631) [-1407.713] * (-1405.315) (-1404.341) [-1414.611] (-1407.361) -- 0:07:16
18500 -- (-1406.235) [-1410.093] (-1401.927) (-1406.148) * [-1404.347] (-1407.768) (-1406.350) (-1405.373) -- 0:07:04
19000 -- (-1404.282) (-1411.112) [-1396.708] (-1405.968) * (-1397.240) [-1399.667] (-1411.409) (-1411.617) -- 0:06:53
19500 -- (-1404.164) [-1406.423] (-1408.833) (-1409.392) * (-1396.589) (-1410.902) (-1410.620) [-1400.635] -- 0:06:42
20000 -- (-1413.675) [-1406.644] (-1403.387) (-1406.656) * (-1396.092) (-1399.454) [-1407.944] (-1413.173) -- 0:07:21
Average standard deviation of split frequencies: 0.029519
20500 -- (-1413.728) (-1405.039) (-1401.037) [-1397.401] * [-1398.264] (-1411.049) (-1406.698) (-1411.032) -- 0:07:10
21000 -- (-1405.700) [-1405.680] (-1409.780) (-1406.762) * (-1408.148) (-1396.948) [-1413.366] (-1422.881) -- 0:06:59
21500 -- (-1400.200) (-1402.944) (-1417.730) [-1407.552] * (-1397.610) [-1403.442] (-1401.345) (-1408.518) -- 0:06:49
22000 -- [-1399.792] (-1402.451) (-1407.203) (-1415.030) * (-1404.763) (-1406.678) [-1407.039] (-1401.610) -- 0:07:24
22500 -- (-1401.897) (-1407.926) [-1399.957] (-1410.923) * (-1408.411) [-1417.728] (-1405.179) (-1402.068) -- 0:07:14
23000 -- [-1410.269] (-1409.929) (-1411.190) (-1399.615) * (-1403.294) (-1399.917) [-1407.995] (-1413.356) -- 0:07:04
23500 -- (-1407.272) (-1431.195) (-1409.646) [-1396.313] * (-1405.876) (-1405.203) (-1404.651) [-1404.553] -- 0:06:55
24000 -- (-1404.141) (-1412.234) [-1402.520] (-1404.446) * (-1404.314) [-1408.623] (-1404.739) (-1412.273) -- 0:06:46
24500 -- (-1414.505) [-1403.659] (-1402.179) (-1405.418) * (-1400.681) [-1403.456] (-1416.655) (-1414.696) -- 0:07:17
25000 -- (-1415.640) [-1404.114] (-1406.988) (-1410.798) * (-1412.895) (-1400.229) [-1411.628] (-1407.637) -- 0:07:09
Average standard deviation of split frequencies: 0.037216
25500 -- [-1408.593] (-1406.909) (-1402.127) (-1413.765) * [-1401.216] (-1407.793) (-1407.868) (-1413.567) -- 0:07:00
26000 -- (-1407.122) (-1403.065) (-1406.603) [-1406.398] * [-1405.880] (-1413.881) (-1441.457) (-1415.408) -- 0:06:52
26500 -- (-1411.644) (-1413.368) [-1401.392] (-1407.374) * (-1412.573) [-1403.515] (-1413.891) (-1411.995) -- 0:06:44
27000 -- (-1403.652) (-1408.635) [-1401.306] (-1412.279) * [-1403.128] (-1412.646) (-1411.875) (-1415.169) -- 0:07:12
27500 -- (-1403.642) (-1407.009) [-1400.560] (-1411.213) * (-1402.058) (-1409.892) [-1406.497] (-1419.763) -- 0:07:04
28000 -- [-1409.772] (-1407.007) (-1400.593) (-1417.280) * (-1402.389) (-1413.532) [-1399.152] (-1423.766) -- 0:06:56
28500 -- [-1401.792] (-1410.856) (-1411.353) (-1423.100) * [-1404.395] (-1416.286) (-1405.580) (-1415.418) -- 0:06:49
29000 -- (-1408.431) (-1412.480) [-1402.100] (-1417.327) * (-1407.968) [-1404.813] (-1420.914) (-1406.595) -- 0:06:41
29500 -- [-1405.402] (-1412.276) (-1406.701) (-1417.844) * [-1401.562] (-1401.462) (-1410.838) (-1413.146) -- 0:07:07
30000 -- (-1403.637) (-1401.106) (-1407.099) [-1407.848] * (-1419.226) (-1406.729) (-1410.602) [-1399.363] -- 0:07:00
Average standard deviation of split frequencies: 0.034361
30500 -- (-1399.151) (-1405.440) [-1397.967] (-1409.404) * [-1402.337] (-1418.015) (-1407.253) (-1401.993) -- 0:06:53
31000 -- (-1411.012) (-1405.400) [-1401.553] (-1417.894) * (-1396.874) (-1413.747) (-1425.529) [-1405.220] -- 0:06:46
31500 -- (-1407.127) (-1402.842) (-1401.444) [-1410.081] * (-1405.021) [-1414.311] (-1408.315) (-1404.780) -- 0:06:39
32000 -- (-1414.569) (-1410.791) [-1405.225] (-1411.278) * (-1417.654) [-1401.469] (-1416.031) (-1408.720) -- 0:07:03
32500 -- [-1407.305] (-1416.708) (-1407.625) (-1405.034) * (-1403.373) (-1416.215) (-1409.973) [-1409.866] -- 0:06:56
33000 -- [-1411.370] (-1410.161) (-1412.963) (-1414.957) * (-1405.456) (-1420.495) [-1410.782] (-1410.425) -- 0:06:50
33500 -- [-1415.623] (-1429.538) (-1405.076) (-1405.422) * (-1411.421) [-1404.994] (-1408.700) (-1406.787) -- 0:06:43
34000 -- (-1413.566) [-1416.183] (-1408.496) (-1396.656) * (-1403.850) (-1415.319) (-1405.109) [-1402.470] -- 0:06:37
34500 -- (-1414.843) (-1413.118) (-1410.963) [-1400.604] * [-1402.529] (-1404.618) (-1415.483) (-1402.603) -- 0:06:59
35000 -- (-1407.109) (-1405.727) [-1399.876] (-1404.823) * (-1404.297) (-1414.730) (-1406.420) [-1398.614] -- 0:06:53
Average standard deviation of split frequencies: 0.025419
35500 -- [-1405.790] (-1404.480) (-1409.876) (-1407.598) * (-1408.164) (-1411.959) (-1408.643) [-1403.026] -- 0:06:47
36000 -- (-1407.425) [-1404.051] (-1409.519) (-1400.475) * (-1412.298) (-1407.903) (-1417.264) [-1397.350] -- 0:06:41
36500 -- (-1406.050) (-1393.114) [-1406.785] (-1403.471) * [-1408.592] (-1407.193) (-1410.133) (-1409.631) -- 0:06:35
37000 -- (-1411.632) (-1408.652) [-1407.682] (-1406.982) * [-1404.360] (-1413.234) (-1409.889) (-1415.774) -- 0:06:56
37500 -- (-1416.984) (-1409.902) [-1406.958] (-1411.234) * (-1410.966) [-1402.181] (-1410.565) (-1418.653) -- 0:06:50
38000 -- (-1407.544) [-1402.201] (-1402.006) (-1422.584) * (-1418.347) [-1400.425] (-1414.519) (-1401.164) -- 0:06:45
38500 -- (-1414.519) (-1406.982) [-1397.280] (-1408.225) * (-1408.729) (-1405.935) (-1409.541) [-1405.716] -- 0:06:39
39000 -- [-1402.082] (-1414.245) (-1407.474) (-1416.065) * (-1400.754) [-1407.265] (-1411.319) (-1408.962) -- 0:06:58
39500 -- (-1406.103) (-1408.676) [-1402.394] (-1409.409) * (-1409.334) (-1400.803) (-1413.161) [-1403.780] -- 0:06:53
40000 -- (-1407.480) (-1405.679) [-1401.593] (-1406.196) * (-1409.923) (-1407.686) (-1410.032) [-1396.286] -- 0:06:48
Average standard deviation of split frequencies: 0.021820
40500 -- [-1402.017] (-1408.378) (-1410.662) (-1405.045) * (-1409.264) (-1412.160) (-1408.629) [-1402.568] -- 0:06:42
41000 -- [-1412.766] (-1428.940) (-1423.738) (-1409.820) * [-1403.808] (-1423.666) (-1401.108) (-1418.431) -- 0:06:37
41500 -- (-1408.997) [-1400.077] (-1410.880) (-1400.134) * (-1412.467) (-1408.653) [-1407.104] (-1408.070) -- 0:06:55
42000 -- [-1409.455] (-1400.761) (-1412.660) (-1405.242) * (-1403.643) (-1405.057) (-1411.244) [-1402.858] -- 0:06:50
42500 -- (-1398.538) [-1406.683] (-1409.766) (-1401.100) * (-1412.487) (-1407.239) (-1405.740) [-1398.778] -- 0:06:45
43000 -- [-1402.493] (-1403.922) (-1406.721) (-1413.285) * (-1408.384) (-1409.313) [-1409.734] (-1405.751) -- 0:06:40
43500 -- (-1411.632) [-1395.967] (-1415.133) (-1407.959) * (-1404.715) (-1405.683) (-1405.180) [-1407.435] -- 0:06:35
44000 -- (-1411.069) [-1407.479] (-1414.315) (-1408.807) * (-1412.706) [-1398.651] (-1415.750) (-1418.813) -- 0:06:52
44500 -- [-1404.339] (-1403.253) (-1414.053) (-1405.110) * (-1408.369) [-1400.529] (-1402.623) (-1410.864) -- 0:06:47
45000 -- [-1397.081] (-1402.647) (-1414.037) (-1419.031) * (-1401.681) (-1401.495) [-1400.456] (-1411.442) -- 0:06:43
Average standard deviation of split frequencies: 0.029605
45500 -- (-1426.552) [-1402.000] (-1408.284) (-1410.998) * (-1411.165) [-1397.375] (-1418.262) (-1420.550) -- 0:06:38
46000 -- (-1406.952) [-1397.296] (-1407.470) (-1420.489) * (-1408.333) (-1400.755) [-1399.850] (-1413.093) -- 0:06:34
46500 -- [-1408.322] (-1396.726) (-1416.844) (-1414.086) * (-1402.199) [-1404.400] (-1411.064) (-1413.491) -- 0:06:50
47000 -- (-1402.415) (-1406.921) [-1400.349] (-1414.848) * (-1416.160) (-1405.958) (-1421.436) [-1403.317] -- 0:06:45
47500 -- (-1403.836) (-1408.772) (-1407.457) [-1407.681] * [-1405.714] (-1405.730) (-1418.405) (-1411.196) -- 0:06:41
48000 -- [-1403.089] (-1413.126) (-1411.741) (-1396.401) * [-1397.423] (-1412.791) (-1403.585) (-1403.300) -- 0:06:36
48500 -- (-1407.069) [-1408.674] (-1415.133) (-1413.824) * (-1407.903) (-1411.203) [-1402.016] (-1404.966) -- 0:06:32
49000 -- (-1412.188) (-1408.043) [-1407.686] (-1420.632) * (-1402.566) (-1406.437) (-1414.786) [-1407.638] -- 0:06:47
49500 -- (-1407.981) (-1398.977) [-1413.520] (-1412.115) * (-1403.285) (-1410.747) [-1405.934] (-1403.002) -- 0:06:43
50000 -- (-1419.996) (-1406.725) (-1407.252) [-1397.639] * (-1413.289) [-1401.728] (-1411.112) (-1418.040) -- 0:06:39
Average standard deviation of split frequencies: 0.025176
50500 -- (-1407.715) (-1418.533) [-1407.368] (-1412.063) * (-1422.767) (-1410.012) [-1402.483] (-1412.611) -- 0:06:34
51000 -- (-1409.014) [-1397.026] (-1404.923) (-1404.881) * (-1409.726) (-1407.794) (-1405.310) [-1407.006] -- 0:06:30
51500 -- (-1407.479) [-1404.767] (-1425.176) (-1402.379) * (-1403.919) (-1413.339) (-1424.378) [-1406.193] -- 0:06:45
52000 -- (-1414.811) [-1410.500] (-1413.178) (-1411.080) * [-1405.679] (-1400.604) (-1405.782) (-1407.769) -- 0:06:41
52500 -- (-1410.865) [-1409.015] (-1414.232) (-1401.068) * (-1420.013) (-1403.224) [-1401.076] (-1413.886) -- 0:06:37
53000 -- (-1408.236) (-1401.067) (-1414.516) [-1418.306] * [-1400.339] (-1412.152) (-1399.720) (-1406.050) -- 0:06:33
53500 -- (-1408.445) (-1403.469) (-1400.190) [-1403.046] * (-1405.939) [-1403.793] (-1399.202) (-1409.578) -- 0:06:29
54000 -- (-1408.226) [-1409.976] (-1402.017) (-1401.372) * (-1400.291) (-1406.835) (-1415.644) [-1403.014] -- 0:06:42
54500 -- (-1405.649) (-1407.278) [-1404.491] (-1407.118) * [-1408.517] (-1414.258) (-1405.208) (-1410.118) -- 0:06:39
55000 -- (-1411.809) (-1415.639) (-1424.981) [-1410.220] * [-1398.384] (-1402.508) (-1413.295) (-1407.540) -- 0:06:35
Average standard deviation of split frequencies: 0.029215
55500 -- (-1419.486) [-1402.580] (-1406.692) (-1406.126) * (-1405.383) (-1406.117) [-1404.631] (-1416.166) -- 0:06:31
56000 -- (-1418.529) (-1405.092) (-1409.698) [-1406.208] * (-1411.558) [-1399.003] (-1403.874) (-1413.544) -- 0:06:27
56500 -- (-1419.935) [-1411.790] (-1413.036) (-1401.171) * (-1416.467) (-1404.998) [-1401.500] (-1409.724) -- 0:06:24
57000 -- (-1416.045) (-1406.038) (-1408.829) [-1409.618] * [-1406.548] (-1405.323) (-1409.188) (-1417.113) -- 0:06:37
57500 -- [-1413.017] (-1419.080) (-1405.977) (-1411.926) * (-1405.738) [-1413.324] (-1410.065) (-1412.812) -- 0:06:33
58000 -- (-1411.626) (-1402.612) [-1411.431] (-1403.688) * (-1410.433) (-1408.683) (-1412.835) [-1413.313] -- 0:06:29
58500 -- (-1401.673) (-1406.025) [-1409.425] (-1401.571) * [-1404.929] (-1402.205) (-1412.499) (-1417.882) -- 0:06:26
59000 -- (-1415.482) [-1402.584] (-1420.251) (-1403.389) * [-1393.015] (-1407.603) (-1407.003) (-1404.059) -- 0:06:22
59500 -- (-1406.068) (-1402.874) [-1408.220] (-1404.864) * (-1400.800) [-1403.353] (-1414.908) (-1403.498) -- 0:06:35
60000 -- (-1410.732) [-1405.580] (-1405.036) (-1403.449) * (-1399.617) [-1404.564] (-1426.882) (-1405.326) -- 0:06:31
Average standard deviation of split frequencies: 0.037024
60500 -- (-1406.332) (-1412.003) (-1405.350) [-1400.965] * [-1402.990] (-1402.778) (-1405.238) (-1418.560) -- 0:06:28
61000 -- [-1402.006] (-1408.484) (-1410.359) (-1402.633) * [-1412.258] (-1414.187) (-1401.524) (-1410.063) -- 0:06:24
61500 -- (-1411.967) (-1405.090) [-1406.452] (-1414.408) * (-1409.441) [-1399.678] (-1413.340) (-1396.852) -- 0:06:21
62000 -- (-1407.337) [-1405.831] (-1407.328) (-1407.679) * [-1397.283] (-1407.930) (-1404.010) (-1406.426) -- 0:06:33
62500 -- (-1413.354) [-1403.522] (-1414.786) (-1409.815) * (-1405.950) (-1403.500) (-1407.540) [-1409.910] -- 0:06:30
63000 -- [-1400.246] (-1409.385) (-1406.073) (-1415.094) * [-1404.535] (-1406.806) (-1409.217) (-1398.742) -- 0:06:26
63500 -- (-1395.240) (-1406.192) [-1396.650] (-1410.579) * [-1408.415] (-1416.794) (-1407.118) (-1409.545) -- 0:06:23
64000 -- (-1412.013) (-1411.303) (-1415.906) [-1394.595] * (-1405.930) (-1416.621) [-1409.797] (-1406.354) -- 0:06:20
64500 -- (-1407.223) (-1408.022) (-1401.600) [-1402.337] * (-1407.515) (-1404.612) (-1412.722) [-1407.416] -- 0:06:31
65000 -- (-1423.482) (-1403.109) [-1402.708] (-1411.399) * (-1408.872) (-1403.046) [-1409.557] (-1415.916) -- 0:06:28
Average standard deviation of split frequencies: 0.029410
65500 -- (-1405.127) [-1404.759] (-1410.297) (-1401.814) * [-1412.276] (-1404.289) (-1412.722) (-1412.098) -- 0:06:25
66000 -- [-1406.826] (-1407.406) (-1411.623) (-1404.928) * (-1407.472) (-1410.581) [-1411.503] (-1415.600) -- 0:06:22
66500 -- (-1401.170) [-1402.978] (-1410.802) (-1405.761) * (-1418.812) (-1406.898) [-1407.846] (-1404.365) -- 0:06:19
67000 -- (-1410.545) (-1416.289) (-1408.286) [-1409.418] * (-1401.141) (-1400.027) [-1401.747] (-1398.547) -- 0:06:29
67500 -- [-1401.480] (-1411.225) (-1415.638) (-1405.468) * (-1413.246) [-1406.636] (-1409.901) (-1400.018) -- 0:06:26
68000 -- [-1401.058] (-1412.902) (-1409.143) (-1399.252) * (-1424.060) (-1403.702) (-1403.889) [-1405.079] -- 0:06:23
68500 -- (-1405.272) (-1408.217) [-1412.167] (-1399.851) * (-1407.678) (-1412.541) [-1409.127] (-1402.918) -- 0:06:20
69000 -- (-1401.536) (-1410.317) [-1409.589] (-1412.613) * (-1417.863) (-1414.568) [-1403.349] (-1401.631) -- 0:06:17
69500 -- (-1398.445) [-1402.900] (-1402.451) (-1427.069) * (-1405.341) (-1413.271) [-1402.880] (-1405.221) -- 0:06:28
70000 -- [-1403.122] (-1399.535) (-1409.031) (-1418.554) * (-1411.574) (-1414.882) [-1409.986] (-1403.411) -- 0:06:25
Average standard deviation of split frequencies: 0.030194
70500 -- (-1399.478) [-1407.476] (-1405.500) (-1436.113) * [-1415.027] (-1424.692) (-1412.693) (-1400.110) -- 0:06:22
71000 -- (-1415.077) [-1405.931] (-1405.638) (-1407.284) * [-1400.939] (-1406.842) (-1411.530) (-1408.063) -- 0:06:19
71500 -- (-1402.272) (-1403.701) [-1406.507] (-1405.163) * [-1403.197] (-1406.496) (-1405.608) (-1404.289) -- 0:06:16
72000 -- [-1406.868] (-1405.698) (-1395.713) (-1409.057) * (-1401.719) (-1418.236) (-1408.837) [-1403.328] -- 0:06:26
72500 -- (-1396.640) [-1401.164] (-1403.111) (-1416.929) * (-1409.951) (-1410.298) [-1410.126] (-1403.266) -- 0:06:23
73000 -- (-1412.585) [-1409.791] (-1407.737) (-1422.665) * [-1394.844] (-1396.393) (-1398.797) (-1400.319) -- 0:06:20
73500 -- (-1405.808) (-1407.357) [-1409.254] (-1405.476) * (-1404.703) [-1403.878] (-1414.900) (-1408.362) -- 0:06:18
74000 -- (-1409.541) (-1403.419) (-1410.551) [-1401.506] * (-1413.930) (-1406.639) (-1408.786) [-1398.461] -- 0:06:15
74500 -- [-1396.910] (-1415.659) (-1401.631) (-1399.049) * (-1405.619) [-1402.865] (-1404.057) (-1409.045) -- 0:06:25
75000 -- [-1402.415] (-1414.346) (-1411.594) (-1409.153) * (-1411.994) (-1417.187) [-1405.889] (-1411.511) -- 0:06:22
Average standard deviation of split frequencies: 0.031666
75500 -- (-1406.192) (-1403.777) (-1405.357) [-1399.733] * (-1413.221) [-1420.262] (-1404.599) (-1413.542) -- 0:06:19
76000 -- [-1399.070] (-1395.451) (-1406.988) (-1413.536) * (-1413.175) (-1416.749) (-1402.029) [-1407.143] -- 0:06:16
76500 -- (-1419.676) [-1403.543] (-1415.508) (-1412.558) * [-1403.734] (-1405.309) (-1418.394) (-1419.882) -- 0:06:14
77000 -- (-1403.299) (-1410.312) (-1403.248) [-1404.997] * [-1407.049] (-1414.171) (-1405.857) (-1427.671) -- 0:06:23
77500 -- (-1412.267) [-1404.906] (-1409.857) (-1410.317) * (-1409.299) (-1405.454) [-1408.015] (-1408.889) -- 0:06:20
78000 -- (-1407.256) (-1416.315) (-1400.702) [-1405.785] * [-1407.082] (-1404.447) (-1400.167) (-1415.969) -- 0:06:18
78500 -- (-1412.471) [-1409.616] (-1408.262) (-1411.523) * [-1412.490] (-1411.652) (-1406.138) (-1413.049) -- 0:06:15
79000 -- (-1410.031) (-1405.744) (-1415.977) [-1407.265] * (-1415.716) (-1399.944) [-1403.491] (-1408.849) -- 0:06:13
79500 -- (-1404.749) [-1408.170] (-1413.881) (-1408.480) * (-1412.452) (-1408.955) (-1417.023) [-1410.014] -- 0:06:22
80000 -- [-1409.872] (-1410.909) (-1412.291) (-1412.122) * (-1422.705) (-1400.375) (-1424.584) [-1405.422] -- 0:06:19
Average standard deviation of split frequencies: 0.029869
80500 -- (-1412.607) (-1404.985) (-1412.563) [-1404.617] * (-1394.504) [-1396.167] (-1411.894) (-1409.107) -- 0:06:16
81000 -- (-1419.141) [-1398.856] (-1403.214) (-1416.804) * (-1404.721) (-1402.525) [-1408.818] (-1414.895) -- 0:06:14
81500 -- (-1413.974) (-1402.219) [-1406.181] (-1413.596) * (-1412.650) (-1408.006) [-1411.122] (-1411.576) -- 0:06:11
82000 -- (-1420.298) (-1406.563) [-1406.828] (-1413.181) * (-1415.566) [-1405.498] (-1420.582) (-1398.789) -- 0:06:20
82500 -- (-1408.565) [-1402.916] (-1407.773) (-1417.694) * (-1406.135) (-1407.729) [-1409.676] (-1411.990) -- 0:06:18
83000 -- (-1410.480) (-1407.142) [-1400.729] (-1398.811) * [-1407.024] (-1409.731) (-1403.585) (-1408.453) -- 0:06:15
83500 -- (-1412.418) [-1398.843] (-1403.843) (-1408.422) * (-1405.428) [-1406.425] (-1406.275) (-1401.916) -- 0:06:13
84000 -- (-1409.421) (-1404.554) (-1413.740) [-1406.388] * (-1409.619) (-1404.032) [-1401.766] (-1410.644) -- 0:06:10
84500 -- (-1411.656) [-1404.118] (-1409.223) (-1420.567) * (-1403.306) (-1413.058) [-1407.618] (-1409.745) -- 0:06:19
85000 -- (-1417.839) (-1413.529) (-1419.942) [-1398.937] * [-1414.605] (-1413.844) (-1407.391) (-1412.451) -- 0:06:16
Average standard deviation of split frequencies: 0.028016
85500 -- (-1412.016) [-1402.852] (-1415.540) (-1403.994) * [-1413.722] (-1412.977) (-1415.589) (-1412.420) -- 0:06:14
86000 -- [-1409.314] (-1402.830) (-1414.821) (-1409.028) * (-1406.514) (-1406.185) [-1399.672] (-1414.104) -- 0:06:11
86500 -- [-1405.494] (-1407.997) (-1406.382) (-1404.225) * (-1403.994) [-1399.737] (-1409.976) (-1402.413) -- 0:06:09
87000 -- (-1403.161) (-1398.731) (-1420.701) [-1397.374] * (-1413.312) [-1395.623] (-1405.672) (-1402.176) -- 0:06:17
87500 -- (-1408.915) (-1399.600) (-1421.002) [-1397.942] * [-1406.215] (-1408.618) (-1407.847) (-1435.032) -- 0:06:15
88000 -- (-1401.182) (-1402.450) (-1413.907) [-1412.836] * (-1405.785) (-1407.995) (-1410.924) [-1398.024] -- 0:06:13
88500 -- (-1414.793) (-1395.616) (-1406.590) [-1407.739] * (-1409.689) [-1403.472] (-1406.765) (-1407.770) -- 0:06:10
89000 -- [-1397.187] (-1399.526) (-1413.897) (-1412.699) * (-1414.191) (-1403.429) (-1420.915) [-1402.818] -- 0:06:08
89500 -- (-1405.552) (-1408.352) (-1412.756) [-1409.401] * (-1407.661) [-1402.698] (-1412.847) (-1411.315) -- 0:06:16
90000 -- (-1411.715) (-1408.729) (-1405.068) [-1401.649] * (-1403.375) (-1404.321) (-1399.514) [-1397.264] -- 0:06:14
Average standard deviation of split frequencies: 0.029174
90500 -- (-1410.275) (-1407.668) [-1405.619] (-1402.555) * (-1406.297) (-1413.274) [-1397.639] (-1405.195) -- 0:06:11
91000 -- (-1404.761) (-1410.202) [-1405.247] (-1406.538) * (-1403.963) (-1404.530) [-1401.534] (-1400.615) -- 0:06:09
91500 -- (-1401.774) [-1401.921] (-1399.216) (-1408.536) * (-1409.117) (-1410.516) (-1409.957) [-1400.938] -- 0:06:07
92000 -- (-1410.884) (-1419.950) [-1408.928] (-1411.148) * (-1406.599) (-1417.553) (-1413.271) [-1395.353] -- 0:06:15
92500 -- [-1404.727] (-1404.001) (-1411.760) (-1409.502) * (-1416.338) (-1413.608) (-1403.944) [-1398.944] -- 0:06:12
93000 -- (-1408.592) (-1414.882) (-1410.255) [-1407.315] * (-1412.097) (-1405.784) [-1404.728] (-1397.871) -- 0:06:10
93500 -- (-1411.796) (-1407.244) [-1400.314] (-1413.616) * (-1409.653) [-1404.163] (-1412.858) (-1407.969) -- 0:06:08
94000 -- (-1410.257) (-1417.909) [-1397.181] (-1406.200) * (-1398.928) [-1398.330] (-1407.944) (-1395.023) -- 0:06:06
94500 -- (-1405.695) (-1410.786) [-1400.983] (-1409.030) * [-1396.226] (-1409.847) (-1416.640) (-1407.665) -- 0:06:13
95000 -- (-1413.479) (-1411.745) (-1418.823) [-1406.436] * (-1402.815) (-1411.915) [-1405.027] (-1400.929) -- 0:06:11
Average standard deviation of split frequencies: 0.030281
95500 -- (-1416.688) (-1418.032) [-1400.426] (-1412.035) * [-1403.912] (-1414.814) (-1408.238) (-1415.963) -- 0:06:09
96000 -- (-1409.470) (-1406.629) [-1401.797] (-1412.165) * [-1410.787] (-1408.994) (-1422.781) (-1418.539) -- 0:06:07
96500 -- (-1409.567) (-1406.428) (-1419.156) [-1406.765] * (-1412.460) (-1415.974) (-1405.498) [-1409.554] -- 0:06:05
97000 -- (-1419.305) (-1405.733) [-1399.083] (-1401.646) * (-1416.443) (-1421.269) [-1411.063] (-1407.800) -- 0:06:03
97500 -- (-1398.480) [-1414.843] (-1401.954) (-1424.713) * (-1423.453) (-1425.074) [-1404.342] (-1397.927) -- 0:06:10
98000 -- (-1411.951) [-1408.775] (-1404.505) (-1412.531) * (-1408.639) (-1407.179) [-1407.522] (-1412.011) -- 0:06:08
98500 -- (-1421.792) (-1420.328) (-1401.856) [-1409.411] * [-1401.261] (-1416.360) (-1404.032) (-1403.359) -- 0:06:06
99000 -- [-1409.239] (-1418.877) (-1399.957) (-1407.855) * (-1405.897) [-1408.924] (-1407.666) (-1404.433) -- 0:06:04
99500 -- (-1406.968) (-1408.740) [-1406.009] (-1410.394) * (-1408.319) (-1406.021) [-1401.424] (-1406.549) -- 0:06:02
100000 -- (-1404.890) (-1419.491) (-1407.552) [-1400.362] * [-1403.027] (-1403.584) (-1407.725) (-1405.873) -- 0:06:09
Average standard deviation of split frequencies: 0.031739
100500 -- [-1399.048] (-1412.378) (-1403.254) (-1403.046) * (-1397.236) [-1400.149] (-1402.861) (-1409.622) -- 0:06:06
101000 -- (-1404.219) (-1407.999) [-1405.094] (-1412.165) * (-1408.218) (-1409.297) (-1412.708) [-1399.903] -- 0:06:04
101500 -- (-1410.464) (-1404.212) (-1400.289) [-1401.881] * (-1409.624) (-1407.863) [-1412.964] (-1404.770) -- 0:06:02
102000 -- (-1409.934) (-1406.520) [-1400.383] (-1402.816) * (-1402.743) (-1415.976) (-1415.285) [-1405.521] -- 0:06:00
102500 -- (-1398.329) (-1400.445) [-1411.402] (-1420.455) * [-1396.077] (-1408.271) (-1414.541) (-1402.082) -- 0:06:07
103000 -- [-1397.786] (-1415.620) (-1404.322) (-1411.835) * [-1406.485] (-1405.265) (-1409.545) (-1411.571) -- 0:06:05
103500 -- (-1407.435) (-1408.373) [-1396.811] (-1409.224) * (-1402.231) [-1403.816] (-1411.880) (-1412.772) -- 0:06:03
104000 -- (-1424.925) (-1403.367) [-1400.726] (-1405.755) * [-1404.692] (-1418.880) (-1422.457) (-1414.037) -- 0:06:01
104500 -- (-1408.339) (-1417.864) [-1399.601] (-1410.002) * (-1402.722) (-1418.949) [-1408.928] (-1410.224) -- 0:05:59
105000 -- (-1402.676) (-1407.805) (-1407.876) [-1402.905] * (-1427.654) [-1415.738] (-1415.704) (-1409.437) -- 0:06:06
Average standard deviation of split frequencies: 0.033354
105500 -- (-1407.001) (-1416.391) [-1406.336] (-1423.406) * [-1403.103] (-1408.846) (-1417.674) (-1409.113) -- 0:06:04
106000 -- (-1408.695) (-1408.519) [-1398.600] (-1402.963) * (-1411.429) (-1402.853) [-1403.012] (-1405.013) -- 0:06:02
106500 -- (-1405.438) [-1401.643] (-1401.518) (-1418.185) * [-1399.570] (-1403.415) (-1400.786) (-1414.338) -- 0:06:00
107000 -- (-1411.448) [-1402.321] (-1398.938) (-1413.658) * (-1409.223) (-1403.019) (-1412.001) [-1400.092] -- 0:05:58
107500 -- [-1404.138] (-1396.010) (-1396.238) (-1415.327) * (-1409.224) (-1418.503) (-1403.400) [-1402.285] -- 0:06:05
108000 -- (-1411.107) (-1410.795) (-1400.904) [-1400.873] * (-1415.899) (-1415.135) (-1409.509) [-1405.297] -- 0:06:03
108500 -- (-1409.118) (-1421.056) [-1402.462] (-1411.347) * (-1410.246) [-1403.823] (-1400.395) (-1398.861) -- 0:06:01
109000 -- (-1415.000) (-1417.851) [-1400.841] (-1411.576) * (-1397.197) [-1397.427] (-1407.447) (-1414.649) -- 0:05:59
109500 -- [-1401.285] (-1405.199) (-1408.602) (-1413.373) * [-1400.215] (-1405.958) (-1420.087) (-1413.877) -- 0:05:57
110000 -- [-1402.033] (-1408.660) (-1404.826) (-1409.374) * (-1402.499) (-1408.379) [-1408.091] (-1407.374) -- 0:06:04
Average standard deviation of split frequencies: 0.033841
110500 -- (-1409.641) (-1409.307) [-1408.200] (-1403.978) * (-1409.318) [-1401.856] (-1411.031) (-1412.379) -- 0:06:02
111000 -- (-1412.578) [-1399.402] (-1402.048) (-1410.238) * (-1418.292) (-1402.394) (-1419.426) [-1409.710] -- 0:06:00
111500 -- (-1405.000) (-1406.177) (-1404.047) [-1412.300] * (-1403.544) (-1404.559) [-1417.602] (-1418.686) -- 0:05:58
112000 -- (-1399.102) [-1402.144] (-1411.084) (-1404.488) * (-1410.176) [-1400.679] (-1405.732) (-1411.307) -- 0:05:56
112500 -- (-1401.681) (-1395.044) (-1399.390) [-1403.332] * (-1404.450) (-1409.013) [-1404.113] (-1414.824) -- 0:06:02
113000 -- (-1407.567) (-1406.737) (-1406.199) [-1401.263] * [-1395.941] (-1404.946) (-1412.631) (-1410.260) -- 0:06:01
113500 -- (-1400.567) [-1407.250] (-1408.871) (-1410.104) * (-1402.059) (-1411.579) (-1408.862) [-1394.868] -- 0:05:59
114000 -- (-1410.448) (-1409.405) [-1401.722] (-1421.201) * (-1402.468) (-1407.296) (-1404.927) [-1399.083] -- 0:05:57
114500 -- (-1402.384) (-1424.377) [-1398.910] (-1403.791) * (-1411.236) (-1403.080) (-1412.041) [-1404.194] -- 0:05:55
115000 -- [-1403.412] (-1402.167) (-1402.563) (-1414.880) * (-1401.464) (-1411.355) [-1398.170] (-1420.725) -- 0:06:01
Average standard deviation of split frequencies: 0.029350
115500 -- [-1416.758] (-1402.643) (-1407.713) (-1417.599) * [-1402.506] (-1397.370) (-1419.574) (-1404.148) -- 0:05:59
116000 -- (-1413.243) (-1405.043) (-1394.066) [-1412.282] * (-1417.494) [-1400.380] (-1416.852) (-1415.325) -- 0:05:58
116500 -- (-1408.890) (-1405.269) [-1412.277] (-1406.013) * (-1416.494) (-1399.027) (-1406.147) [-1399.789] -- 0:05:56
117000 -- (-1414.269) (-1410.741) [-1414.262] (-1401.163) * (-1411.761) (-1413.865) (-1411.274) [-1404.484] -- 0:05:54
117500 -- [-1406.289] (-1402.035) (-1407.581) (-1399.436) * [-1395.030] (-1414.466) (-1410.779) (-1415.332) -- 0:06:00
118000 -- (-1409.827) (-1413.261) (-1404.336) [-1402.268] * (-1402.709) (-1410.238) (-1409.915) [-1412.233] -- 0:05:58
118500 -- (-1424.751) (-1405.549) [-1400.351] (-1402.293) * [-1405.041] (-1411.272) (-1412.410) (-1432.774) -- 0:05:57
119000 -- (-1427.674) [-1415.673] (-1403.278) (-1401.788) * [-1407.689] (-1404.622) (-1401.839) (-1408.260) -- 0:05:55
119500 -- (-1409.883) (-1406.926) (-1404.407) [-1399.373] * (-1413.721) (-1403.603) [-1402.763] (-1411.175) -- 0:05:53
120000 -- [-1402.129] (-1409.395) (-1401.219) (-1399.777) * (-1410.985) (-1410.042) (-1404.877) [-1408.990] -- 0:05:59
Average standard deviation of split frequencies: 0.029517
120500 -- (-1408.719) (-1412.811) [-1397.079] (-1407.051) * (-1405.791) (-1404.132) (-1406.405) [-1408.671] -- 0:05:57
121000 -- [-1408.500] (-1410.152) (-1407.079) (-1403.788) * (-1412.552) (-1408.710) [-1405.746] (-1409.145) -- 0:05:55
121500 -- (-1395.922) [-1409.171] (-1402.951) (-1415.370) * [-1412.087] (-1405.955) (-1408.591) (-1405.859) -- 0:05:54
122000 -- [-1404.744] (-1406.952) (-1401.317) (-1407.894) * (-1416.243) [-1408.342] (-1409.840) (-1417.598) -- 0:05:52
122500 -- (-1403.515) (-1404.236) (-1407.620) [-1404.605] * (-1404.627) [-1409.073] (-1409.345) (-1416.820) -- 0:05:58
123000 -- (-1400.836) (-1413.470) (-1416.931) [-1403.800] * [-1404.290] (-1412.308) (-1418.170) (-1402.645) -- 0:05:56
123500 -- [-1408.850] (-1414.141) (-1411.132) (-1407.683) * (-1404.197) (-1414.521) (-1409.803) [-1407.046] -- 0:05:54
124000 -- [-1403.580] (-1413.048) (-1409.563) (-1411.888) * [-1404.808] (-1411.094) (-1412.748) (-1411.393) -- 0:05:53
124500 -- (-1402.651) [-1405.368] (-1409.762) (-1418.464) * (-1417.248) (-1409.435) (-1416.556) [-1402.734] -- 0:05:51
125000 -- [-1410.086] (-1405.772) (-1406.928) (-1414.994) * (-1410.294) (-1427.063) [-1406.929] (-1398.664) -- 0:05:57
Average standard deviation of split frequencies: 0.028475
125500 -- (-1409.374) [-1406.555] (-1418.706) (-1406.412) * (-1415.947) (-1413.986) (-1405.907) [-1403.053] -- 0:05:55
126000 -- (-1408.472) [-1402.183] (-1410.489) (-1411.041) * (-1418.775) (-1419.197) [-1409.034] (-1397.082) -- 0:05:53
126500 -- (-1403.481) (-1407.427) (-1409.498) [-1402.047] * (-1414.571) [-1410.049] (-1406.456) (-1397.313) -- 0:05:52
127000 -- (-1404.426) [-1400.692] (-1419.593) (-1406.664) * (-1406.106) [-1405.999] (-1414.302) (-1411.591) -- 0:05:50
127500 -- (-1404.082) (-1403.882) [-1407.360] (-1420.686) * (-1417.511) (-1404.473) [-1413.145] (-1396.243) -- 0:05:55
128000 -- [-1399.090] (-1407.719) (-1407.532) (-1409.525) * (-1416.675) (-1410.165) [-1406.307] (-1404.683) -- 0:05:54
128500 -- (-1400.843) [-1404.235] (-1422.059) (-1405.751) * (-1431.037) (-1402.989) (-1415.410) [-1403.264] -- 0:05:52
129000 -- (-1412.034) [-1410.528] (-1423.284) (-1413.630) * (-1420.504) (-1403.711) (-1406.739) [-1407.446] -- 0:05:51
129500 -- [-1413.461] (-1404.033) (-1423.614) (-1407.627) * (-1419.017) [-1404.041] (-1412.936) (-1411.065) -- 0:05:49
130000 -- [-1403.647] (-1402.856) (-1422.741) (-1406.205) * [-1415.004] (-1399.513) (-1413.623) (-1416.391) -- 0:05:48
Average standard deviation of split frequencies: 0.025655
130500 -- (-1407.904) (-1408.562) [-1404.842] (-1403.731) * [-1402.863] (-1402.768) (-1407.685) (-1413.031) -- 0:05:53
131000 -- (-1411.450) (-1399.445) (-1410.116) [-1398.930] * (-1406.247) [-1399.679] (-1409.796) (-1412.824) -- 0:05:51
131500 -- (-1410.474) (-1399.187) (-1402.036) [-1406.229] * (-1406.228) (-1402.302) (-1402.796) [-1406.674] -- 0:05:50
132000 -- (-1404.720) (-1406.160) (-1409.135) [-1405.813] * [-1403.330] (-1401.956) (-1412.916) (-1402.382) -- 0:05:48
132500 -- [-1397.155] (-1402.395) (-1403.094) (-1409.827) * (-1406.987) [-1409.691] (-1403.221) (-1404.484) -- 0:05:47
133000 -- (-1409.598) [-1404.885] (-1405.393) (-1417.533) * (-1407.534) [-1403.190] (-1409.824) (-1410.980) -- 0:05:52
133500 -- (-1403.713) [-1404.338] (-1412.860) (-1409.689) * [-1400.899] (-1406.812) (-1417.770) (-1411.651) -- 0:05:50
134000 -- [-1407.378] (-1410.525) (-1407.696) (-1412.687) * (-1404.765) [-1409.639] (-1415.635) (-1408.736) -- 0:05:48
134500 -- [-1401.066] (-1411.720) (-1417.092) (-1409.016) * [-1403.170] (-1408.873) (-1402.967) (-1405.804) -- 0:05:47
135000 -- (-1406.211) (-1412.519) [-1403.471] (-1414.736) * [-1411.369] (-1410.540) (-1398.599) (-1413.545) -- 0:05:46
Average standard deviation of split frequencies: 0.026959
135500 -- [-1412.804] (-1403.289) (-1414.392) (-1412.677) * (-1411.623) (-1407.194) [-1407.697] (-1416.717) -- 0:05:50
136000 -- (-1415.204) (-1403.853) (-1422.295) [-1403.983] * (-1409.594) (-1408.456) [-1408.289] (-1400.815) -- 0:05:49
136500 -- (-1403.230) (-1409.855) (-1418.582) [-1413.897] * (-1411.705) (-1405.823) [-1417.360] (-1404.131) -- 0:05:47
137000 -- [-1406.156] (-1415.905) (-1398.921) (-1404.904) * (-1407.664) (-1398.455) (-1420.750) [-1399.484] -- 0:05:46
137500 -- (-1410.809) (-1405.324) [-1393.145] (-1406.603) * (-1413.960) (-1405.079) [-1402.687] (-1402.989) -- 0:05:45
138000 -- (-1397.736) [-1402.752] (-1406.376) (-1418.179) * [-1407.302] (-1412.801) (-1411.580) (-1413.299) -- 0:05:49
138500 -- (-1400.671) (-1405.876) [-1410.357] (-1412.084) * (-1406.499) (-1410.940) (-1408.258) [-1403.460] -- 0:05:48
139000 -- (-1407.466) (-1400.705) (-1420.014) [-1407.993] * (-1416.337) [-1399.401] (-1415.173) (-1408.037) -- 0:05:46
139500 -- (-1414.558) (-1404.160) [-1400.489] (-1406.624) * [-1405.758] (-1406.560) (-1415.845) (-1413.443) -- 0:05:45
140000 -- (-1401.285) (-1408.219) [-1404.282] (-1409.037) * [-1402.222] (-1408.271) (-1409.787) (-1409.576) -- 0:05:44
Average standard deviation of split frequencies: 0.026624
140500 -- (-1414.016) (-1405.391) [-1396.539] (-1408.449) * (-1403.127) (-1411.326) [-1408.298] (-1398.835) -- 0:05:48
141000 -- (-1403.207) (-1407.496) [-1399.457] (-1405.223) * (-1403.006) (-1414.889) (-1416.387) [-1405.273] -- 0:05:47
141500 -- (-1411.906) (-1408.741) (-1411.538) [-1399.984] * (-1397.692) [-1408.175] (-1412.754) (-1407.325) -- 0:05:45
142000 -- [-1402.329] (-1396.188) (-1409.848) (-1419.382) * [-1400.129] (-1400.168) (-1405.325) (-1411.397) -- 0:05:44
142500 -- (-1410.629) [-1400.037] (-1410.551) (-1396.969) * (-1416.297) (-1405.387) (-1394.070) [-1400.466] -- 0:05:43
143000 -- (-1404.875) [-1400.131] (-1402.633) (-1412.527) * (-1414.122) [-1407.585] (-1406.712) (-1408.200) -- 0:05:47
143500 -- (-1404.175) (-1412.015) [-1397.223] (-1412.441) * [-1406.058] (-1408.351) (-1407.395) (-1418.320) -- 0:05:46
144000 -- (-1402.517) (-1406.081) (-1407.819) [-1401.007] * [-1403.154] (-1408.468) (-1405.625) (-1413.402) -- 0:05:44
144500 -- (-1403.643) (-1415.128) (-1408.470) [-1399.113] * [-1403.109] (-1428.329) (-1406.210) (-1408.767) -- 0:05:43
145000 -- [-1401.482] (-1409.394) (-1401.158) (-1406.963) * [-1401.032] (-1419.666) (-1409.720) (-1406.475) -- 0:05:42
Average standard deviation of split frequencies: 0.025830
145500 -- (-1405.300) (-1411.981) [-1398.608] (-1414.735) * (-1402.363) [-1403.775] (-1418.491) (-1409.335) -- 0:05:46
146000 -- [-1395.536] (-1415.612) (-1404.708) (-1410.830) * (-1420.109) [-1400.286] (-1416.213) (-1411.651) -- 0:05:45
146500 -- (-1410.747) (-1407.425) [-1401.210] (-1412.765) * (-1418.816) (-1406.729) [-1408.466] (-1403.293) -- 0:05:43
147000 -- [-1401.778] (-1409.669) (-1414.573) (-1411.982) * (-1418.855) [-1407.263] (-1417.544) (-1407.608) -- 0:05:42
147500 -- (-1419.058) [-1398.422] (-1418.364) (-1412.098) * (-1414.777) [-1403.818] (-1415.517) (-1414.915) -- 0:05:41
148000 -- (-1409.629) [-1400.572] (-1415.566) (-1407.003) * [-1409.242] (-1408.355) (-1418.800) (-1408.137) -- 0:05:45
148500 -- [-1399.153] (-1413.636) (-1414.170) (-1404.720) * (-1400.195) (-1410.467) [-1419.185] (-1407.140) -- 0:05:44
149000 -- [-1399.653] (-1401.720) (-1414.168) (-1401.637) * [-1401.729] (-1405.503) (-1411.598) (-1407.570) -- 0:05:42
149500 -- (-1416.773) [-1397.226] (-1414.557) (-1404.560) * (-1413.084) (-1399.750) [-1404.115] (-1409.997) -- 0:05:41
150000 -- (-1415.433) (-1404.343) (-1406.420) [-1404.458] * (-1407.204) [-1401.470] (-1403.390) (-1403.293) -- 0:05:40
Average standard deviation of split frequencies: 0.024335
150500 -- (-1417.953) (-1400.715) [-1408.194] (-1412.698) * (-1412.292) (-1400.900) (-1419.475) [-1404.592] -- 0:05:44
151000 -- [-1409.542] (-1401.430) (-1407.342) (-1407.323) * (-1415.121) (-1405.537) [-1408.435] (-1400.704) -- 0:05:42
151500 -- [-1404.965] (-1402.964) (-1412.228) (-1401.017) * (-1400.445) [-1416.683] (-1400.332) (-1405.840) -- 0:05:41
152000 -- (-1413.097) (-1405.764) (-1411.025) [-1406.736] * (-1405.693) (-1409.979) (-1413.766) [-1403.368] -- 0:05:40
152500 -- (-1408.378) [-1397.592] (-1411.270) (-1416.142) * [-1402.600] (-1422.767) (-1413.803) (-1412.302) -- 0:05:39
153000 -- (-1407.117) (-1404.102) [-1397.807] (-1411.665) * [-1402.438] (-1416.152) (-1414.093) (-1402.412) -- 0:05:43
153500 -- (-1421.168) (-1413.207) [-1403.753] (-1405.446) * [-1406.427] (-1416.089) (-1425.823) (-1413.481) -- 0:05:41
154000 -- (-1429.233) (-1398.924) [-1397.344] (-1414.294) * [-1397.987] (-1415.363) (-1415.299) (-1411.185) -- 0:05:40
154500 -- (-1404.354) [-1399.455] (-1405.998) (-1417.331) * (-1402.758) (-1417.438) (-1418.396) [-1400.941] -- 0:05:39
155000 -- (-1400.902) (-1407.833) (-1412.528) [-1402.561] * (-1409.081) (-1414.364) (-1413.265) [-1405.526] -- 0:05:38
Average standard deviation of split frequencies: 0.026357
155500 -- (-1407.170) (-1402.911) [-1399.924] (-1414.947) * (-1412.465) (-1415.074) (-1408.335) [-1406.501] -- 0:05:42
156000 -- (-1409.897) (-1409.594) [-1405.775] (-1404.908) * (-1409.508) (-1410.126) [-1398.840] (-1402.828) -- 0:05:40
156500 -- [-1399.877] (-1421.226) (-1407.605) (-1404.457) * (-1409.725) (-1415.855) [-1404.899] (-1404.443) -- 0:05:39
157000 -- (-1401.337) [-1408.823] (-1411.857) (-1401.672) * (-1406.206) (-1410.010) [-1406.893] (-1409.062) -- 0:05:38
157500 -- (-1411.696) (-1418.002) [-1409.691] (-1415.868) * (-1419.865) [-1403.025] (-1407.385) (-1413.820) -- 0:05:37
158000 -- [-1410.269] (-1429.795) (-1416.914) (-1417.137) * (-1409.546) (-1407.690) [-1405.550] (-1429.599) -- 0:05:41
158500 -- (-1408.894) (-1423.779) [-1404.958] (-1412.910) * (-1413.722) (-1419.349) (-1406.923) [-1409.113] -- 0:05:39
159000 -- (-1407.865) (-1407.660) (-1410.421) [-1413.094] * (-1411.405) [-1403.600] (-1407.313) (-1419.784) -- 0:05:38
159500 -- [-1411.351] (-1410.102) (-1417.958) (-1413.973) * (-1409.930) (-1407.094) [-1407.863] (-1412.333) -- 0:05:37
160000 -- (-1403.357) [-1407.938] (-1403.630) (-1402.413) * (-1407.782) (-1408.322) [-1399.610] (-1416.321) -- 0:05:36
Average standard deviation of split frequencies: 0.026924
160500 -- [-1400.862] (-1410.622) (-1416.717) (-1401.153) * (-1410.840) (-1400.732) [-1406.017] (-1407.803) -- 0:05:34
161000 -- (-1413.817) (-1400.172) [-1401.664] (-1411.716) * [-1400.079] (-1411.767) (-1404.529) (-1410.067) -- 0:05:38
161500 -- (-1400.846) (-1408.758) (-1405.700) [-1411.291] * (-1405.066) [-1399.937] (-1414.664) (-1402.811) -- 0:05:37
162000 -- [-1399.916] (-1403.656) (-1422.711) (-1409.084) * (-1404.469) [-1397.806] (-1421.057) (-1408.474) -- 0:05:36
162500 -- (-1412.571) (-1409.056) [-1407.470] (-1406.561) * [-1401.897] (-1410.390) (-1399.944) (-1415.158) -- 0:05:35
163000 -- (-1419.573) (-1406.299) (-1412.345) [-1400.517] * (-1407.364) (-1421.116) (-1414.910) [-1407.589] -- 0:05:33
163500 -- (-1415.117) (-1409.792) (-1409.758) [-1399.567] * [-1411.460] (-1415.708) (-1408.964) (-1422.561) -- 0:05:37
164000 -- (-1411.558) [-1405.998] (-1420.592) (-1405.449) * [-1406.781] (-1423.168) (-1411.348) (-1417.642) -- 0:05:36
164500 -- (-1409.292) [-1398.861] (-1407.343) (-1396.275) * [-1398.801] (-1411.215) (-1417.945) (-1401.321) -- 0:05:35
165000 -- (-1414.820) [-1396.321] (-1419.392) (-1403.884) * (-1412.905) [-1395.843] (-1413.974) (-1399.428) -- 0:05:34
Average standard deviation of split frequencies: 0.025224
165500 -- (-1413.528) [-1403.858] (-1412.065) (-1415.591) * [-1399.728] (-1406.099) (-1404.621) (-1406.684) -- 0:05:32
166000 -- (-1411.618) [-1396.108] (-1422.898) (-1412.520) * (-1403.839) (-1415.086) [-1404.526] (-1409.194) -- 0:05:36
166500 -- (-1408.891) (-1407.368) (-1414.198) [-1404.898] * [-1410.916] (-1406.180) (-1418.582) (-1416.480) -- 0:05:35
167000 -- (-1406.551) (-1417.521) (-1409.420) [-1408.459] * (-1416.367) (-1404.939) [-1410.116] (-1408.813) -- 0:05:34
167500 -- (-1409.484) (-1410.533) [-1406.269] (-1399.995) * (-1405.962) (-1406.895) [-1409.306] (-1415.599) -- 0:05:33
168000 -- (-1414.467) (-1408.767) [-1404.894] (-1414.530) * [-1398.733] (-1396.629) (-1409.905) (-1404.484) -- 0:05:31
168500 -- [-1399.052] (-1411.036) (-1420.018) (-1406.967) * [-1405.372] (-1415.649) (-1413.007) (-1410.083) -- 0:05:35
169000 -- [-1397.054] (-1409.100) (-1404.041) (-1406.275) * [-1398.237] (-1413.022) (-1410.202) (-1412.365) -- 0:05:34
169500 -- (-1403.614) (-1407.023) [-1416.308] (-1405.996) * (-1404.965) (-1419.663) [-1399.549] (-1418.983) -- 0:05:33
170000 -- (-1405.395) [-1404.548] (-1406.333) (-1404.140) * (-1398.572) (-1412.827) (-1409.394) [-1407.921] -- 0:05:32
Average standard deviation of split frequencies: 0.024047
170500 -- (-1410.842) (-1403.438) [-1402.554] (-1413.229) * (-1415.360) (-1409.318) [-1401.715] (-1408.081) -- 0:05:30
171000 -- (-1412.771) [-1408.337] (-1399.139) (-1415.704) * (-1414.293) (-1417.828) (-1409.773) [-1397.951] -- 0:05:34
171500 -- (-1415.329) (-1413.057) [-1398.047] (-1404.881) * (-1405.937) (-1412.216) (-1407.703) [-1403.744] -- 0:05:33
172000 -- (-1403.426) [-1405.709] (-1404.246) (-1404.404) * (-1401.367) [-1405.486] (-1402.508) (-1407.300) -- 0:05:32
172500 -- (-1414.095) (-1401.007) (-1406.397) [-1412.680] * (-1409.280) (-1409.324) (-1401.478) [-1404.128] -- 0:05:31
173000 -- (-1411.657) (-1400.310) [-1404.458] (-1402.670) * (-1413.373) (-1412.869) [-1402.699] (-1420.524) -- 0:05:29
173500 -- (-1405.693) (-1400.937) [-1404.574] (-1415.308) * (-1408.909) (-1418.701) [-1403.829] (-1406.755) -- 0:05:33
174000 -- (-1402.907) (-1403.449) [-1402.533] (-1405.727) * (-1409.072) (-1403.487) [-1405.174] (-1402.883) -- 0:05:32
174500 -- (-1414.328) (-1409.339) [-1404.234] (-1405.313) * (-1409.566) (-1402.883) (-1409.686) [-1403.167] -- 0:05:31
175000 -- [-1404.384] (-1414.366) (-1407.589) (-1408.974) * (-1416.312) (-1399.457) (-1416.007) [-1404.314] -- 0:05:30
Average standard deviation of split frequencies: 0.020797
175500 -- (-1416.885) [-1408.706] (-1404.586) (-1417.711) * [-1399.928] (-1398.154) (-1411.055) (-1416.132) -- 0:05:28
176000 -- (-1406.938) (-1410.643) [-1402.160] (-1418.318) * [-1404.242] (-1407.528) (-1400.198) (-1408.785) -- 0:05:32
176500 -- [-1402.105] (-1416.303) (-1408.393) (-1406.883) * (-1409.020) [-1409.339] (-1412.124) (-1413.549) -- 0:05:31
177000 -- (-1402.463) [-1395.969] (-1412.603) (-1399.507) * [-1399.884] (-1407.435) (-1394.743) (-1418.134) -- 0:05:30
177500 -- (-1414.241) [-1411.093] (-1403.585) (-1421.726) * [-1398.147] (-1402.580) (-1406.586) (-1418.628) -- 0:05:29
178000 -- (-1399.586) (-1406.509) (-1410.351) [-1402.358] * (-1402.333) (-1410.955) (-1403.916) [-1397.037] -- 0:05:27
178500 -- (-1397.252) (-1403.595) (-1410.422) [-1405.896] * [-1407.462] (-1403.583) (-1410.220) (-1410.716) -- 0:05:31
179000 -- (-1399.968) (-1413.203) [-1406.401] (-1415.249) * (-1417.764) [-1406.827] (-1412.521) (-1403.177) -- 0:05:30
179500 -- [-1407.613] (-1416.793) (-1399.768) (-1402.895) * [-1402.344] (-1401.502) (-1408.856) (-1417.689) -- 0:05:29
180000 -- [-1404.043] (-1409.207) (-1410.183) (-1413.743) * (-1408.675) (-1404.456) [-1403.592] (-1428.854) -- 0:05:28
Average standard deviation of split frequencies: 0.019646
180500 -- (-1407.234) [-1403.229] (-1403.923) (-1404.861) * (-1422.632) [-1398.454] (-1411.064) (-1407.258) -- 0:05:26
181000 -- (-1405.711) [-1404.934] (-1402.000) (-1407.069) * (-1417.941) [-1402.422] (-1408.641) (-1412.706) -- 0:05:30
181500 -- [-1403.639] (-1402.511) (-1407.025) (-1409.638) * [-1414.688] (-1414.949) (-1410.003) (-1414.043) -- 0:05:29
182000 -- [-1398.439] (-1402.225) (-1411.935) (-1399.255) * (-1403.437) (-1405.589) [-1404.848] (-1418.223) -- 0:05:28
182500 -- (-1403.467) (-1405.700) [-1403.217] (-1411.033) * [-1398.296] (-1404.776) (-1404.589) (-1404.950) -- 0:05:27
183000 -- (-1400.266) (-1401.074) [-1403.424] (-1410.274) * [-1413.294] (-1399.493) (-1397.543) (-1399.751) -- 0:05:25
183500 -- (-1406.761) (-1405.829) (-1408.837) [-1414.701] * (-1420.389) (-1404.474) [-1397.795] (-1400.677) -- 0:05:29
184000 -- (-1423.534) [-1402.405] (-1420.563) (-1420.353) * (-1412.412) (-1399.055) [-1410.117] (-1406.323) -- 0:05:28
184500 -- (-1413.238) (-1404.077) [-1411.567] (-1416.753) * (-1411.272) [-1414.276] (-1409.746) (-1408.751) -- 0:05:27
185000 -- (-1415.784) [-1411.096] (-1407.569) (-1419.510) * [-1413.438] (-1412.662) (-1407.254) (-1403.918) -- 0:05:26
Average standard deviation of split frequencies: 0.017294
185500 -- [-1401.616] (-1405.215) (-1410.274) (-1405.454) * (-1419.871) [-1405.664] (-1409.109) (-1404.830) -- 0:05:24
186000 -- (-1414.267) [-1401.904] (-1424.060) (-1408.319) * (-1401.898) (-1402.959) [-1407.185] (-1402.888) -- 0:05:28
186500 -- (-1416.026) (-1404.209) (-1415.035) [-1415.545] * (-1407.960) (-1407.202) (-1411.929) [-1417.014] -- 0:05:27
187000 -- [-1410.341] (-1415.189) (-1414.822) (-1406.842) * [-1405.427] (-1401.734) (-1413.628) (-1409.681) -- 0:05:26
187500 -- [-1401.203] (-1398.731) (-1417.980) (-1415.389) * (-1408.233) (-1405.232) (-1412.865) [-1397.267] -- 0:05:25
188000 -- (-1410.257) (-1402.902) (-1417.145) [-1407.155] * (-1411.129) (-1409.366) [-1405.014] (-1413.865) -- 0:05:23
188500 -- (-1412.097) (-1418.005) (-1398.199) [-1407.537] * (-1404.755) (-1408.043) (-1405.464) [-1408.038] -- 0:05:27
189000 -- [-1405.239] (-1418.344) (-1402.333) (-1408.336) * (-1406.206) (-1411.728) [-1400.484] (-1413.423) -- 0:05:26
189500 -- (-1399.081) (-1407.766) [-1400.289] (-1409.245) * (-1404.902) [-1406.817] (-1420.106) (-1404.552) -- 0:05:25
190000 -- (-1404.287) (-1413.189) [-1406.977] (-1417.271) * (-1408.235) (-1405.777) (-1407.427) [-1402.905] -- 0:05:24
Average standard deviation of split frequencies: 0.017161
190500 -- [-1400.716] (-1408.473) (-1410.614) (-1400.299) * (-1403.392) [-1408.103] (-1409.176) (-1410.158) -- 0:05:22
191000 -- (-1409.008) (-1411.429) [-1410.259] (-1408.527) * [-1404.256] (-1411.544) (-1404.845) (-1418.461) -- 0:05:26
191500 -- (-1406.416) (-1407.467) [-1411.228] (-1403.654) * (-1415.562) (-1402.312) [-1399.738] (-1412.068) -- 0:05:25
192000 -- [-1414.471] (-1415.400) (-1407.332) (-1400.680) * (-1412.933) (-1406.202) [-1410.699] (-1414.183) -- 0:05:24
192500 -- (-1401.867) (-1404.243) (-1401.351) [-1401.767] * (-1404.374) [-1399.460] (-1411.102) (-1409.903) -- 0:05:23
193000 -- (-1405.577) (-1409.050) (-1405.585) [-1397.956] * (-1414.633) (-1402.826) (-1414.773) [-1404.666] -- 0:05:21
193500 -- (-1400.776) (-1409.896) [-1406.227] (-1412.498) * [-1408.947] (-1413.484) (-1415.438) (-1400.474) -- 0:05:25
194000 -- (-1429.798) (-1413.714) (-1408.061) [-1409.227] * (-1405.497) (-1404.167) (-1414.689) [-1406.699] -- 0:05:24
194500 -- (-1400.979) (-1412.271) [-1402.757] (-1406.484) * (-1410.573) (-1410.316) (-1422.098) [-1401.058] -- 0:05:23
195000 -- (-1417.307) (-1410.908) [-1407.784] (-1414.479) * (-1413.940) (-1406.821) (-1414.126) [-1397.958] -- 0:05:22
Average standard deviation of split frequencies: 0.018817
195500 -- (-1404.692) [-1402.111] (-1411.551) (-1408.643) * (-1406.415) (-1414.274) (-1414.585) [-1400.899] -- 0:05:20
196000 -- (-1403.449) (-1417.015) [-1408.662] (-1406.109) * (-1401.618) (-1403.354) [-1399.952] (-1412.343) -- 0:05:24
196500 -- (-1410.237) (-1409.326) (-1403.459) [-1410.953] * (-1416.161) [-1402.368] (-1407.139) (-1410.973) -- 0:05:23
197000 -- (-1404.269) (-1406.691) (-1406.373) [-1411.812] * (-1407.335) (-1403.599) (-1412.659) [-1413.756] -- 0:05:22
197500 -- (-1403.452) (-1408.518) [-1404.789] (-1406.739) * (-1417.700) (-1410.471) (-1413.372) [-1402.070] -- 0:05:21
198000 -- (-1410.588) (-1417.210) [-1395.471] (-1405.513) * [-1417.687] (-1410.602) (-1413.122) (-1401.588) -- 0:05:19
198500 -- (-1412.736) [-1405.630] (-1414.951) (-1406.583) * (-1416.237) (-1415.496) [-1405.909] (-1399.032) -- 0:05:23
199000 -- (-1404.747) (-1415.863) (-1409.255) [-1404.528] * (-1405.741) [-1408.212] (-1413.299) (-1396.662) -- 0:05:22
199500 -- [-1406.451] (-1410.694) (-1408.617) (-1416.633) * (-1415.654) (-1413.548) (-1404.835) [-1396.964] -- 0:05:21
200000 -- (-1406.680) (-1412.796) [-1395.159] (-1406.254) * (-1406.952) [-1404.905] (-1413.606) (-1400.819) -- 0:05:20
Average standard deviation of split frequencies: 0.018241
200500 -- (-1405.681) (-1426.214) [-1395.332] (-1414.667) * [-1400.573] (-1418.330) (-1412.497) (-1405.054) -- 0:05:19
201000 -- (-1404.758) (-1415.356) [-1405.019] (-1403.559) * (-1406.899) (-1414.279) [-1405.757] (-1406.175) -- 0:05:21
201500 -- (-1404.985) [-1402.462] (-1415.179) (-1408.946) * (-1403.391) (-1419.787) (-1412.164) [-1401.065] -- 0:05:20
202000 -- [-1406.132] (-1406.307) (-1413.641) (-1405.154) * (-1405.274) (-1420.201) [-1399.031] (-1414.195) -- 0:05:19
202500 -- [-1398.246] (-1407.930) (-1408.393) (-1406.471) * (-1418.739) (-1411.035) (-1400.185) [-1402.530] -- 0:05:19
203000 -- (-1407.435) (-1408.168) (-1402.234) [-1399.648] * (-1417.538) (-1407.335) [-1407.473] (-1405.812) -- 0:05:18
203500 -- [-1415.800] (-1401.713) (-1411.662) (-1414.177) * (-1423.831) (-1413.150) [-1406.062] (-1403.132) -- 0:05:20
204000 -- (-1407.284) (-1401.844) (-1414.531) [-1405.472] * (-1420.581) [-1411.633] (-1418.365) (-1416.126) -- 0:05:19
204500 -- (-1405.287) (-1413.651) (-1413.513) [-1405.594] * (-1420.396) (-1399.534) [-1400.133] (-1402.896) -- 0:05:18
205000 -- (-1407.738) (-1402.521) [-1403.937] (-1411.236) * (-1408.515) (-1393.090) (-1407.318) [-1405.229] -- 0:05:18
Average standard deviation of split frequencies: 0.016557
205500 -- (-1416.326) [-1407.619] (-1413.391) (-1415.857) * [-1407.295] (-1405.219) (-1406.079) (-1414.135) -- 0:05:17
206000 -- (-1404.677) [-1401.262] (-1409.946) (-1410.961) * (-1415.494) [-1404.548] (-1408.768) (-1409.980) -- 0:05:19
206500 -- [-1405.184] (-1409.985) (-1400.745) (-1411.803) * [-1398.901] (-1404.523) (-1409.744) (-1410.417) -- 0:05:18
207000 -- [-1412.705] (-1415.785) (-1411.315) (-1406.915) * (-1400.318) (-1411.503) (-1403.838) [-1407.816] -- 0:05:17
207500 -- (-1413.120) (-1399.581) (-1406.625) [-1413.964] * (-1405.851) (-1407.115) (-1409.634) [-1400.553] -- 0:05:17
208000 -- (-1412.787) [-1397.199] (-1408.260) (-1413.491) * (-1409.771) (-1408.867) (-1421.275) [-1403.058] -- 0:05:16
208500 -- (-1408.319) (-1410.950) (-1420.235) [-1399.544] * [-1407.153] (-1417.742) (-1409.084) (-1403.208) -- 0:05:18
209000 -- (-1406.781) (-1404.638) [-1412.047] (-1408.571) * (-1403.256) (-1423.785) [-1400.853] (-1400.824) -- 0:05:17
209500 -- (-1400.574) (-1410.359) [-1405.044] (-1403.453) * (-1402.612) (-1414.846) (-1404.347) [-1404.669] -- 0:05:16
210000 -- (-1408.278) [-1403.030] (-1403.732) (-1403.622) * (-1409.459) [-1410.188] (-1409.465) (-1411.835) -- 0:05:16
Average standard deviation of split frequencies: 0.016190
210500 -- (-1409.718) (-1402.143) [-1403.893] (-1407.682) * (-1407.000) (-1405.794) (-1414.414) [-1408.520] -- 0:05:15
211000 -- [-1409.359] (-1412.142) (-1410.404) (-1412.347) * (-1405.382) [-1406.905] (-1406.578) (-1408.047) -- 0:05:17
211500 -- (-1414.361) (-1411.044) (-1397.644) [-1406.263] * (-1418.066) [-1410.119] (-1404.487) (-1406.845) -- 0:05:16
212000 -- (-1414.097) (-1407.848) [-1400.181] (-1405.096) * (-1406.379) (-1407.861) (-1406.682) [-1410.318] -- 0:05:15
212500 -- (-1399.333) [-1397.651] (-1410.965) (-1403.851) * (-1395.385) (-1406.499) (-1416.803) [-1402.480] -- 0:05:15
213000 -- (-1406.603) (-1408.789) (-1411.338) [-1410.188] * (-1408.694) [-1402.683] (-1405.541) (-1412.326) -- 0:05:14
213500 -- (-1410.129) (-1403.947) [-1403.208] (-1411.657) * [-1411.786] (-1404.300) (-1404.477) (-1412.170) -- 0:05:16
214000 -- (-1419.865) (-1402.883) [-1401.447] (-1419.597) * (-1412.722) (-1401.011) [-1399.481] (-1410.583) -- 0:05:15
214500 -- (-1415.204) [-1413.749] (-1413.578) (-1424.107) * [-1399.086] (-1409.983) (-1400.213) (-1411.999) -- 0:05:14
215000 -- (-1404.827) (-1409.803) [-1402.714] (-1408.971) * [-1402.768] (-1407.932) (-1409.323) (-1416.188) -- 0:05:14
Average standard deviation of split frequencies: 0.014250
215500 -- (-1412.242) (-1408.414) [-1405.754] (-1400.382) * (-1411.899) [-1403.068] (-1424.046) (-1398.722) -- 0:05:13
216000 -- (-1406.777) (-1407.696) (-1406.514) [-1411.617] * [-1395.915] (-1402.747) (-1426.718) (-1400.023) -- 0:05:15
216500 -- [-1407.823] (-1417.340) (-1411.938) (-1405.331) * (-1404.992) (-1401.281) [-1398.294] (-1409.145) -- 0:05:14
217000 -- (-1408.696) [-1405.934] (-1406.301) (-1404.601) * (-1401.345) (-1396.309) [-1413.252] (-1401.121) -- 0:05:13
217500 -- [-1408.626] (-1418.847) (-1406.637) (-1411.000) * [-1407.434] (-1410.222) (-1406.897) (-1412.425) -- 0:05:13
218000 -- (-1410.432) (-1419.188) [-1405.536] (-1412.895) * (-1402.376) (-1404.202) [-1407.726] (-1397.658) -- 0:05:12
218500 -- [-1402.634] (-1408.655) (-1405.846) (-1411.018) * (-1412.096) (-1422.082) [-1402.553] (-1414.780) -- 0:05:14
219000 -- (-1408.592) (-1411.876) [-1402.361] (-1415.087) * (-1413.723) [-1401.140] (-1411.675) (-1408.185) -- 0:05:13
219500 -- (-1412.583) (-1411.868) [-1412.164] (-1409.451) * (-1412.321) (-1400.007) [-1395.933] (-1405.553) -- 0:05:12
220000 -- (-1407.988) (-1408.778) [-1412.782] (-1408.208) * (-1403.499) (-1406.782) [-1394.680] (-1409.325) -- 0:05:12
Average standard deviation of split frequencies: 0.015087
220500 -- (-1413.428) (-1405.094) (-1407.079) [-1410.004] * (-1413.719) [-1420.996] (-1398.773) (-1401.292) -- 0:05:11
221000 -- (-1412.015) (-1416.383) (-1418.575) [-1407.076] * (-1414.451) (-1411.811) (-1411.183) [-1414.003] -- 0:05:13
221500 -- [-1397.915] (-1404.815) (-1404.796) (-1410.261) * [-1401.248] (-1413.010) (-1406.091) (-1410.785) -- 0:05:12
222000 -- [-1400.516] (-1416.809) (-1415.164) (-1419.486) * (-1404.993) [-1402.098] (-1402.537) (-1416.237) -- 0:05:11
222500 -- (-1415.820) (-1419.202) [-1401.354] (-1405.118) * [-1398.248] (-1404.377) (-1411.612) (-1406.204) -- 0:05:11
223000 -- (-1407.463) (-1407.917) [-1398.556] (-1413.274) * (-1403.415) (-1399.312) (-1405.390) [-1404.172] -- 0:05:10
223500 -- [-1400.373] (-1406.304) (-1411.024) (-1410.868) * (-1396.576) (-1400.860) (-1404.360) [-1397.688] -- 0:05:12
224000 -- (-1408.131) [-1406.045] (-1410.737) (-1408.622) * (-1411.125) (-1417.262) [-1395.063] (-1406.224) -- 0:05:11
224500 -- (-1407.602) (-1404.746) (-1416.619) [-1407.104] * (-1399.277) [-1400.867] (-1407.522) (-1408.111) -- 0:05:10
225000 -- (-1411.936) [-1404.300] (-1411.844) (-1410.572) * [-1398.171] (-1409.576) (-1396.448) (-1412.096) -- 0:05:10
Average standard deviation of split frequencies: 0.014992
225500 -- [-1412.782] (-1402.204) (-1406.355) (-1407.938) * [-1396.911] (-1404.597) (-1393.537) (-1406.195) -- 0:05:09
226000 -- (-1404.190) [-1397.965] (-1401.987) (-1413.705) * [-1399.438] (-1410.829) (-1400.344) (-1423.567) -- 0:05:11
226500 -- (-1411.912) (-1408.115) (-1408.739) [-1397.449] * (-1409.640) [-1414.232] (-1401.908) (-1415.748) -- 0:05:10
227000 -- [-1411.265] (-1412.143) (-1428.514) (-1401.085) * (-1415.227) (-1420.249) (-1413.793) [-1414.714] -- 0:05:09
227500 -- (-1409.740) (-1402.330) [-1406.882] (-1405.575) * (-1410.124) (-1409.483) (-1419.379) [-1401.441] -- 0:05:09
228000 -- [-1413.801] (-1404.446) (-1406.216) (-1406.382) * (-1403.785) (-1401.408) (-1402.322) [-1405.559] -- 0:05:08
228500 -- (-1402.109) [-1403.366] (-1404.983) (-1404.465) * [-1411.561] (-1403.501) (-1409.669) (-1408.965) -- 0:05:10
229000 -- [-1403.615] (-1406.603) (-1402.848) (-1404.815) * (-1415.295) [-1407.697] (-1416.613) (-1414.785) -- 0:05:09
229500 -- [-1407.275] (-1414.669) (-1406.304) (-1403.038) * (-1412.681) [-1399.142] (-1415.151) (-1404.646) -- 0:05:08
230000 -- [-1415.508] (-1407.033) (-1408.290) (-1404.367) * (-1405.767) (-1399.639) [-1407.815] (-1401.026) -- 0:05:08
Average standard deviation of split frequencies: 0.014944
230500 -- [-1401.763] (-1401.568) (-1410.603) (-1402.848) * (-1418.187) (-1410.556) (-1410.528) [-1410.179] -- 0:05:07
231000 -- (-1403.013) (-1410.915) [-1408.336] (-1399.776) * (-1416.759) (-1408.078) (-1401.998) [-1393.733] -- 0:05:09
231500 -- (-1417.076) [-1402.783] (-1407.226) (-1412.329) * (-1402.031) (-1406.843) (-1396.066) [-1411.527] -- 0:05:08
232000 -- (-1407.188) (-1396.588) [-1396.212] (-1407.951) * (-1411.181) (-1411.011) [-1395.241] (-1407.264) -- 0:05:07
232500 -- (-1409.974) [-1398.627] (-1402.185) (-1412.455) * (-1419.328) (-1403.798) (-1407.641) [-1403.977] -- 0:05:07
233000 -- (-1407.840) (-1403.505) [-1405.591] (-1425.372) * [-1398.705] (-1414.839) (-1404.260) (-1407.958) -- 0:05:06
233500 -- (-1408.695) (-1401.631) [-1399.311] (-1414.519) * (-1407.762) [-1405.868] (-1409.825) (-1419.101) -- 0:05:08
234000 -- (-1413.946) (-1408.389) [-1400.268] (-1420.796) * (-1403.893) (-1403.879) (-1403.444) [-1404.084] -- 0:05:07
234500 -- (-1411.308) (-1410.985) (-1404.799) [-1401.786] * (-1415.222) (-1407.170) (-1410.179) [-1410.913] -- 0:05:06
235000 -- (-1423.994) (-1409.570) (-1404.206) [-1400.045] * (-1405.988) (-1417.518) [-1398.702] (-1415.813) -- 0:05:06
Average standard deviation of split frequencies: 0.014731
235500 -- (-1410.961) (-1405.075) (-1400.714) [-1393.977] * (-1400.439) [-1404.734] (-1410.514) (-1421.257) -- 0:05:05
236000 -- (-1415.769) (-1408.276) [-1404.806] (-1398.000) * (-1405.111) (-1406.432) [-1399.840] (-1418.789) -- 0:05:07
236500 -- (-1418.240) (-1405.394) (-1398.190) [-1409.396] * (-1400.728) [-1403.284] (-1408.891) (-1409.929) -- 0:05:06
237000 -- (-1411.226) [-1402.296] (-1414.027) (-1399.840) * (-1404.263) (-1403.239) [-1396.808] (-1409.298) -- 0:05:05
237500 -- (-1408.464) (-1406.003) [-1410.104] (-1399.712) * (-1415.798) (-1399.102) (-1408.136) [-1404.374] -- 0:05:05
238000 -- (-1419.428) (-1414.549) (-1405.310) [-1395.364] * [-1402.812] (-1418.018) (-1422.837) (-1401.133) -- 0:05:04
238500 -- (-1407.827) [-1412.221] (-1410.610) (-1402.159) * (-1399.406) [-1408.923] (-1401.224) (-1414.518) -- 0:05:06
239000 -- (-1403.078) (-1416.866) (-1408.180) [-1408.147] * [-1408.002] (-1397.208) (-1403.150) (-1399.829) -- 0:05:05
239500 -- [-1405.601] (-1412.026) (-1408.908) (-1416.357) * (-1409.134) (-1411.156) [-1402.342] (-1408.458) -- 0:05:04
240000 -- [-1398.016] (-1411.635) (-1400.501) (-1419.583) * [-1410.344] (-1406.820) (-1399.515) (-1416.700) -- 0:05:04
Average standard deviation of split frequencies: 0.014446
240500 -- (-1397.821) (-1410.272) [-1406.734] (-1417.060) * (-1407.146) (-1403.024) (-1411.674) [-1404.076] -- 0:05:03
241000 -- (-1403.384) (-1406.409) [-1408.461] (-1403.378) * (-1413.186) (-1410.087) (-1411.370) [-1404.473] -- 0:05:05
241500 -- (-1402.180) [-1394.761] (-1408.284) (-1411.590) * [-1394.666] (-1413.472) (-1422.148) (-1405.422) -- 0:05:04
242000 -- (-1405.188) (-1402.420) [-1412.081] (-1405.711) * [-1404.021] (-1406.483) (-1418.874) (-1413.129) -- 0:05:03
242500 -- (-1413.001) (-1401.831) [-1410.270] (-1407.974) * (-1405.683) (-1416.379) (-1418.170) [-1401.027] -- 0:05:03
243000 -- [-1405.815] (-1416.586) (-1421.417) (-1397.923) * (-1403.152) (-1411.060) (-1405.330) [-1407.187] -- 0:05:05
243500 -- (-1412.651) (-1402.846) (-1405.071) [-1402.671] * [-1416.707] (-1409.289) (-1406.244) (-1411.378) -- 0:05:04
244000 -- (-1409.735) (-1408.716) (-1412.053) [-1402.493] * [-1405.827] (-1415.179) (-1405.899) (-1402.570) -- 0:05:03
244500 -- [-1406.223] (-1404.337) (-1401.494) (-1402.202) * [-1407.868] (-1412.765) (-1409.388) (-1404.246) -- 0:05:02
245000 -- (-1410.630) (-1415.223) (-1404.608) [-1406.146] * (-1410.038) [-1414.318] (-1413.760) (-1406.066) -- 0:05:02
Average standard deviation of split frequencies: 0.013189
245500 -- [-1398.228] (-1407.689) (-1401.032) (-1401.779) * [-1397.048] (-1415.162) (-1403.980) (-1409.408) -- 0:05:04
246000 -- (-1408.199) [-1411.007] (-1407.163) (-1407.106) * (-1401.798) (-1419.047) [-1396.910] (-1409.082) -- 0:05:03
246500 -- [-1403.455] (-1407.560) (-1423.602) (-1412.970) * [-1410.427] (-1419.383) (-1408.204) (-1400.439) -- 0:05:02
247000 -- [-1399.916] (-1416.062) (-1412.019) (-1398.998) * [-1405.730] (-1409.930) (-1408.721) (-1411.054) -- 0:05:01
247500 -- (-1410.306) [-1418.481] (-1412.856) (-1412.735) * (-1413.601) (-1418.500) (-1401.995) [-1404.269] -- 0:05:04
248000 -- (-1412.634) (-1418.810) [-1407.185] (-1403.715) * (-1405.199) (-1401.037) [-1407.918] (-1410.776) -- 0:05:03
248500 -- (-1409.413) [-1412.252] (-1408.630) (-1409.587) * [-1398.490] (-1411.956) (-1413.267) (-1410.050) -- 0:05:02
249000 -- [-1403.634] (-1412.793) (-1401.527) (-1415.677) * (-1413.586) [-1400.758] (-1398.661) (-1407.977) -- 0:05:01
249500 -- (-1414.153) [-1407.861] (-1397.222) (-1407.793) * [-1409.136] (-1413.003) (-1413.336) (-1414.460) -- 0:05:00
250000 -- (-1418.274) (-1408.252) (-1409.083) [-1404.905] * (-1414.237) (-1412.316) [-1400.270] (-1410.711) -- 0:05:03
Average standard deviation of split frequencies: 0.011519
250500 -- (-1407.714) [-1401.205] (-1409.114) (-1402.544) * [-1411.918] (-1416.513) (-1409.928) (-1408.666) -- 0:05:02
251000 -- (-1408.068) (-1400.581) (-1414.250) [-1409.787] * (-1419.894) (-1411.070) [-1409.265] (-1408.154) -- 0:05:01
251500 -- (-1412.353) [-1402.181] (-1412.295) (-1400.102) * (-1414.748) [-1401.791] (-1405.695) (-1407.901) -- 0:05:00
252000 -- (-1407.106) [-1402.708] (-1407.244) (-1409.620) * (-1412.608) (-1406.257) [-1403.811] (-1407.430) -- 0:04:59
252500 -- (-1406.281) [-1407.134] (-1415.694) (-1406.258) * (-1412.539) (-1408.516) [-1402.624] (-1413.622) -- 0:05:01
253000 -- (-1402.188) [-1414.780] (-1421.427) (-1407.988) * [-1405.051] (-1408.456) (-1402.698) (-1414.573) -- 0:05:01
253500 -- [-1402.910] (-1412.517) (-1416.777) (-1411.871) * (-1406.000) (-1428.124) [-1401.164] (-1407.393) -- 0:05:00
254000 -- (-1403.950) (-1413.582) (-1407.649) [-1403.255] * (-1404.459) (-1427.696) [-1397.465] (-1397.755) -- 0:04:59
254500 -- (-1403.468) (-1403.983) [-1400.109] (-1414.504) * [-1407.204] (-1419.371) (-1415.769) (-1409.373) -- 0:04:58
255000 -- (-1409.294) (-1408.623) (-1407.864) [-1402.663] * [-1396.109] (-1414.370) (-1415.122) (-1413.044) -- 0:05:00
Average standard deviation of split frequencies: 0.012199
255500 -- [-1401.756] (-1407.241) (-1415.650) (-1406.848) * (-1408.217) (-1402.362) [-1414.784] (-1412.980) -- 0:05:00
256000 -- (-1407.598) (-1404.364) (-1408.620) [-1406.529] * (-1413.409) (-1400.798) [-1399.211] (-1436.323) -- 0:04:59
256500 -- (-1399.786) (-1400.418) [-1414.844] (-1410.960) * [-1407.250] (-1409.012) (-1402.568) (-1413.063) -- 0:04:58
257000 -- [-1401.067] (-1408.868) (-1406.172) (-1408.869) * [-1408.153] (-1405.040) (-1409.030) (-1413.787) -- 0:04:57
257500 -- (-1409.905) (-1406.615) [-1409.410] (-1405.812) * (-1413.102) (-1403.729) [-1403.416] (-1419.327) -- 0:04:59
258000 -- (-1401.401) (-1414.470) (-1410.521) [-1398.292] * (-1411.689) [-1403.216] (-1401.134) (-1412.415) -- 0:04:59
258500 -- (-1410.479) (-1411.881) (-1412.251) [-1407.820] * [-1401.371] (-1404.734) (-1413.345) (-1413.441) -- 0:04:58
259000 -- (-1411.718) (-1411.746) (-1408.534) [-1409.692] * [-1406.011] (-1419.564) (-1402.326) (-1412.165) -- 0:04:57
259500 -- [-1409.293] (-1417.964) (-1407.096) (-1398.293) * [-1404.500] (-1405.792) (-1404.293) (-1401.992) -- 0:04:59
260000 -- (-1399.499) (-1412.113) (-1406.262) [-1403.065] * (-1410.313) (-1410.823) [-1403.225] (-1408.710) -- 0:04:58
Average standard deviation of split frequencies: 0.010851
260500 -- (-1400.601) [-1408.959] (-1410.756) (-1406.269) * (-1413.700) [-1406.390] (-1411.412) (-1403.636) -- 0:04:58
261000 -- (-1403.883) (-1413.805) (-1405.904) [-1410.965] * [-1405.216] (-1415.446) (-1414.380) (-1408.830) -- 0:04:57
261500 -- (-1403.130) [-1402.896] (-1405.403) (-1408.378) * [-1403.978] (-1412.940) (-1418.728) (-1403.381) -- 0:04:56
262000 -- [-1399.962] (-1406.869) (-1410.207) (-1404.638) * (-1421.395) [-1402.334] (-1414.448) (-1405.143) -- 0:04:58
262500 -- [-1398.203] (-1404.519) (-1406.075) (-1408.520) * (-1423.173) [-1397.291] (-1420.031) (-1406.087) -- 0:04:57
263000 -- [-1406.007] (-1408.496) (-1406.878) (-1411.800) * (-1405.353) [-1404.115] (-1412.632) (-1400.506) -- 0:04:57
263500 -- (-1398.658) (-1411.020) [-1403.001] (-1406.616) * (-1404.610) [-1402.524] (-1416.232) (-1413.203) -- 0:04:56
264000 -- (-1403.124) [-1405.759] (-1403.187) (-1413.139) * (-1401.130) [-1397.555] (-1400.198) (-1404.390) -- 0:04:55
264500 -- (-1407.649) (-1396.283) [-1400.151] (-1417.740) * (-1402.107) [-1404.680] (-1404.748) (-1406.510) -- 0:04:57
265000 -- (-1409.474) (-1417.591) [-1407.381] (-1409.648) * (-1398.311) [-1395.478] (-1406.388) (-1411.786) -- 0:04:56
Average standard deviation of split frequencies: 0.011187
265500 -- [-1400.449] (-1400.441) (-1406.214) (-1412.652) * (-1406.565) (-1409.877) (-1403.957) [-1407.360] -- 0:04:56
266000 -- (-1401.646) [-1402.357] (-1417.694) (-1416.101) * [-1396.998] (-1406.650) (-1417.902) (-1425.423) -- 0:04:55
266500 -- (-1409.905) [-1406.487] (-1405.645) (-1414.176) * (-1403.335) [-1404.668] (-1407.901) (-1412.954) -- 0:04:54
267000 -- (-1396.843) [-1414.265] (-1407.374) (-1403.690) * (-1407.482) (-1402.046) [-1399.958] (-1402.217) -- 0:04:56
267500 -- (-1397.897) (-1406.408) (-1406.312) [-1399.309] * (-1403.469) [-1401.967] (-1416.334) (-1401.527) -- 0:04:55
268000 -- (-1404.901) (-1403.567) (-1406.180) [-1399.856] * (-1401.881) (-1408.083) (-1402.797) [-1405.501] -- 0:04:54
268500 -- (-1409.115) [-1405.960] (-1406.743) (-1401.991) * (-1410.007) (-1415.667) (-1408.173) [-1406.416] -- 0:04:54
269000 -- (-1409.201) [-1398.999] (-1409.464) (-1406.683) * [-1403.714] (-1405.264) (-1409.576) (-1401.771) -- 0:04:56
269500 -- [-1411.371] (-1397.884) (-1404.246) (-1405.971) * [-1397.811] (-1413.607) (-1403.932) (-1423.030) -- 0:04:55
270000 -- (-1424.649) [-1406.052] (-1417.835) (-1411.581) * [-1398.310] (-1407.464) (-1408.050) (-1403.996) -- 0:04:54
Average standard deviation of split frequencies: 0.011103
270500 -- [-1412.142] (-1406.012) (-1416.985) (-1409.964) * (-1401.027) (-1414.784) [-1407.364] (-1408.226) -- 0:04:53
271000 -- [-1405.272] (-1416.820) (-1412.059) (-1403.135) * (-1402.985) [-1405.882] (-1404.023) (-1413.804) -- 0:04:53
271500 -- (-1409.609) (-1402.601) [-1402.161] (-1405.776) * (-1412.579) [-1407.346] (-1412.999) (-1412.290) -- 0:04:55
272000 -- (-1401.475) [-1403.391] (-1406.555) (-1404.214) * (-1409.972) (-1403.360) [-1407.665] (-1410.355) -- 0:04:54
272500 -- (-1405.149) (-1404.397) [-1394.719] (-1400.563) * [-1406.446] (-1415.543) (-1412.708) (-1410.980) -- 0:04:53
273000 -- (-1409.021) (-1410.415) [-1402.117] (-1400.611) * [-1406.279] (-1418.698) (-1405.296) (-1414.068) -- 0:04:52
273500 -- (-1400.941) (-1403.976) [-1400.430] (-1412.545) * (-1403.353) [-1408.135] (-1404.654) (-1415.492) -- 0:04:52
274000 -- (-1413.527) (-1404.616) (-1407.612) [-1404.702] * [-1407.949] (-1409.564) (-1410.022) (-1414.630) -- 0:04:54
274500 -- [-1403.609] (-1416.596) (-1400.555) (-1417.043) * (-1404.037) [-1414.264] (-1405.258) (-1417.909) -- 0:04:53
275000 -- (-1405.156) (-1416.957) [-1400.823] (-1424.207) * [-1404.097] (-1409.491) (-1414.686) (-1419.346) -- 0:04:52
Average standard deviation of split frequencies: 0.010782
275500 -- (-1396.963) [-1406.086] (-1405.981) (-1422.017) * (-1410.372) [-1407.744] (-1427.542) (-1410.501) -- 0:04:51
276000 -- (-1408.399) [-1407.117] (-1408.200) (-1409.524) * (-1411.326) (-1408.583) [-1401.191] (-1406.752) -- 0:04:51
276500 -- (-1414.364) [-1404.842] (-1412.799) (-1407.958) * (-1403.930) (-1410.577) [-1397.101] (-1411.904) -- 0:04:53
277000 -- (-1410.435) (-1404.601) (-1407.285) [-1398.020] * (-1405.225) (-1410.088) [-1405.181] (-1406.246) -- 0:04:52
277500 -- (-1406.152) (-1404.668) (-1411.423) [-1400.990] * (-1411.226) (-1418.067) [-1406.980] (-1400.972) -- 0:04:51
278000 -- (-1404.565) (-1408.131) (-1424.087) [-1407.132] * (-1413.226) (-1405.866) (-1400.593) [-1402.108] -- 0:04:50
278500 -- [-1400.122] (-1405.056) (-1417.764) (-1411.214) * (-1413.932) [-1404.757] (-1415.095) (-1417.628) -- 0:04:50
279000 -- (-1403.693) [-1410.694] (-1423.067) (-1406.983) * (-1405.687) (-1409.765) (-1409.724) [-1402.952] -- 0:04:52
279500 -- [-1406.473] (-1403.965) (-1428.994) (-1412.981) * (-1403.677) (-1417.762) (-1409.783) [-1410.059] -- 0:04:51
280000 -- (-1406.288) (-1409.428) (-1413.460) [-1408.595] * (-1405.491) (-1414.065) (-1412.621) [-1399.296] -- 0:04:50
Average standard deviation of split frequencies: 0.011967
280500 -- (-1412.060) [-1408.265] (-1418.016) (-1405.930) * (-1406.735) (-1416.224) (-1414.763) [-1405.426] -- 0:04:49
281000 -- (-1408.780) [-1400.855] (-1408.020) (-1414.901) * (-1403.011) (-1423.476) (-1407.951) [-1402.154] -- 0:04:49
281500 -- (-1418.732) (-1421.654) [-1405.697] (-1411.245) * (-1408.541) (-1418.596) [-1403.830] (-1407.154) -- 0:04:50
282000 -- (-1410.077) (-1417.456) (-1408.281) [-1416.876] * (-1398.641) (-1424.209) [-1407.006] (-1404.397) -- 0:04:50
282500 -- [-1412.763] (-1409.794) (-1403.912) (-1405.706) * (-1416.003) (-1405.238) (-1416.770) [-1419.336] -- 0:04:49
283000 -- (-1412.567) [-1407.926] (-1404.781) (-1405.516) * (-1405.915) (-1400.112) [-1416.743] (-1406.838) -- 0:04:48
283500 -- (-1403.693) (-1408.285) (-1405.668) [-1404.493] * (-1401.258) (-1405.780) (-1409.131) [-1405.264] -- 0:04:48
284000 -- (-1416.972) [-1404.130] (-1403.691) (-1415.510) * (-1409.695) (-1424.507) (-1404.411) [-1398.695] -- 0:04:49
284500 -- (-1412.322) (-1408.437) (-1413.841) [-1411.877] * (-1407.869) (-1411.389) (-1419.962) [-1403.408] -- 0:04:49
285000 -- (-1412.258) [-1408.005] (-1407.811) (-1392.733) * [-1396.670] (-1407.276) (-1408.267) (-1408.256) -- 0:04:48
Average standard deviation of split frequencies: 0.011641
285500 -- (-1410.152) (-1402.113) (-1408.929) [-1404.421] * (-1414.572) (-1410.839) (-1410.997) [-1409.719] -- 0:04:47
286000 -- (-1413.227) [-1413.271] (-1404.303) (-1412.016) * (-1414.423) [-1402.367] (-1409.572) (-1410.684) -- 0:04:47
286500 -- (-1400.904) (-1408.178) (-1407.615) [-1408.564] * (-1409.811) (-1407.558) (-1399.602) [-1407.957] -- 0:04:48
287000 -- (-1405.220) (-1424.270) [-1401.800] (-1404.351) * (-1409.463) [-1398.578] (-1407.654) (-1405.457) -- 0:04:48
287500 -- [-1395.977] (-1408.787) (-1400.362) (-1414.963) * (-1407.519) [-1408.330] (-1413.739) (-1403.468) -- 0:04:47
288000 -- [-1399.253] (-1403.850) (-1421.108) (-1410.228) * (-1401.811) (-1407.217) (-1412.001) [-1398.365] -- 0:04:46
288500 -- [-1408.039] (-1414.047) (-1405.663) (-1414.883) * (-1417.043) (-1407.299) (-1415.170) [-1399.475] -- 0:04:46
289000 -- (-1415.406) (-1403.267) (-1419.236) [-1402.042] * (-1415.998) (-1410.145) (-1404.106) [-1406.390] -- 0:04:47
289500 -- [-1408.928] (-1417.047) (-1415.888) (-1414.197) * [-1413.492] (-1402.318) (-1414.168) (-1407.656) -- 0:04:47
290000 -- (-1412.845) [-1402.657] (-1407.985) (-1406.225) * (-1407.232) (-1407.628) [-1403.437] (-1411.878) -- 0:04:46
Average standard deviation of split frequencies: 0.009934
290500 -- [-1403.666] (-1410.094) (-1408.483) (-1403.262) * (-1410.867) [-1407.723] (-1408.183) (-1403.565) -- 0:04:45
291000 -- (-1419.795) (-1415.962) [-1405.071] (-1396.903) * (-1410.139) (-1409.546) (-1398.929) [-1396.034] -- 0:04:45
291500 -- (-1408.765) [-1407.559] (-1418.749) (-1405.367) * (-1410.963) (-1419.143) (-1397.200) [-1397.432] -- 0:04:46
292000 -- [-1411.652] (-1425.914) (-1406.122) (-1399.543) * [-1402.545] (-1405.833) (-1404.099) (-1405.106) -- 0:04:46
292500 -- (-1409.999) (-1414.402) [-1412.501] (-1403.105) * (-1409.727) (-1400.966) [-1399.887] (-1406.263) -- 0:04:45
293000 -- [-1402.026] (-1409.567) (-1402.230) (-1410.393) * (-1405.675) (-1405.783) [-1397.417] (-1403.860) -- 0:04:44
293500 -- (-1425.533) (-1401.602) [-1408.057] (-1408.425) * [-1407.139] (-1406.597) (-1405.047) (-1417.849) -- 0:04:44
294000 -- (-1404.033) (-1414.449) [-1406.128] (-1418.152) * (-1415.390) [-1402.089] (-1406.513) (-1413.915) -- 0:04:45
294500 -- (-1407.661) (-1419.269) [-1396.912] (-1407.729) * (-1409.095) (-1402.578) [-1399.350] (-1410.730) -- 0:04:45
295000 -- (-1419.260) (-1398.905) (-1401.711) [-1398.953] * (-1416.814) (-1411.470) [-1395.937] (-1414.644) -- 0:04:44
Average standard deviation of split frequencies: 0.010551
295500 -- (-1411.528) [-1404.367] (-1411.367) (-1398.236) * [-1413.289] (-1418.586) (-1404.980) (-1417.565) -- 0:04:43
296000 -- (-1410.029) [-1393.569] (-1421.254) (-1408.251) * (-1417.129) (-1414.936) [-1403.085] (-1409.113) -- 0:04:43
296500 -- (-1412.071) (-1401.354) [-1400.184] (-1400.566) * [-1395.539] (-1405.618) (-1396.603) (-1404.711) -- 0:04:44
297000 -- (-1414.036) (-1418.253) [-1405.403] (-1402.069) * [-1403.371] (-1409.317) (-1410.715) (-1412.231) -- 0:04:44
297500 -- (-1412.825) [-1415.016] (-1402.729) (-1400.109) * [-1398.372] (-1418.112) (-1413.852) (-1404.704) -- 0:04:43
298000 -- (-1416.340) [-1412.664] (-1406.225) (-1414.006) * (-1409.552) (-1413.068) (-1398.518) [-1402.253] -- 0:04:42
298500 -- (-1397.825) [-1411.952] (-1413.736) (-1411.594) * [-1400.739] (-1404.517) (-1407.176) (-1405.673) -- 0:04:42
299000 -- (-1414.583) (-1408.421) [-1398.858] (-1409.432) * (-1401.891) (-1404.328) (-1418.802) [-1410.501] -- 0:04:43
299500 -- (-1412.503) [-1407.468] (-1399.400) (-1419.109) * [-1400.567] (-1405.316) (-1413.634) (-1404.599) -- 0:04:43
300000 -- (-1404.593) (-1406.340) (-1412.382) [-1408.379] * (-1405.629) [-1400.694] (-1407.213) (-1401.536) -- 0:04:42
Average standard deviation of split frequencies: 0.009211
300500 -- (-1408.538) (-1403.883) (-1408.842) [-1398.714] * (-1417.577) (-1404.455) [-1406.804] (-1408.344) -- 0:04:41
301000 -- (-1419.687) [-1403.378] (-1412.189) (-1406.566) * (-1401.741) [-1409.800] (-1406.555) (-1411.726) -- 0:04:40
301500 -- [-1396.537] (-1398.457) (-1404.114) (-1410.842) * (-1405.902) [-1403.260] (-1403.836) (-1407.879) -- 0:04:42
302000 -- (-1409.815) [-1405.206] (-1424.680) (-1409.456) * (-1404.408) (-1404.821) [-1395.176] (-1411.966) -- 0:04:41
302500 -- (-1412.000) [-1410.519] (-1410.137) (-1416.449) * (-1411.136) [-1405.130] (-1402.877) (-1410.020) -- 0:04:41
303000 -- [-1405.862] (-1407.838) (-1410.693) (-1415.362) * (-1414.433) [-1404.925] (-1412.058) (-1419.610) -- 0:04:40
303500 -- [-1410.194] (-1409.232) (-1409.544) (-1399.270) * (-1395.762) [-1404.451] (-1417.975) (-1407.087) -- 0:04:39
304000 -- [-1401.411] (-1402.530) (-1404.308) (-1418.347) * [-1403.127] (-1408.692) (-1417.919) (-1410.001) -- 0:04:41
304500 -- (-1409.250) [-1403.350] (-1408.533) (-1417.793) * (-1403.421) (-1403.183) [-1412.683] (-1413.108) -- 0:04:40
305000 -- (-1415.729) [-1400.021] (-1408.540) (-1411.504) * (-1408.608) [-1399.690] (-1408.943) (-1408.018) -- 0:04:40
Average standard deviation of split frequencies: 0.009725
305500 -- [-1400.351] (-1404.438) (-1400.772) (-1410.928) * (-1414.388) [-1399.744] (-1417.457) (-1404.697) -- 0:04:39
306000 -- (-1408.966) [-1399.199] (-1407.469) (-1420.227) * [-1401.408] (-1401.813) (-1417.512) (-1408.870) -- 0:04:38
306500 -- (-1417.790) [-1398.872] (-1401.542) (-1406.665) * (-1408.321) [-1395.866] (-1403.875) (-1406.531) -- 0:04:40
307000 -- (-1404.290) (-1405.960) (-1410.647) [-1403.186] * (-1414.411) [-1404.155] (-1399.472) (-1412.708) -- 0:04:39
307500 -- (-1413.605) [-1398.724] (-1407.508) (-1414.444) * (-1414.309) (-1409.313) [-1397.885] (-1401.766) -- 0:04:39
308000 -- (-1410.362) [-1396.633] (-1407.830) (-1408.376) * (-1408.178) [-1404.698] (-1400.820) (-1405.831) -- 0:04:38
308500 -- (-1412.744) [-1408.330] (-1408.440) (-1398.442) * [-1402.242] (-1414.162) (-1407.369) (-1409.730) -- 0:04:40
309000 -- (-1410.499) [-1402.117] (-1403.293) (-1403.603) * [-1404.162] (-1400.115) (-1405.701) (-1417.341) -- 0:04:39
309500 -- (-1417.760) [-1402.515] (-1405.345) (-1405.380) * [-1403.493] (-1410.489) (-1407.649) (-1416.534) -- 0:04:38
310000 -- (-1407.194) (-1418.192) [-1407.177] (-1405.826) * [-1400.005] (-1413.612) (-1417.982) (-1408.332) -- 0:04:38
Average standard deviation of split frequencies: 0.010811
310500 -- [-1405.397] (-1416.668) (-1406.718) (-1414.032) * (-1414.189) (-1407.899) [-1404.549] (-1405.979) -- 0:04:37
311000 -- (-1401.556) [-1406.247] (-1409.178) (-1410.925) * (-1405.528) (-1400.581) (-1406.915) [-1408.709] -- 0:04:39
311500 -- (-1413.255) (-1413.790) [-1403.070] (-1413.638) * (-1403.695) [-1401.350] (-1411.346) (-1407.482) -- 0:04:38
312000 -- (-1405.539) (-1420.218) [-1410.267] (-1400.545) * (-1402.358) (-1412.399) (-1400.485) [-1403.855] -- 0:04:37
312500 -- (-1410.594) (-1407.615) [-1406.503] (-1398.773) * (-1400.847) (-1406.919) [-1406.002] (-1413.300) -- 0:04:37
313000 -- [-1404.973] (-1409.411) (-1408.900) (-1413.361) * [-1398.376] (-1406.088) (-1402.126) (-1404.171) -- 0:04:36
313500 -- (-1410.142) [-1401.474] (-1406.227) (-1413.841) * [-1396.621] (-1404.601) (-1405.017) (-1402.377) -- 0:04:38
314000 -- (-1402.934) [-1406.536] (-1408.883) (-1408.566) * (-1405.410) (-1416.635) (-1414.924) [-1397.950] -- 0:04:37
314500 -- [-1408.914] (-1422.725) (-1395.842) (-1408.132) * (-1421.463) (-1398.549) (-1401.370) [-1404.424] -- 0:04:36
315000 -- (-1409.622) (-1407.913) [-1406.166] (-1411.541) * (-1428.455) (-1409.240) (-1411.265) [-1402.810] -- 0:04:36
Average standard deviation of split frequencies: 0.009883
315500 -- (-1429.625) (-1404.736) [-1399.732] (-1421.419) * (-1407.810) [-1403.637] (-1404.313) (-1402.530) -- 0:04:35
316000 -- [-1407.377] (-1420.510) (-1402.745) (-1400.185) * (-1406.813) (-1403.636) (-1402.096) [-1396.405] -- 0:04:37
316500 -- [-1405.305] (-1406.206) (-1420.938) (-1415.899) * [-1405.937] (-1408.774) (-1401.955) (-1415.919) -- 0:04:36
317000 -- (-1404.670) (-1414.356) (-1419.369) [-1402.832] * (-1406.498) (-1412.828) (-1407.597) [-1403.107] -- 0:04:35
317500 -- (-1402.959) [-1403.266] (-1413.570) (-1403.119) * (-1410.575) (-1410.839) (-1409.847) [-1409.122] -- 0:04:35
318000 -- (-1412.225) [-1397.758] (-1408.150) (-1408.261) * (-1418.396) (-1418.109) (-1401.350) [-1405.071] -- 0:04:34
318500 -- (-1404.081) (-1401.495) [-1411.545] (-1408.068) * (-1406.349) (-1408.509) [-1396.461] (-1421.770) -- 0:04:36
319000 -- (-1407.459) (-1398.567) (-1411.615) [-1409.927] * (-1425.271) (-1409.711) [-1399.067] (-1405.742) -- 0:04:35
319500 -- (-1413.539) (-1407.509) [-1414.011] (-1413.990) * (-1401.341) (-1407.586) [-1404.596] (-1405.978) -- 0:04:34
320000 -- (-1408.345) (-1413.603) [-1411.225] (-1411.843) * [-1404.836] (-1404.956) (-1405.560) (-1416.061) -- 0:04:34
Average standard deviation of split frequencies: 0.010934
320500 -- (-1414.804) (-1401.359) (-1411.518) [-1403.678] * (-1404.317) (-1410.949) [-1399.123] (-1413.174) -- 0:04:33
321000 -- (-1414.213) (-1414.538) [-1414.375] (-1413.298) * (-1414.015) (-1410.789) (-1405.682) [-1411.053] -- 0:04:34
321500 -- [-1407.594] (-1410.980) (-1413.708) (-1409.612) * (-1406.033) [-1405.602] (-1401.865) (-1412.034) -- 0:04:34
322000 -- (-1402.460) [-1406.890] (-1418.152) (-1410.105) * (-1413.476) [-1405.604] (-1401.601) (-1409.451) -- 0:04:33
322500 -- (-1407.981) [-1408.999] (-1410.022) (-1410.246) * (-1405.203) (-1407.975) [-1402.192] (-1402.039) -- 0:04:33
323000 -- [-1402.153] (-1412.248) (-1409.508) (-1407.268) * (-1400.501) [-1405.819] (-1407.954) (-1412.870) -- 0:04:32
323500 -- (-1408.822) [-1410.730] (-1418.763) (-1409.151) * (-1408.639) [-1402.248] (-1410.080) (-1410.472) -- 0:04:33
324000 -- [-1412.685] (-1406.717) (-1413.302) (-1407.158) * (-1407.043) (-1403.894) [-1401.302] (-1418.617) -- 0:04:33
324500 -- (-1412.954) (-1407.858) (-1412.862) [-1416.467] * (-1405.446) [-1406.925] (-1403.804) (-1408.546) -- 0:04:32
325000 -- (-1407.493) (-1406.543) [-1404.822] (-1410.185) * [-1403.820] (-1414.011) (-1406.472) (-1407.997) -- 0:04:32
Average standard deviation of split frequencies: 0.010122
325500 -- (-1403.272) (-1414.371) [-1399.321] (-1400.867) * (-1400.262) (-1405.898) [-1405.219] (-1397.603) -- 0:04:31
326000 -- (-1408.704) (-1412.081) [-1405.988] (-1412.726) * (-1404.921) [-1399.617] (-1398.036) (-1404.143) -- 0:04:32
326500 -- [-1408.988] (-1415.629) (-1406.829) (-1414.057) * (-1404.110) (-1408.044) (-1401.644) [-1404.908] -- 0:04:32
327000 -- (-1411.399) (-1412.208) [-1409.131] (-1401.893) * [-1405.913] (-1407.049) (-1401.080) (-1414.287) -- 0:04:31
327500 -- (-1407.619) (-1407.551) (-1414.843) [-1400.758] * (-1410.165) [-1402.058] (-1406.366) (-1411.780) -- 0:04:31
328000 -- (-1408.920) (-1411.476) (-1412.029) [-1406.501] * [-1411.927] (-1409.761) (-1416.583) (-1416.442) -- 0:04:32
328500 -- [-1402.074] (-1399.153) (-1408.865) (-1407.680) * [-1411.878] (-1403.216) (-1408.922) (-1409.769) -- 0:04:31
329000 -- (-1406.716) [-1402.732] (-1405.653) (-1414.226) * (-1399.452) (-1412.524) (-1417.318) [-1406.690] -- 0:04:31
329500 -- (-1406.914) [-1401.105] (-1405.926) (-1405.026) * (-1404.018) (-1409.503) [-1403.314] (-1408.213) -- 0:04:30
330000 -- [-1408.782] (-1407.462) (-1405.920) (-1413.565) * (-1403.835) (-1398.869) [-1409.620] (-1416.896) -- 0:04:30
Average standard deviation of split frequencies: 0.009712
330500 -- (-1407.076) (-1413.532) (-1425.968) [-1411.678] * (-1393.858) [-1400.615] (-1409.468) (-1409.546) -- 0:04:31
331000 -- (-1403.661) (-1401.196) (-1409.449) [-1401.764] * (-1397.883) (-1400.858) (-1418.450) [-1403.772] -- 0:04:30
331500 -- (-1412.205) (-1412.278) [-1405.860] (-1402.602) * [-1404.429] (-1410.632) (-1413.615) (-1411.799) -- 0:04:30
332000 -- [-1402.570] (-1409.237) (-1416.372) (-1406.891) * (-1404.552) (-1407.593) [-1418.596] (-1416.160) -- 0:04:29
332500 -- (-1409.205) (-1410.149) (-1411.486) [-1409.543] * (-1410.617) [-1405.487] (-1402.261) (-1405.144) -- 0:04:29
333000 -- (-1399.376) [-1400.432] (-1414.725) (-1400.038) * (-1412.563) (-1404.818) (-1413.662) [-1406.183] -- 0:04:30
333500 -- (-1407.462) [-1399.918] (-1407.017) (-1404.431) * (-1407.420) (-1415.594) [-1404.902] (-1403.321) -- 0:04:29
334000 -- (-1408.645) (-1395.902) [-1401.204] (-1403.995) * (-1408.806) (-1416.376) [-1406.997] (-1406.515) -- 0:04:29
334500 -- (-1402.735) (-1405.630) (-1394.462) [-1399.060] * [-1402.292] (-1414.093) (-1422.930) (-1399.530) -- 0:04:28
335000 -- (-1411.611) (-1409.762) (-1402.866) [-1396.300] * [-1408.791] (-1410.618) (-1410.353) (-1406.533) -- 0:04:27
Average standard deviation of split frequencies: 0.008856
335500 -- (-1416.179) (-1413.593) (-1403.428) [-1403.899] * (-1406.090) [-1395.904] (-1405.653) (-1400.613) -- 0:04:29
336000 -- (-1403.811) (-1403.791) (-1405.776) [-1400.536] * (-1406.726) [-1401.924] (-1403.833) (-1404.802) -- 0:04:28
336500 -- (-1405.295) (-1406.265) (-1413.072) [-1402.040] * (-1414.260) (-1407.716) [-1407.487] (-1406.214) -- 0:04:28
337000 -- (-1413.884) (-1407.565) [-1402.959] (-1407.931) * (-1412.490) (-1412.510) (-1406.991) [-1403.044] -- 0:04:27
337500 -- [-1403.021] (-1407.411) (-1407.986) (-1402.505) * (-1415.900) (-1410.833) (-1421.589) [-1408.169] -- 0:04:26
338000 -- [-1401.741] (-1409.703) (-1403.934) (-1404.017) * (-1403.382) (-1407.003) (-1424.575) [-1402.152] -- 0:04:26
338500 -- (-1406.464) (-1403.384) (-1406.272) [-1402.231] * [-1410.588] (-1410.003) (-1415.797) (-1407.709) -- 0:04:27
339000 -- (-1399.831) (-1411.388) [-1394.876] (-1406.614) * [-1405.234] (-1408.682) (-1414.048) (-1412.462) -- 0:04:27
339500 -- (-1404.587) (-1406.664) [-1406.249] (-1406.861) * [-1406.158] (-1403.230) (-1409.449) (-1410.171) -- 0:04:26
340000 -- (-1401.139) (-1399.191) (-1401.246) [-1405.852] * [-1403.713] (-1413.962) (-1412.616) (-1402.674) -- 0:04:25
Average standard deviation of split frequencies: 0.009427
340500 -- (-1403.435) (-1399.775) (-1404.518) [-1400.800] * (-1413.225) (-1413.931) [-1401.488] (-1409.164) -- 0:04:25
341000 -- [-1403.235] (-1415.582) (-1406.547) (-1412.701) * (-1423.637) (-1409.417) (-1411.702) [-1398.949] -- 0:04:26
341500 -- (-1403.613) [-1401.972] (-1411.038) (-1410.958) * (-1403.952) (-1414.269) [-1403.259] (-1396.893) -- 0:04:26
342000 -- (-1405.683) (-1418.957) (-1410.436) [-1409.504] * [-1402.222] (-1401.397) (-1408.491) (-1401.591) -- 0:04:25
342500 -- (-1411.953) (-1402.063) [-1401.265] (-1422.911) * [-1406.427] (-1412.537) (-1415.304) (-1410.353) -- 0:04:24
343000 -- (-1413.093) [-1401.768] (-1404.012) (-1408.249) * (-1406.465) (-1418.885) (-1408.290) [-1401.799] -- 0:04:24
343500 -- (-1412.788) (-1404.325) [-1405.147] (-1411.740) * [-1413.567] (-1414.875) (-1409.167) (-1414.331) -- 0:04:25
344000 -- (-1412.392) [-1402.204] (-1405.461) (-1395.295) * (-1409.070) (-1408.597) (-1403.615) [-1400.817] -- 0:04:25
344500 -- (-1412.312) (-1403.665) (-1405.959) [-1401.638] * [-1404.957] (-1406.093) (-1398.814) (-1405.554) -- 0:04:24
345000 -- (-1410.338) (-1413.079) (-1397.850) [-1406.336] * (-1411.908) [-1403.335] (-1408.637) (-1415.122) -- 0:04:23
Average standard deviation of split frequencies: 0.009452
345500 -- (-1404.672) (-1411.068) (-1417.044) [-1402.031] * [-1411.759] (-1409.170) (-1403.738) (-1409.308) -- 0:04:23
346000 -- (-1415.067) [-1405.485] (-1401.748) (-1406.464) * (-1412.829) (-1414.096) (-1400.318) [-1413.915] -- 0:04:24
346500 -- [-1410.425] (-1406.629) (-1410.685) (-1407.005) * (-1408.717) (-1404.572) (-1410.586) [-1410.780] -- 0:04:24
347000 -- (-1412.574) [-1403.104] (-1405.166) (-1410.704) * (-1415.674) [-1401.012] (-1425.061) (-1405.708) -- 0:04:23
347500 -- (-1410.171) (-1400.351) [-1398.193] (-1400.801) * (-1413.518) [-1402.294] (-1422.923) (-1404.921) -- 0:04:22
348000 -- [-1406.162] (-1408.641) (-1406.471) (-1412.225) * (-1413.852) (-1403.513) [-1408.775] (-1408.329) -- 0:04:22
348500 -- (-1408.014) [-1406.318] (-1401.411) (-1408.013) * (-1424.202) (-1409.719) (-1410.632) [-1396.605] -- 0:04:23
349000 -- (-1408.405) (-1417.018) (-1407.777) [-1410.935] * (-1400.149) [-1400.687] (-1404.842) (-1414.133) -- 0:04:23
349500 -- (-1408.220) (-1408.171) (-1402.251) [-1402.792] * (-1408.354) (-1403.608) (-1414.837) [-1408.429] -- 0:04:22
350000 -- (-1403.559) (-1402.792) [-1403.305] (-1413.248) * (-1407.108) (-1409.190) [-1407.792] (-1413.361) -- 0:04:21
Average standard deviation of split frequencies: 0.009074
350500 -- [-1408.202] (-1410.790) (-1411.113) (-1408.361) * (-1410.214) (-1418.328) (-1413.889) [-1407.094] -- 0:04:21
351000 -- (-1407.899) (-1411.183) (-1418.347) [-1399.957] * (-1410.184) (-1409.115) (-1410.526) [-1405.923] -- 0:04:22
351500 -- (-1411.148) (-1398.342) (-1405.992) [-1399.264] * (-1403.057) [-1402.576] (-1401.753) (-1400.310) -- 0:04:21
352000 -- (-1416.743) [-1399.998] (-1415.600) (-1398.068) * (-1408.368) (-1411.334) (-1405.304) [-1398.276] -- 0:04:21
352500 -- (-1406.708) [-1400.269] (-1407.384) (-1403.751) * (-1405.082) [-1410.074] (-1422.274) (-1411.206) -- 0:04:20
353000 -- (-1411.260) (-1401.555) (-1410.322) [-1404.042] * [-1409.003] (-1409.420) (-1412.656) (-1402.905) -- 0:04:20
353500 -- (-1412.799) [-1406.110] (-1415.432) (-1407.260) * [-1397.194] (-1402.344) (-1405.958) (-1398.252) -- 0:04:21
354000 -- (-1409.140) (-1412.116) (-1398.461) [-1405.336] * [-1398.422] (-1407.581) (-1404.226) (-1421.505) -- 0:04:20
354500 -- (-1411.812) [-1397.707] (-1415.605) (-1406.776) * [-1401.506] (-1405.737) (-1397.519) (-1412.047) -- 0:04:20
355000 -- [-1412.081] (-1409.954) (-1405.523) (-1406.524) * [-1394.179] (-1407.118) (-1399.084) (-1409.389) -- 0:04:19
Average standard deviation of split frequencies: 0.009021
355500 -- (-1409.621) (-1402.899) [-1406.752] (-1416.316) * (-1406.482) (-1406.788) (-1419.664) [-1405.409] -- 0:04:19
356000 -- (-1408.221) [-1396.484] (-1398.710) (-1408.915) * (-1405.885) (-1411.886) (-1413.447) [-1400.857] -- 0:04:20
356500 -- (-1406.570) (-1405.887) [-1406.116] (-1402.164) * (-1413.977) (-1404.726) [-1421.720] (-1414.572) -- 0:04:19
357000 -- (-1402.846) (-1406.887) (-1406.625) [-1409.781] * (-1412.960) (-1404.153) (-1400.281) [-1405.920] -- 0:04:19
357500 -- (-1416.922) (-1408.029) (-1406.347) [-1404.489] * (-1404.377) (-1419.699) [-1399.094] (-1410.582) -- 0:04:18
358000 -- (-1407.841) [-1405.759] (-1404.063) (-1409.340) * (-1419.391) [-1402.654] (-1408.305) (-1404.607) -- 0:04:20
358500 -- [-1410.791] (-1399.503) (-1411.151) (-1404.513) * (-1403.712) (-1413.910) (-1403.351) [-1399.732] -- 0:04:19
359000 -- (-1407.626) [-1399.997] (-1415.095) (-1405.793) * (-1412.113) (-1405.283) [-1401.323] (-1404.729) -- 0:04:18
359500 -- [-1405.094] (-1412.986) (-1404.818) (-1418.470) * (-1414.413) (-1405.718) (-1410.354) [-1405.331] -- 0:04:18
360000 -- (-1413.304) (-1404.448) [-1407.424] (-1419.784) * (-1409.538) (-1414.535) [-1414.549] (-1412.813) -- 0:04:17
Average standard deviation of split frequencies: 0.008496
360500 -- (-1405.441) [-1397.447] (-1407.820) (-1411.272) * [-1404.596] (-1412.547) (-1412.184) (-1413.183) -- 0:04:17
361000 -- (-1411.245) [-1400.894] (-1413.402) (-1410.281) * (-1411.805) (-1407.281) (-1402.655) [-1405.846] -- 0:04:18
361500 -- (-1400.467) [-1400.084] (-1410.839) (-1405.851) * (-1397.330) [-1400.731] (-1417.651) (-1409.652) -- 0:04:17
362000 -- (-1408.014) [-1404.902] (-1401.841) (-1416.306) * (-1403.567) [-1404.023] (-1411.470) (-1410.986) -- 0:04:17
362500 -- [-1405.127] (-1403.814) (-1401.127) (-1411.027) * [-1404.749] (-1413.029) (-1421.552) (-1414.014) -- 0:04:16
363000 -- [-1397.799] (-1408.715) (-1400.598) (-1401.977) * (-1409.885) (-1411.294) (-1412.792) [-1401.652] -- 0:04:16
363500 -- (-1414.604) [-1405.916] (-1418.163) (-1411.151) * [-1406.974] (-1410.199) (-1408.936) (-1406.840) -- 0:04:17
364000 -- (-1403.732) (-1406.223) [-1403.127] (-1405.702) * [-1406.568] (-1414.767) (-1414.655) (-1404.192) -- 0:04:16
364500 -- (-1417.704) (-1405.260) (-1402.387) [-1399.491] * (-1406.425) (-1414.139) (-1408.095) [-1400.781] -- 0:04:16
365000 -- [-1403.142] (-1413.296) (-1413.343) (-1403.220) * (-1407.936) (-1404.503) [-1404.470] (-1415.193) -- 0:04:15
Average standard deviation of split frequencies: 0.008372
365500 -- (-1410.481) (-1418.484) [-1402.586] (-1405.187) * (-1406.867) [-1398.162] (-1400.515) (-1407.122) -- 0:04:15
366000 -- (-1413.038) (-1407.425) (-1405.379) [-1407.411] * (-1415.819) (-1401.983) [-1412.672] (-1401.947) -- 0:04:16
366500 -- [-1403.551] (-1414.493) (-1410.147) (-1400.413) * [-1402.082] (-1399.994) (-1414.437) (-1415.559) -- 0:04:15
367000 -- (-1397.672) (-1413.944) (-1405.033) [-1407.126] * (-1403.679) [-1402.569] (-1408.563) (-1414.691) -- 0:04:15
367500 -- (-1402.032) (-1411.137) [-1411.032] (-1410.692) * (-1399.764) (-1408.038) (-1397.834) [-1401.705] -- 0:04:14
368000 -- (-1406.971) (-1409.378) (-1406.306) [-1406.208] * [-1407.041] (-1402.010) (-1413.851) (-1411.169) -- 0:04:14
368500 -- (-1412.519) (-1406.572) [-1412.117] (-1409.339) * (-1402.904) (-1413.035) (-1409.290) [-1418.604] -- 0:04:15
369000 -- (-1410.449) (-1409.746) (-1407.113) [-1394.902] * (-1406.187) (-1405.575) (-1405.458) [-1411.400] -- 0:04:14
369500 -- (-1408.698) [-1412.585] (-1412.519) (-1411.421) * [-1401.364] (-1407.119) (-1404.121) (-1401.351) -- 0:04:14
370000 -- (-1413.287) (-1411.558) [-1408.589] (-1401.653) * [-1397.254] (-1415.158) (-1418.502) (-1401.511) -- 0:04:13
Average standard deviation of split frequencies: 0.008982
370500 -- (-1405.473) (-1401.646) [-1399.238] (-1413.609) * [-1410.591] (-1414.334) (-1402.813) (-1412.159) -- 0:04:13
371000 -- [-1401.148] (-1404.796) (-1405.733) (-1408.961) * [-1403.074] (-1408.714) (-1405.001) (-1397.128) -- 0:04:14
371500 -- (-1413.643) (-1407.442) [-1401.472] (-1410.119) * (-1406.614) (-1413.424) (-1407.246) [-1399.418] -- 0:04:13
372000 -- (-1422.557) [-1407.871] (-1408.959) (-1412.863) * [-1401.590] (-1403.797) (-1422.671) (-1403.250) -- 0:04:13
372500 -- (-1409.010) [-1402.862] (-1412.590) (-1409.515) * [-1412.640] (-1405.906) (-1415.950) (-1412.544) -- 0:04:12
373000 -- [-1411.534] (-1419.180) (-1411.233) (-1406.806) * (-1408.431) (-1411.504) (-1409.075) [-1406.507] -- 0:04:12
373500 -- (-1414.854) [-1406.861] (-1414.063) (-1418.120) * [-1408.570] (-1406.787) (-1401.233) (-1408.970) -- 0:04:13
374000 -- (-1410.231) [-1397.794] (-1413.173) (-1411.727) * [-1406.493] (-1418.893) (-1408.125) (-1407.245) -- 0:04:12
374500 -- (-1412.774) (-1403.594) (-1402.675) [-1410.401] * (-1409.294) [-1402.556] (-1410.204) (-1413.059) -- 0:04:12
375000 -- [-1406.560] (-1403.332) (-1410.794) (-1408.725) * [-1396.779] (-1408.601) (-1406.195) (-1409.353) -- 0:04:11
Average standard deviation of split frequencies: 0.009246
375500 -- [-1403.875] (-1406.345) (-1417.639) (-1404.312) * (-1409.653) [-1415.365] (-1403.822) (-1416.996) -- 0:04:11
376000 -- [-1404.241] (-1403.116) (-1411.281) (-1408.995) * [-1407.053] (-1412.727) (-1399.053) (-1408.309) -- 0:04:12
376500 -- [-1396.708] (-1411.399) (-1402.825) (-1409.061) * (-1419.269) [-1407.099] (-1401.420) (-1415.165) -- 0:04:11
377000 -- (-1413.816) (-1401.215) [-1401.008] (-1417.191) * (-1409.139) (-1408.886) (-1404.335) [-1407.853] -- 0:04:11
377500 -- [-1399.531] (-1398.689) (-1405.108) (-1405.190) * (-1415.075) (-1408.302) [-1405.413] (-1403.451) -- 0:04:10
378000 -- (-1407.201) [-1404.472] (-1408.262) (-1412.495) * (-1413.259) (-1415.390) [-1405.838] (-1407.777) -- 0:04:10
378500 -- [-1404.222] (-1415.087) (-1397.028) (-1402.405) * (-1414.021) (-1417.230) (-1403.798) [-1405.694] -- 0:04:11
379000 -- [-1406.848] (-1416.108) (-1412.267) (-1403.782) * (-1413.443) (-1412.957) (-1412.378) [-1405.239] -- 0:04:10
379500 -- [-1400.452] (-1401.835) (-1401.693) (-1397.984) * (-1405.889) [-1398.042] (-1416.602) (-1401.367) -- 0:04:10
380000 -- (-1402.443) (-1400.041) (-1410.303) [-1403.001] * (-1418.019) [-1400.638] (-1402.921) (-1405.304) -- 0:04:09
Average standard deviation of split frequencies: 0.009210
380500 -- (-1406.483) [-1399.216] (-1412.942) (-1401.830) * (-1408.190) (-1416.811) (-1411.747) [-1404.495] -- 0:04:09
381000 -- (-1411.274) [-1398.977] (-1410.141) (-1408.648) * (-1401.925) (-1404.375) [-1406.805] (-1400.757) -- 0:04:08
381500 -- (-1406.103) (-1404.199) (-1406.588) [-1406.185] * (-1401.834) (-1403.443) [-1410.589] (-1404.575) -- 0:04:09
382000 -- (-1415.070) [-1401.598] (-1400.066) (-1423.457) * (-1409.805) [-1404.440] (-1406.552) (-1405.048) -- 0:04:09
382500 -- (-1406.784) [-1402.226] (-1402.826) (-1407.551) * (-1410.152) (-1410.975) [-1408.805] (-1410.847) -- 0:04:08
383000 -- [-1404.345] (-1405.318) (-1404.864) (-1411.194) * [-1405.144] (-1411.697) (-1407.585) (-1407.205) -- 0:04:08
383500 -- (-1406.179) (-1401.867) (-1414.191) [-1404.603] * (-1418.425) [-1409.374] (-1396.786) (-1407.538) -- 0:04:07
384000 -- (-1405.118) (-1404.382) [-1406.114] (-1409.614) * (-1408.200) (-1412.508) [-1397.991] (-1413.777) -- 0:04:08
384500 -- (-1407.528) (-1405.173) [-1397.632] (-1412.315) * (-1402.469) (-1402.195) (-1404.285) [-1400.204] -- 0:04:08
385000 -- (-1400.939) (-1405.368) [-1400.512] (-1401.351) * (-1400.973) (-1418.496) (-1403.903) [-1406.174] -- 0:04:07
Average standard deviation of split frequencies: 0.008091
385500 -- (-1413.981) [-1407.793] (-1398.966) (-1404.090) * (-1418.399) (-1407.963) [-1405.687] (-1407.376) -- 0:04:07
386000 -- [-1402.260] (-1405.158) (-1414.963) (-1405.016) * (-1412.589) (-1400.821) (-1406.898) [-1399.068] -- 0:04:06
386500 -- (-1416.274) (-1402.637) (-1427.816) [-1404.279] * (-1410.976) [-1396.303] (-1400.859) (-1413.911) -- 0:04:07
387000 -- (-1406.898) [-1400.379] (-1403.226) (-1408.056) * (-1408.199) [-1400.513] (-1408.100) (-1400.747) -- 0:04:07
387500 -- (-1415.890) (-1416.207) (-1405.231) [-1405.001] * [-1411.900] (-1402.346) (-1408.959) (-1405.775) -- 0:04:06
388000 -- (-1401.806) (-1415.363) [-1403.343] (-1403.705) * [-1407.174] (-1405.753) (-1404.529) (-1411.885) -- 0:04:06
388500 -- (-1398.869) (-1412.904) (-1409.580) [-1406.138] * [-1402.937] (-1410.732) (-1417.298) (-1410.261) -- 0:04:05
389000 -- [-1409.845] (-1425.222) (-1420.142) (-1397.251) * (-1400.008) (-1416.759) [-1405.960] (-1411.641) -- 0:04:06
389500 -- [-1399.574] (-1413.626) (-1408.600) (-1404.924) * (-1408.486) (-1407.073) [-1408.053] (-1413.638) -- 0:04:06
390000 -- [-1403.175] (-1427.348) (-1404.460) (-1403.343) * (-1411.149) (-1406.198) (-1404.249) [-1402.914] -- 0:04:05
Average standard deviation of split frequencies: 0.007240
390500 -- (-1400.340) (-1414.910) [-1400.803] (-1413.895) * [-1405.821] (-1412.999) (-1403.082) (-1407.804) -- 0:04:05
391000 -- (-1413.502) [-1406.089] (-1401.079) (-1401.262) * (-1408.139) [-1399.633] (-1402.187) (-1408.978) -- 0:04:04
391500 -- (-1414.390) (-1405.160) (-1412.250) [-1398.583] * (-1413.535) (-1406.340) [-1399.369] (-1408.204) -- 0:04:05
392000 -- (-1409.093) (-1404.962) (-1407.475) [-1410.002] * (-1417.416) (-1410.875) (-1402.863) [-1407.842] -- 0:04:05
392500 -- (-1423.889) [-1401.833] (-1400.366) (-1407.156) * (-1417.994) (-1412.733) (-1413.061) [-1411.345] -- 0:04:04
393000 -- (-1404.864) (-1408.629) [-1412.817] (-1410.146) * [-1397.755] (-1406.219) (-1409.446) (-1409.469) -- 0:04:04
393500 -- (-1402.509) (-1413.644) (-1408.404) [-1403.887] * (-1406.799) (-1403.435) (-1417.875) [-1408.336] -- 0:04:03
394000 -- (-1413.991) [-1400.953] (-1403.694) (-1410.833) * (-1417.804) (-1413.622) (-1413.029) [-1401.976] -- 0:04:04
394500 -- (-1401.635) (-1419.562) [-1404.984] (-1414.526) * [-1403.759] (-1406.938) (-1398.876) (-1399.311) -- 0:04:04
395000 -- [-1408.576] (-1406.567) (-1412.871) (-1412.646) * (-1410.533) (-1415.708) [-1405.367] (-1411.192) -- 0:04:03
Average standard deviation of split frequencies: 0.007812
395500 -- (-1405.460) (-1398.351) [-1412.810] (-1405.520) * (-1420.474) [-1406.775] (-1402.618) (-1403.382) -- 0:04:03
396000 -- (-1410.450) [-1407.357] (-1415.894) (-1409.988) * (-1410.548) (-1408.564) [-1405.841] (-1417.349) -- 0:04:02
396500 -- (-1413.888) (-1418.090) [-1407.591] (-1408.645) * (-1403.965) (-1406.401) [-1403.014] (-1420.338) -- 0:04:03
397000 -- (-1418.299) [-1405.542] (-1407.851) (-1406.586) * [-1409.666] (-1422.573) (-1406.938) (-1414.218) -- 0:04:03
397500 -- (-1416.185) [-1406.354] (-1403.831) (-1404.396) * (-1399.782) [-1413.977] (-1406.949) (-1406.935) -- 0:04:02
398000 -- (-1413.877) (-1400.842) (-1406.141) [-1410.432] * [-1417.152] (-1400.596) (-1398.240) (-1414.412) -- 0:04:02
398500 -- (-1409.754) (-1403.461) (-1405.929) [-1404.659] * (-1414.876) (-1417.485) [-1398.999] (-1410.918) -- 0:04:01
399000 -- (-1415.173) (-1413.872) [-1400.409] (-1413.349) * (-1411.633) [-1419.433] (-1411.790) (-1409.905) -- 0:04:02
399500 -- (-1410.147) (-1419.393) [-1407.924] (-1407.501) * (-1407.019) (-1409.947) [-1404.728] (-1410.834) -- 0:04:02
400000 -- (-1409.011) (-1424.587) [-1400.828] (-1399.143) * (-1407.966) (-1414.513) [-1408.366] (-1415.162) -- 0:04:01
Average standard deviation of split frequencies: 0.007868
400500 -- [-1405.674] (-1406.853) (-1404.692) (-1405.939) * (-1404.976) (-1414.869) (-1401.425) [-1410.885] -- 0:04:00
401000 -- (-1410.294) [-1405.483] (-1407.369) (-1409.088) * (-1405.011) [-1411.621] (-1411.075) (-1404.487) -- 0:04:00
401500 -- (-1403.319) (-1407.952) [-1401.851] (-1404.637) * (-1404.027) (-1411.443) [-1406.516] (-1419.910) -- 0:04:01
402000 -- (-1411.313) (-1411.474) [-1396.545] (-1403.673) * (-1408.147) (-1402.755) [-1405.639] (-1400.310) -- 0:04:00
402500 -- (-1412.026) (-1409.102) [-1405.909] (-1410.253) * (-1418.924) (-1405.129) [-1407.207] (-1401.619) -- 0:04:00
403000 -- (-1406.942) [-1397.352] (-1400.520) (-1407.599) * (-1414.487) [-1404.368] (-1397.832) (-1413.084) -- 0:03:59
403500 -- (-1415.125) (-1402.125) [-1404.634] (-1404.507) * [-1400.468] (-1406.438) (-1404.788) (-1407.932) -- 0:03:59
404000 -- (-1412.060) [-1408.005] (-1400.548) (-1411.810) * [-1409.354] (-1411.247) (-1417.210) (-1401.316) -- 0:04:00
404500 -- (-1417.012) [-1410.453] (-1401.024) (-1405.689) * (-1408.600) (-1403.532) (-1415.224) [-1407.832] -- 0:03:59
405000 -- (-1399.614) (-1409.728) (-1402.027) [-1402.957] * (-1411.810) (-1401.809) (-1400.079) [-1402.826] -- 0:03:59
Average standard deviation of split frequencies: 0.007475
405500 -- [-1408.900] (-1406.989) (-1404.699) (-1404.843) * (-1421.297) (-1408.867) (-1403.476) [-1403.633] -- 0:03:58
406000 -- (-1409.178) (-1405.878) (-1424.257) [-1408.728] * (-1410.797) (-1411.985) [-1400.146] (-1403.526) -- 0:03:58
406500 -- [-1406.368] (-1415.716) (-1409.137) (-1416.978) * (-1412.035) [-1411.039] (-1408.426) (-1412.474) -- 0:03:59
407000 -- (-1408.645) (-1408.920) (-1407.666) [-1416.628] * (-1407.521) (-1418.192) [-1399.848] (-1403.728) -- 0:03:58
407500 -- (-1400.639) [-1400.818] (-1416.752) (-1406.978) * [-1410.109] (-1403.579) (-1415.806) (-1409.839) -- 0:03:58
408000 -- (-1398.920) (-1409.293) [-1404.934] (-1408.437) * (-1402.608) [-1409.435] (-1411.415) (-1409.484) -- 0:03:57
408500 -- [-1410.267] (-1412.138) (-1412.299) (-1408.365) * (-1409.209) [-1415.104] (-1412.356) (-1405.483) -- 0:03:58
409000 -- (-1401.290) (-1402.440) [-1414.571] (-1412.676) * (-1417.432) (-1406.691) (-1394.899) [-1407.213] -- 0:03:58
409500 -- [-1404.500] (-1405.729) (-1407.559) (-1407.003) * (-1412.173) (-1402.456) (-1404.795) [-1410.011] -- 0:03:57
410000 -- (-1411.728) (-1417.291) (-1408.666) [-1408.192] * (-1406.395) (-1402.672) [-1402.372] (-1408.261) -- 0:03:57
Average standard deviation of split frequencies: 0.006959
410500 -- (-1399.975) [-1397.473] (-1422.263) (-1411.164) * (-1411.739) [-1402.778] (-1412.869) (-1405.492) -- 0:03:56
411000 -- (-1414.426) (-1405.572) [-1405.620] (-1416.245) * (-1411.226) [-1404.731] (-1415.946) (-1403.886) -- 0:03:57
411500 -- (-1410.532) (-1402.678) [-1398.194] (-1414.034) * (-1399.818) [-1398.751] (-1410.955) (-1399.832) -- 0:03:57
412000 -- [-1405.689] (-1394.526) (-1405.446) (-1416.776) * [-1400.886] (-1405.174) (-1405.313) (-1402.864) -- 0:03:56
412500 -- (-1406.368) (-1399.309) [-1410.327] (-1419.934) * (-1404.323) (-1409.502) [-1404.237] (-1404.493) -- 0:03:56
413000 -- [-1400.582] (-1405.761) (-1401.527) (-1414.926) * (-1395.382) [-1400.267] (-1420.159) (-1411.723) -- 0:03:55
413500 -- [-1402.104] (-1412.926) (-1411.434) (-1418.417) * (-1405.027) [-1403.137] (-1415.740) (-1415.150) -- 0:03:56
414000 -- (-1414.873) [-1408.917] (-1411.995) (-1419.447) * (-1410.159) [-1413.282] (-1407.842) (-1407.585) -- 0:03:56
414500 -- (-1406.805) [-1406.745] (-1410.810) (-1407.414) * (-1405.225) (-1406.420) [-1408.902] (-1413.545) -- 0:03:55
415000 -- (-1401.191) (-1409.670) [-1398.006] (-1413.579) * (-1406.127) [-1404.548] (-1407.063) (-1412.916) -- 0:03:55
Average standard deviation of split frequencies: 0.006445
415500 -- (-1405.882) (-1410.857) [-1394.521] (-1411.631) * (-1408.089) (-1406.393) [-1400.059] (-1407.550) -- 0:03:54
416000 -- (-1411.000) (-1413.836) [-1398.582] (-1414.325) * (-1409.255) (-1405.409) (-1408.880) [-1411.891] -- 0:03:55
416500 -- (-1404.582) (-1409.151) [-1404.033] (-1417.061) * [-1395.970] (-1405.733) (-1408.798) (-1428.327) -- 0:03:55
417000 -- (-1407.032) [-1408.921] (-1411.141) (-1412.705) * (-1400.712) [-1402.619] (-1405.227) (-1411.946) -- 0:03:54
417500 -- [-1406.422] (-1404.845) (-1412.685) (-1412.164) * (-1410.589) (-1401.884) (-1406.385) [-1404.088] -- 0:03:54
418000 -- (-1409.003) (-1406.015) (-1411.755) [-1402.354] * [-1407.022] (-1416.815) (-1412.437) (-1406.367) -- 0:03:53
418500 -- (-1401.153) [-1408.813] (-1402.311) (-1411.047) * (-1403.152) (-1417.890) (-1399.739) [-1402.165] -- 0:03:54
419000 -- (-1407.390) [-1404.652] (-1398.567) (-1402.484) * [-1412.240] (-1405.572) (-1410.686) (-1400.510) -- 0:03:54
419500 -- (-1421.359) (-1404.204) [-1399.778] (-1407.618) * (-1413.303) (-1418.424) (-1408.242) [-1405.032] -- 0:03:53
420000 -- (-1402.191) [-1400.409] (-1413.493) (-1442.010) * (-1413.635) (-1401.294) (-1403.635) [-1400.324] -- 0:03:53
Average standard deviation of split frequencies: 0.006864
420500 -- [-1399.874] (-1417.588) (-1404.094) (-1410.870) * (-1408.029) (-1408.501) [-1397.354] (-1408.057) -- 0:03:52
421000 -- (-1402.323) (-1408.272) (-1405.459) [-1409.430] * (-1411.587) [-1394.893] (-1401.131) (-1410.501) -- 0:03:52
421500 -- (-1405.286) (-1410.450) [-1404.979] (-1407.116) * (-1413.137) (-1405.590) (-1404.700) [-1400.583] -- 0:03:53
422000 -- (-1418.415) (-1413.883) [-1410.992] (-1410.091) * (-1415.021) (-1412.311) (-1403.141) [-1400.708] -- 0:03:52
422500 -- (-1405.558) (-1418.963) (-1421.125) [-1410.025] * (-1409.675) [-1414.043] (-1414.619) (-1408.686) -- 0:03:52
423000 -- (-1413.638) (-1410.685) (-1421.147) [-1402.469] * (-1416.625) (-1403.430) [-1400.388] (-1412.188) -- 0:03:51
423500 -- (-1419.870) (-1402.330) [-1410.596] (-1406.330) * [-1403.312] (-1411.220) (-1410.271) (-1411.249) -- 0:03:51
424000 -- (-1406.658) [-1411.171] (-1423.700) (-1397.916) * [-1411.287] (-1415.791) (-1407.317) (-1402.881) -- 0:03:52
424500 -- (-1402.471) (-1404.265) (-1418.436) [-1406.004] * (-1409.433) [-1403.365] (-1408.253) (-1405.613) -- 0:03:51
425000 -- (-1405.398) (-1406.086) [-1401.669] (-1407.065) * (-1409.566) (-1412.875) (-1405.274) [-1404.287] -- 0:03:51
Average standard deviation of split frequencies: 0.006225
425500 -- [-1414.237] (-1409.590) (-1402.812) (-1404.034) * (-1408.236) [-1403.482] (-1409.445) (-1418.035) -- 0:03:50
426000 -- (-1412.549) (-1405.849) (-1414.140) [-1399.250] * (-1398.950) [-1399.939] (-1412.208) (-1411.391) -- 0:03:50
426500 -- (-1409.859) (-1408.213) (-1420.828) [-1401.134] * (-1406.602) [-1409.887] (-1404.191) (-1401.717) -- 0:03:51
427000 -- (-1408.924) [-1406.473] (-1406.106) (-1403.318) * [-1403.478] (-1418.485) (-1404.617) (-1405.428) -- 0:03:50
427500 -- (-1408.895) (-1418.610) [-1408.857] (-1403.198) * (-1417.611) (-1408.577) [-1405.145] (-1415.052) -- 0:03:50
428000 -- (-1409.775) (-1399.318) (-1399.272) [-1397.104] * (-1412.260) (-1410.743) [-1416.540] (-1408.471) -- 0:03:49
428500 -- [-1413.244] (-1401.714) (-1404.904) (-1410.513) * (-1416.895) [-1397.467] (-1407.598) (-1407.808) -- 0:03:49
429000 -- [-1403.795] (-1411.119) (-1399.869) (-1399.044) * (-1410.611) (-1406.292) (-1416.020) [-1396.093] -- 0:03:50
429500 -- (-1401.687) [-1410.574] (-1409.894) (-1397.035) * (-1407.748) (-1414.268) [-1401.915] (-1415.969) -- 0:03:49
430000 -- (-1402.135) (-1405.014) (-1412.308) [-1399.065] * [-1407.603] (-1415.375) (-1411.980) (-1405.991) -- 0:03:49
Average standard deviation of split frequencies: 0.006841
430500 -- [-1401.384] (-1407.780) (-1415.651) (-1404.000) * (-1416.860) (-1404.652) [-1408.656] (-1405.937) -- 0:03:48
431000 -- (-1402.135) (-1406.756) (-1405.131) [-1397.220] * (-1412.122) (-1403.489) (-1400.003) [-1402.777] -- 0:03:49
431500 -- (-1400.215) [-1399.365] (-1411.651) (-1409.334) * (-1413.247) (-1404.208) (-1414.747) [-1397.614] -- 0:03:49
432000 -- (-1411.607) [-1404.696] (-1407.238) (-1401.227) * (-1411.594) [-1407.434] (-1408.650) (-1407.154) -- 0:03:48
432500 -- (-1407.344) [-1406.167] (-1405.228) (-1408.689) * (-1415.829) (-1405.176) (-1410.179) [-1407.949] -- 0:03:48
433000 -- (-1419.065) (-1408.698) (-1407.432) [-1403.466] * (-1411.061) (-1411.926) [-1408.256] (-1404.756) -- 0:03:47
433500 -- (-1406.839) (-1408.018) (-1411.176) [-1403.466] * [-1407.560] (-1407.581) (-1404.117) (-1410.985) -- 0:03:48
434000 -- (-1405.002) (-1399.409) [-1395.676] (-1405.309) * (-1414.727) [-1400.300] (-1413.997) (-1401.660) -- 0:03:48
434500 -- [-1401.546] (-1401.418) (-1408.634) (-1407.685) * (-1410.896) [-1410.700] (-1403.465) (-1405.174) -- 0:03:47
435000 -- [-1407.552] (-1398.117) (-1404.584) (-1422.894) * (-1411.754) (-1404.616) [-1404.561] (-1406.949) -- 0:03:47
Average standard deviation of split frequencies: 0.006690
435500 -- (-1413.536) (-1404.336) [-1398.504] (-1409.975) * [-1401.538] (-1408.073) (-1411.610) (-1406.945) -- 0:03:46
436000 -- (-1411.294) [-1407.221] (-1409.818) (-1411.258) * (-1401.888) [-1406.226] (-1409.401) (-1419.208) -- 0:03:47
436500 -- (-1406.878) (-1416.932) (-1406.919) [-1409.024] * (-1410.791) (-1417.625) (-1403.492) [-1405.894] -- 0:03:47
437000 -- (-1399.616) (-1413.117) (-1407.534) [-1416.554] * (-1414.315) (-1415.605) (-1405.905) [-1407.946] -- 0:03:46
437500 -- (-1408.889) (-1424.253) (-1409.583) [-1402.409] * (-1419.780) (-1403.782) (-1398.913) [-1400.096] -- 0:03:46
438000 -- [-1397.954] (-1422.518) (-1401.617) (-1404.593) * [-1403.639] (-1420.739) (-1404.605) (-1408.106) -- 0:03:45
438500 -- (-1411.871) (-1413.125) [-1408.809] (-1405.127) * (-1411.194) [-1402.976] (-1414.080) (-1408.109) -- 0:03:46
439000 -- (-1401.442) (-1416.791) (-1406.253) [-1399.863] * (-1409.149) (-1405.754) [-1403.691] (-1401.460) -- 0:03:46
439500 -- (-1407.144) (-1420.456) (-1412.041) [-1404.007] * (-1399.024) [-1409.144] (-1418.710) (-1422.775) -- 0:03:45
440000 -- [-1397.086] (-1429.267) (-1404.551) (-1410.033) * (-1418.925) (-1410.321) (-1407.102) [-1397.398] -- 0:03:45
Average standard deviation of split frequencies: 0.006953
440500 -- (-1402.408) (-1410.582) (-1403.386) [-1419.451] * (-1400.543) (-1412.180) [-1401.650] (-1403.787) -- 0:03:44
441000 -- (-1411.556) [-1417.019] (-1407.175) (-1400.015) * (-1426.828) (-1409.734) (-1407.735) [-1401.253] -- 0:03:45
441500 -- (-1417.696) (-1416.186) (-1412.504) [-1401.163] * (-1431.038) (-1406.586) [-1401.956] (-1411.406) -- 0:03:45
442000 -- (-1413.694) (-1408.300) (-1406.277) [-1399.646] * (-1407.255) (-1409.306) (-1408.733) [-1404.733] -- 0:03:44
442500 -- (-1408.011) (-1409.280) [-1409.684] (-1400.805) * (-1409.224) (-1398.756) (-1409.716) [-1405.152] -- 0:03:44
443000 -- (-1409.564) (-1404.419) (-1402.293) [-1400.736] * (-1414.110) (-1399.847) (-1404.953) [-1403.379] -- 0:03:43
443500 -- (-1401.690) [-1402.508] (-1419.819) (-1414.573) * (-1404.010) [-1407.632] (-1408.676) (-1403.419) -- 0:03:44
444000 -- (-1408.646) [-1409.619] (-1411.599) (-1409.147) * (-1410.626) (-1414.812) (-1401.569) [-1403.921] -- 0:03:44
444500 -- (-1403.553) (-1406.712) [-1406.731] (-1407.021) * [-1402.846] (-1410.522) (-1402.875) (-1417.173) -- 0:03:43
445000 -- (-1409.283) [-1400.724] (-1410.367) (-1411.566) * (-1406.781) (-1413.652) [-1401.978] (-1412.979) -- 0:03:43
Average standard deviation of split frequencies: 0.007531
445500 -- (-1409.278) (-1406.314) [-1403.377] (-1411.004) * (-1409.108) (-1404.990) [-1401.520] (-1415.947) -- 0:03:42
446000 -- (-1412.524) (-1429.542) (-1404.115) [-1404.111] * (-1405.326) (-1410.715) (-1403.506) [-1406.491] -- 0:03:43
446500 -- (-1414.406) [-1415.707] (-1410.510) (-1395.315) * (-1412.879) (-1410.097) (-1397.234) [-1397.190] -- 0:03:43
447000 -- (-1412.593) (-1405.560) (-1415.481) [-1398.307] * (-1401.223) (-1408.564) [-1406.715] (-1412.323) -- 0:03:42
447500 -- (-1416.665) (-1404.048) (-1408.564) [-1404.986] * (-1412.888) (-1405.269) [-1400.302] (-1403.990) -- 0:03:42
448000 -- (-1429.412) (-1406.368) [-1399.920] (-1409.069) * (-1408.388) (-1411.289) [-1395.447] (-1404.683) -- 0:03:41
448500 -- (-1416.882) [-1398.529] (-1409.681) (-1403.169) * (-1397.050) (-1420.184) (-1412.017) [-1398.970] -- 0:03:42
449000 -- (-1416.388) (-1412.121) [-1408.539] (-1405.649) * [-1400.946] (-1410.352) (-1411.763) (-1395.101) -- 0:03:42
449500 -- [-1403.626] (-1408.700) (-1404.251) (-1406.611) * [-1400.881] (-1407.068) (-1422.349) (-1399.238) -- 0:03:41
450000 -- (-1401.964) (-1408.773) [-1393.441] (-1407.381) * (-1403.610) (-1405.733) (-1409.600) [-1407.481] -- 0:03:41
Average standard deviation of split frequencies: 0.007649
450500 -- (-1405.324) (-1409.623) (-1402.798) [-1403.748] * (-1414.967) (-1406.928) (-1415.579) [-1400.038] -- 0:03:40
451000 -- (-1411.472) (-1402.018) [-1402.481] (-1406.150) * (-1407.429) [-1396.418] (-1406.455) (-1416.888) -- 0:03:41
451500 -- (-1409.901) (-1411.335) [-1398.675] (-1404.377) * (-1412.049) (-1405.871) [-1402.580] (-1418.037) -- 0:03:41
452000 -- [-1411.381] (-1403.486) (-1408.720) (-1405.287) * (-1402.972) [-1401.901] (-1395.861) (-1422.697) -- 0:03:40
452500 -- (-1414.174) (-1412.163) (-1424.140) [-1404.705] * (-1402.963) (-1408.139) [-1406.871] (-1416.959) -- 0:03:40
453000 -- (-1407.327) (-1421.075) (-1407.912) [-1405.889] * [-1395.005] (-1406.035) (-1407.101) (-1406.172) -- 0:03:39
453500 -- (-1411.842) (-1409.143) (-1411.606) [-1402.447] * [-1402.491] (-1413.404) (-1407.209) (-1407.124) -- 0:03:40
454000 -- [-1400.708] (-1405.800) (-1400.011) (-1402.616) * (-1404.955) (-1413.443) (-1404.838) [-1400.345] -- 0:03:40
454500 -- (-1412.490) (-1405.299) [-1393.138] (-1413.083) * [-1402.836] (-1404.677) (-1415.397) (-1411.064) -- 0:03:39
455000 -- (-1402.579) [-1413.465] (-1396.969) (-1406.443) * [-1404.617] (-1412.477) (-1410.971) (-1408.755) -- 0:03:39
Average standard deviation of split frequencies: 0.007818
455500 -- [-1400.173] (-1404.549) (-1403.592) (-1418.917) * (-1402.292) (-1414.130) (-1410.849) [-1413.177] -- 0:03:38
456000 -- [-1399.802] (-1408.031) (-1399.832) (-1408.900) * [-1410.043] (-1413.903) (-1410.136) (-1412.296) -- 0:03:39
456500 -- [-1402.857] (-1409.489) (-1403.872) (-1405.785) * [-1404.263] (-1415.764) (-1403.268) (-1410.541) -- 0:03:39
457000 -- (-1405.364) [-1406.640] (-1410.998) (-1407.404) * (-1403.320) (-1414.481) [-1400.493] (-1414.078) -- 0:03:38
457500 -- (-1404.287) (-1405.369) (-1404.724) [-1396.661] * [-1400.412] (-1415.631) (-1410.955) (-1415.708) -- 0:03:38
458000 -- (-1405.885) [-1404.539] (-1409.046) (-1406.464) * [-1402.365] (-1415.672) (-1416.614) (-1413.796) -- 0:03:37
458500 -- (-1409.810) [-1412.099] (-1409.755) (-1416.920) * (-1410.240) (-1420.052) [-1411.576] (-1400.495) -- 0:03:38
459000 -- (-1407.958) (-1407.465) [-1408.942] (-1415.651) * (-1415.342) (-1420.546) [-1403.431] (-1401.927) -- 0:03:38
459500 -- (-1400.907) (-1416.079) [-1400.959] (-1407.124) * (-1421.641) (-1420.424) (-1395.672) [-1408.961] -- 0:03:37
460000 -- (-1402.362) [-1411.349] (-1406.016) (-1414.310) * (-1415.430) [-1405.615] (-1401.994) (-1410.757) -- 0:03:37
Average standard deviation of split frequencies: 0.007867
460500 -- (-1411.816) (-1414.015) [-1400.771] (-1417.463) * [-1407.248] (-1416.655) (-1407.156) (-1410.461) -- 0:03:37
461000 -- (-1429.552) (-1414.117) [-1402.013] (-1406.604) * (-1411.765) (-1409.022) [-1398.327] (-1400.670) -- 0:03:37
461500 -- (-1421.281) (-1417.216) (-1401.383) [-1395.667] * (-1411.010) (-1418.467) (-1404.691) [-1409.083] -- 0:03:37
462000 -- (-1418.543) (-1410.354) (-1406.735) [-1401.136] * (-1415.539) (-1404.628) (-1412.563) [-1399.675] -- 0:03:36
462500 -- (-1414.853) (-1402.628) [-1408.169] (-1409.922) * (-1403.599) (-1416.245) (-1407.394) [-1402.302] -- 0:03:36
463000 -- (-1404.510) [-1409.711] (-1406.415) (-1402.006) * (-1416.070) (-1403.894) [-1405.262] (-1409.408) -- 0:03:36
463500 -- (-1412.343) (-1409.793) (-1403.680) [-1403.416] * (-1416.229) [-1407.096] (-1407.607) (-1408.961) -- 0:03:36
464000 -- [-1405.591] (-1404.540) (-1401.769) (-1407.684) * (-1407.342) [-1402.107] (-1410.986) (-1415.031) -- 0:03:36
464500 -- (-1406.548) (-1404.963) (-1405.142) [-1400.407] * (-1411.461) [-1404.855] (-1411.358) (-1424.455) -- 0:03:35
465000 -- (-1414.577) (-1403.791) [-1404.046] (-1418.385) * (-1416.166) (-1402.012) [-1410.594] (-1412.754) -- 0:03:36
Average standard deviation of split frequencies: 0.007840
465500 -- [-1399.886] (-1397.214) (-1403.798) (-1410.091) * (-1407.823) [-1401.650] (-1411.381) (-1404.791) -- 0:03:35
466000 -- (-1403.313) [-1400.510] (-1400.253) (-1403.662) * (-1399.768) (-1406.857) [-1403.413] (-1408.414) -- 0:03:35
466500 -- (-1394.460) (-1412.921) [-1399.440] (-1408.683) * (-1400.595) (-1408.757) [-1399.495] (-1411.349) -- 0:03:35
467000 -- [-1398.649] (-1405.857) (-1403.194) (-1395.712) * (-1408.748) (-1406.131) [-1404.630] (-1408.630) -- 0:03:34
467500 -- (-1406.283) (-1409.372) [-1403.939] (-1413.376) * (-1404.800) (-1420.511) (-1408.354) [-1403.102] -- 0:03:35
468000 -- (-1411.034) (-1411.790) [-1395.962] (-1410.973) * [-1407.356] (-1415.754) (-1405.434) (-1408.433) -- 0:03:34
468500 -- (-1412.786) (-1412.054) (-1407.890) [-1395.279] * (-1400.573) (-1413.849) (-1404.359) [-1410.780] -- 0:03:34
469000 -- (-1409.238) [-1408.509] (-1404.348) (-1403.819) * [-1398.730] (-1413.987) (-1406.992) (-1416.141) -- 0:03:33
469500 -- (-1418.137) (-1407.782) (-1412.292) [-1398.799] * (-1408.298) (-1407.344) [-1404.664] (-1416.588) -- 0:03:33
470000 -- (-1402.253) (-1403.577) (-1405.826) [-1404.126] * (-1406.727) (-1406.089) [-1405.841] (-1398.482) -- 0:03:34
Average standard deviation of split frequencies: 0.008200
470500 -- (-1404.127) [-1399.643] (-1411.128) (-1404.358) * (-1409.302) [-1405.375] (-1409.693) (-1414.383) -- 0:03:33
471000 -- (-1401.520) (-1411.279) (-1397.523) [-1396.783] * (-1415.784) [-1408.418] (-1405.470) (-1407.841) -- 0:03:33
471500 -- (-1410.046) (-1405.666) [-1402.895] (-1399.540) * (-1410.890) [-1399.019] (-1402.174) (-1411.992) -- 0:03:32
472000 -- (-1412.117) (-1409.967) [-1405.949] (-1407.264) * (-1419.612) [-1398.687] (-1399.190) (-1407.761) -- 0:03:32
472500 -- (-1409.396) (-1413.719) [-1414.199] (-1405.953) * (-1410.746) (-1413.615) [-1401.463] (-1411.700) -- 0:03:33
473000 -- [-1410.906] (-1412.637) (-1423.144) (-1399.039) * (-1410.764) (-1403.300) (-1410.148) [-1414.745] -- 0:03:32
473500 -- (-1406.241) (-1412.204) (-1414.423) [-1408.077] * (-1413.927) (-1409.098) (-1404.990) [-1397.863] -- 0:03:32
474000 -- (-1398.849) [-1408.277] (-1399.387) (-1414.935) * (-1416.032) (-1405.824) (-1402.604) [-1402.787] -- 0:03:31
474500 -- (-1397.815) (-1401.072) [-1411.053] (-1421.589) * (-1402.419) (-1408.744) (-1407.976) [-1411.504] -- 0:03:31
475000 -- (-1398.899) (-1404.687) (-1409.696) [-1408.799] * (-1407.465) (-1406.684) (-1399.191) [-1413.762] -- 0:03:32
Average standard deviation of split frequencies: 0.008294
475500 -- (-1408.720) (-1412.564) (-1417.071) [-1407.555] * [-1408.289] (-1405.068) (-1410.259) (-1410.486) -- 0:03:31
476000 -- (-1406.739) [-1405.896] (-1410.923) (-1409.332) * (-1401.084) (-1404.591) (-1415.424) [-1403.874] -- 0:03:31
476500 -- [-1401.175] (-1406.741) (-1396.765) (-1414.898) * (-1413.942) (-1405.788) (-1417.655) [-1407.770] -- 0:03:30
477000 -- [-1396.761] (-1408.833) (-1404.575) (-1419.953) * (-1429.918) [-1406.467] (-1409.737) (-1407.919) -- 0:03:30
477500 -- (-1400.108) (-1401.794) [-1407.341] (-1408.311) * [-1411.928] (-1408.053) (-1406.845) (-1404.892) -- 0:03:31
478000 -- [-1402.292] (-1406.514) (-1405.459) (-1406.296) * (-1398.174) (-1402.551) (-1415.994) [-1415.052] -- 0:03:30
478500 -- [-1393.122] (-1413.941) (-1408.085) (-1410.375) * (-1404.175) (-1415.007) [-1402.148] (-1408.800) -- 0:03:30
479000 -- (-1405.071) (-1411.586) (-1412.987) [-1406.416] * (-1409.702) [-1404.622] (-1413.856) (-1405.210) -- 0:03:29
479500 -- (-1402.868) [-1413.468] (-1407.497) (-1405.085) * (-1406.081) (-1409.671) (-1399.251) [-1397.369] -- 0:03:29
480000 -- (-1408.103) (-1418.429) (-1405.016) [-1409.381] * (-1400.537) (-1410.376) [-1407.450] (-1405.806) -- 0:03:30
Average standard deviation of split frequencies: 0.009133
480500 -- [-1402.068] (-1417.342) (-1400.360) (-1409.255) * (-1405.026) (-1417.686) [-1404.148] (-1419.841) -- 0:03:29
481000 -- [-1411.118] (-1411.300) (-1405.198) (-1405.094) * (-1403.424) (-1405.165) (-1407.569) [-1407.635] -- 0:03:29
481500 -- (-1420.611) [-1399.166] (-1403.825) (-1409.330) * (-1410.399) (-1401.802) [-1396.975] (-1410.537) -- 0:03:28
482000 -- (-1413.801) [-1403.323] (-1408.231) (-1398.103) * (-1407.302) [-1406.978] (-1415.175) (-1410.941) -- 0:03:28
482500 -- (-1419.905) (-1402.472) [-1404.555] (-1400.241) * (-1407.745) [-1408.689] (-1415.956) (-1402.690) -- 0:03:29
483000 -- (-1413.786) (-1400.171) (-1403.469) [-1403.417] * (-1411.971) (-1400.110) [-1404.203] (-1414.014) -- 0:03:28
483500 -- (-1411.585) [-1412.835] (-1406.487) (-1410.311) * (-1412.259) (-1409.240) (-1406.785) [-1399.778] -- 0:03:28
484000 -- (-1416.718) (-1410.290) (-1406.479) [-1397.956] * (-1420.495) (-1405.887) (-1411.431) [-1405.079] -- 0:03:27
484500 -- (-1415.384) (-1411.371) (-1401.218) [-1401.788] * (-1418.069) [-1394.850] (-1413.378) (-1413.885) -- 0:03:27
485000 -- (-1402.731) [-1406.663] (-1398.708) (-1407.521) * (-1412.661) (-1403.098) (-1410.149) [-1404.692] -- 0:03:28
Average standard deviation of split frequencies: 0.009154
485500 -- (-1402.478) [-1403.401] (-1400.755) (-1419.580) * (-1424.469) (-1410.844) (-1403.627) [-1409.670] -- 0:03:27
486000 -- (-1403.382) (-1401.054) (-1414.708) [-1405.597] * (-1416.191) [-1403.999] (-1410.210) (-1403.417) -- 0:03:27
486500 -- [-1399.784] (-1407.496) (-1405.454) (-1407.956) * [-1401.127] (-1412.854) (-1415.571) (-1429.467) -- 0:03:26
487000 -- [-1401.637] (-1407.108) (-1407.456) (-1417.556) * (-1418.509) (-1407.245) [-1406.638] (-1406.103) -- 0:03:26
487500 -- (-1401.869) (-1414.551) [-1401.971] (-1413.936) * (-1414.832) [-1406.808] (-1411.956) (-1409.235) -- 0:03:27
488000 -- (-1399.683) (-1407.684) [-1402.703] (-1411.539) * (-1412.712) [-1403.522] (-1406.431) (-1405.330) -- 0:03:26
488500 -- (-1400.575) (-1402.189) [-1402.245] (-1412.331) * (-1415.412) [-1412.217] (-1419.048) (-1412.019) -- 0:03:26
489000 -- (-1413.658) [-1399.772] (-1403.009) (-1412.647) * [-1407.049] (-1415.870) (-1407.085) (-1408.385) -- 0:03:25
489500 -- (-1404.964) (-1405.668) (-1409.190) [-1407.531] * (-1406.827) (-1406.901) (-1405.872) [-1402.340] -- 0:03:25
490000 -- (-1411.151) [-1410.057] (-1414.405) (-1412.256) * (-1411.533) (-1406.296) [-1401.406] (-1403.759) -- 0:03:26
Average standard deviation of split frequencies: 0.008827
490500 -- (-1408.675) (-1410.830) (-1405.099) [-1408.097] * (-1414.140) (-1409.109) (-1404.769) [-1406.989] -- 0:03:25
491000 -- [-1417.475] (-1412.301) (-1416.134) (-1405.941) * (-1411.486) [-1403.461] (-1407.589) (-1405.278) -- 0:03:25
491500 -- [-1397.979] (-1408.396) (-1411.425) (-1407.063) * (-1406.972) (-1402.929) (-1416.822) [-1400.621] -- 0:03:24
492000 -- (-1401.756) (-1407.335) (-1399.459) [-1405.747] * (-1403.491) (-1412.135) (-1409.992) [-1405.591] -- 0:03:24
492500 -- [-1401.439] (-1407.689) (-1405.642) (-1413.468) * [-1399.667] (-1412.382) (-1408.318) (-1407.431) -- 0:03:25
493000 -- [-1413.904] (-1408.178) (-1422.146) (-1399.409) * (-1415.205) (-1401.470) (-1410.864) [-1398.401] -- 0:03:24
493500 -- (-1418.270) [-1408.626] (-1412.840) (-1411.598) * (-1404.666) [-1406.407] (-1401.261) (-1405.472) -- 0:03:24
494000 -- (-1408.670) [-1406.254] (-1414.539) (-1408.012) * (-1404.789) (-1415.094) (-1409.499) [-1407.863] -- 0:03:23
494500 -- [-1402.958] (-1401.178) (-1410.648) (-1408.030) * [-1401.296] (-1419.533) (-1417.332) (-1401.486) -- 0:03:23
495000 -- [-1405.696] (-1399.368) (-1421.082) (-1415.127) * (-1404.445) (-1413.099) (-1408.479) [-1399.647] -- 0:03:24
Average standard deviation of split frequencies: 0.008494
495500 -- (-1409.147) [-1403.578] (-1407.953) (-1409.567) * [-1403.143] (-1415.030) (-1409.177) (-1414.975) -- 0:03:23
496000 -- [-1413.215] (-1401.706) (-1411.129) (-1415.491) * (-1410.178) [-1405.950] (-1407.998) (-1403.746) -- 0:03:23
496500 -- (-1413.462) [-1395.957] (-1410.929) (-1414.270) * (-1408.937) (-1409.811) [-1399.373] (-1406.458) -- 0:03:22
497000 -- (-1415.241) (-1408.635) (-1409.428) [-1405.680] * (-1414.827) [-1406.702] (-1400.675) (-1413.032) -- 0:03:22
497500 -- [-1398.585] (-1407.647) (-1403.994) (-1411.890) * (-1400.540) (-1409.486) [-1406.689] (-1411.066) -- 0:03:23
498000 -- (-1410.419) (-1399.716) [-1403.079] (-1420.024) * [-1396.889] (-1400.678) (-1399.556) (-1410.826) -- 0:03:22
498500 -- (-1405.537) [-1414.437] (-1405.929) (-1420.985) * [-1407.390] (-1409.686) (-1407.350) (-1420.417) -- 0:03:22
499000 -- (-1404.260) (-1414.360) [-1402.088] (-1414.006) * (-1402.334) (-1407.882) [-1403.277] (-1408.702) -- 0:03:21
499500 -- (-1416.729) (-1407.244) [-1402.558] (-1420.356) * (-1422.051) (-1406.862) (-1417.972) [-1403.336] -- 0:03:21
500000 -- (-1418.140) (-1413.738) [-1404.924] (-1408.941) * (-1415.636) (-1410.213) [-1404.868] (-1409.279) -- 0:03:22
Average standard deviation of split frequencies: 0.008768
500500 -- (-1421.045) (-1412.322) [-1398.259] (-1410.260) * (-1414.258) [-1404.762] (-1408.531) (-1406.357) -- 0:03:21
501000 -- (-1412.795) [-1411.638] (-1407.701) (-1404.229) * (-1411.074) [-1407.738] (-1430.003) (-1409.849) -- 0:03:21
501500 -- [-1406.922] (-1412.906) (-1410.456) (-1405.271) * (-1406.823) [-1412.582] (-1419.781) (-1414.149) -- 0:03:20
502000 -- (-1418.337) [-1406.800] (-1410.276) (-1409.604) * (-1410.254) [-1400.031] (-1406.197) (-1411.346) -- 0:03:20
502500 -- (-1407.116) [-1407.396] (-1407.575) (-1412.008) * (-1399.222) (-1402.934) [-1408.006] (-1415.438) -- 0:03:20
503000 -- [-1403.187] (-1402.354) (-1407.587) (-1398.756) * (-1411.624) [-1400.470] (-1413.653) (-1411.032) -- 0:03:20
503500 -- (-1398.135) [-1401.461] (-1411.478) (-1405.323) * (-1408.251) (-1402.550) [-1408.329] (-1402.155) -- 0:03:20
504000 -- (-1409.890) [-1406.671] (-1409.706) (-1414.303) * (-1403.732) (-1429.482) (-1423.656) [-1401.986] -- 0:03:19
504500 -- (-1402.953) (-1402.496) (-1402.441) [-1405.365] * [-1403.607] (-1426.206) (-1417.243) (-1404.919) -- 0:03:19
505000 -- (-1414.318) (-1410.585) (-1408.013) [-1402.307] * [-1413.459] (-1413.968) (-1410.743) (-1403.551) -- 0:03:19
Average standard deviation of split frequencies: 0.008326
505500 -- (-1411.119) (-1404.847) (-1419.306) [-1404.876] * (-1410.320) (-1407.878) [-1411.031] (-1403.265) -- 0:03:19
506000 -- [-1405.219] (-1407.866) (-1413.515) (-1406.095) * (-1410.877) (-1410.768) (-1402.093) [-1399.986] -- 0:03:19
506500 -- [-1408.338] (-1432.918) (-1414.537) (-1410.371) * (-1404.257) (-1418.287) [-1404.906] (-1403.869) -- 0:03:18
507000 -- [-1402.432] (-1419.421) (-1413.541) (-1409.763) * (-1402.966) (-1408.884) (-1408.408) [-1407.582] -- 0:03:18
507500 -- (-1418.214) (-1417.011) (-1412.756) [-1408.870] * (-1408.346) [-1397.475] (-1411.076) (-1405.118) -- 0:03:18
508000 -- (-1409.386) (-1410.170) (-1405.793) [-1401.813] * [-1412.910] (-1415.475) (-1416.776) (-1408.065) -- 0:03:18
508500 -- [-1401.024] (-1410.729) (-1420.021) (-1409.408) * [-1400.422] (-1403.209) (-1408.347) (-1399.665) -- 0:03:18
509000 -- [-1408.726] (-1405.229) (-1409.695) (-1397.365) * [-1411.361] (-1412.094) (-1404.025) (-1421.309) -- 0:03:17
509500 -- (-1408.419) (-1404.454) (-1412.158) [-1400.979] * [-1405.735] (-1409.315) (-1411.441) (-1414.336) -- 0:03:17
510000 -- (-1412.828) [-1403.755] (-1408.340) (-1399.911) * (-1410.031) [-1404.367] (-1413.937) (-1401.822) -- 0:03:17
Average standard deviation of split frequencies: 0.007789
510500 -- (-1406.456) [-1404.717] (-1414.040) (-1416.773) * (-1418.151) (-1403.939) [-1405.015] (-1427.224) -- 0:03:17
511000 -- (-1412.817) (-1412.810) (-1411.234) [-1405.554] * (-1414.014) [-1407.780] (-1412.337) (-1421.242) -- 0:03:17
511500 -- (-1403.235) (-1405.799) [-1410.301] (-1412.077) * (-1404.114) (-1411.430) [-1394.129] (-1413.663) -- 0:03:16
512000 -- (-1409.250) [-1402.704] (-1407.497) (-1402.998) * [-1397.362] (-1403.426) (-1403.745) (-1419.153) -- 0:03:16
512500 -- (-1412.797) (-1406.042) [-1417.476] (-1408.260) * [-1405.011] (-1403.746) (-1404.007) (-1408.389) -- 0:03:16
513000 -- [-1396.820] (-1399.276) (-1414.907) (-1410.485) * (-1409.016) (-1405.625) (-1399.727) [-1405.676] -- 0:03:16
513500 -- [-1396.065] (-1414.562) (-1405.482) (-1419.836) * (-1416.535) (-1401.804) (-1400.693) [-1400.421] -- 0:03:16
514000 -- (-1413.947) (-1419.570) (-1410.106) [-1403.196] * [-1405.295] (-1407.462) (-1401.917) (-1411.236) -- 0:03:15
514500 -- (-1402.778) (-1415.998) [-1405.466] (-1402.534) * (-1403.772) (-1397.471) (-1401.492) [-1412.491] -- 0:03:15
515000 -- (-1400.821) (-1411.596) (-1409.651) [-1409.279] * (-1413.426) (-1411.239) (-1406.112) [-1396.891] -- 0:03:15
Average standard deviation of split frequencies: 0.007880
515500 -- [-1403.168] (-1417.867) (-1415.616) (-1413.039) * (-1407.128) (-1411.951) (-1405.635) [-1406.977] -- 0:03:15
516000 -- (-1413.525) [-1401.857] (-1404.384) (-1403.382) * (-1407.448) [-1404.066] (-1411.089) (-1403.926) -- 0:03:15
516500 -- (-1401.196) (-1406.453) [-1403.505] (-1401.351) * (-1410.464) (-1421.007) [-1399.450] (-1407.964) -- 0:03:14
517000 -- (-1404.337) (-1414.878) (-1410.186) [-1410.266] * (-1407.516) [-1401.818] (-1404.842) (-1403.997) -- 0:03:14
517500 -- [-1408.589] (-1413.074) (-1416.616) (-1394.722) * (-1414.113) (-1416.036) (-1400.405) [-1408.533] -- 0:03:14
518000 -- (-1401.790) (-1415.174) (-1404.612) [-1401.028] * (-1412.082) [-1408.256] (-1408.303) (-1415.266) -- 0:03:14
518500 -- (-1414.993) (-1410.847) [-1403.141] (-1405.557) * (-1412.304) [-1405.872] (-1399.357) (-1397.416) -- 0:03:14
519000 -- (-1402.863) (-1411.655) [-1404.955] (-1397.151) * (-1407.160) [-1409.349] (-1402.647) (-1415.180) -- 0:03:13
519500 -- (-1407.590) (-1406.544) [-1409.662] (-1403.343) * [-1403.333] (-1406.398) (-1403.447) (-1403.422) -- 0:03:13
520000 -- (-1409.570) (-1405.422) (-1413.317) [-1409.273] * [-1396.794] (-1406.333) (-1408.637) (-1411.063) -- 0:03:13
Average standard deviation of split frequencies: 0.008375
520500 -- [-1399.866] (-1401.255) (-1411.819) (-1410.049) * (-1407.754) (-1409.773) [-1400.273] (-1408.395) -- 0:03:13
521000 -- (-1412.627) (-1413.495) [-1403.865] (-1400.020) * (-1395.779) (-1408.611) [-1406.388] (-1407.038) -- 0:03:13
521500 -- (-1414.195) (-1429.031) (-1407.592) [-1408.771] * (-1402.003) [-1404.500] (-1405.733) (-1410.731) -- 0:03:12
522000 -- (-1411.441) (-1413.828) (-1404.926) [-1402.267] * (-1398.012) [-1402.147] (-1412.427) (-1408.046) -- 0:03:12
522500 -- (-1403.678) (-1407.130) [-1404.822] (-1414.331) * (-1406.524) (-1411.484) [-1405.228] (-1417.311) -- 0:03:12
523000 -- (-1399.604) (-1410.326) (-1421.432) [-1404.131] * (-1409.607) (-1406.589) (-1409.237) [-1412.479] -- 0:03:12
523500 -- (-1414.945) (-1417.182) (-1417.141) [-1396.961] * [-1393.784] (-1407.603) (-1405.705) (-1422.602) -- 0:03:12
524000 -- [-1406.061] (-1411.926) (-1423.028) (-1417.271) * (-1402.505) (-1406.273) (-1402.972) [-1404.855] -- 0:03:11
524500 -- (-1407.150) [-1410.306] (-1421.372) (-1408.293) * (-1416.041) (-1404.400) (-1404.771) [-1399.246] -- 0:03:11
525000 -- [-1407.275] (-1412.692) (-1408.856) (-1409.513) * (-1411.570) (-1412.849) (-1406.447) [-1397.847] -- 0:03:11
Average standard deviation of split frequencies: 0.008122
525500 -- (-1410.482) (-1410.645) [-1404.514] (-1410.104) * (-1418.546) (-1431.443) [-1401.902] (-1407.012) -- 0:03:11
526000 -- (-1412.935) [-1407.528] (-1407.508) (-1407.206) * [-1403.020] (-1429.718) (-1403.936) (-1404.351) -- 0:03:11
526500 -- [-1396.060] (-1407.856) (-1405.779) (-1406.358) * [-1403.474] (-1420.275) (-1412.137) (-1408.134) -- 0:03:10
527000 -- (-1401.444) (-1404.993) [-1408.251] (-1402.512) * (-1411.812) (-1408.314) (-1414.998) [-1398.747] -- 0:03:10
527500 -- (-1401.059) (-1410.281) [-1399.562] (-1411.571) * (-1402.394) (-1410.862) (-1404.827) [-1406.360] -- 0:03:10
528000 -- (-1409.194) (-1408.885) [-1403.695] (-1408.384) * (-1408.618) (-1400.414) (-1403.295) [-1403.793] -- 0:03:10
528500 -- (-1413.408) (-1411.814) [-1405.945] (-1409.742) * (-1402.934) [-1399.038] (-1415.826) (-1407.619) -- 0:03:10
529000 -- (-1413.076) [-1403.473] (-1404.489) (-1405.311) * (-1411.659) (-1406.906) (-1400.588) [-1403.561] -- 0:03:09
529500 -- (-1413.944) [-1405.715] (-1404.709) (-1411.874) * (-1407.672) (-1431.230) (-1404.498) [-1405.714] -- 0:03:09
530000 -- (-1409.024) (-1408.775) [-1410.000] (-1403.390) * (-1400.259) (-1415.526) [-1406.448] (-1411.567) -- 0:03:09
Average standard deviation of split frequencies: 0.007995
530500 -- (-1415.188) (-1405.608) [-1403.069] (-1404.695) * (-1414.757) (-1413.258) [-1413.755] (-1408.366) -- 0:03:09
531000 -- (-1410.751) (-1407.807) [-1408.592] (-1400.011) * (-1412.775) [-1404.327] (-1412.037) (-1408.277) -- 0:03:09
531500 -- (-1413.617) (-1404.179) [-1411.160] (-1415.082) * (-1414.338) [-1400.433] (-1405.045) (-1404.236) -- 0:03:08
532000 -- (-1407.535) (-1403.320) (-1406.027) [-1408.048] * [-1407.975] (-1409.447) (-1416.533) (-1404.464) -- 0:03:08
532500 -- (-1404.901) (-1403.921) [-1404.225] (-1405.984) * [-1400.061] (-1415.005) (-1409.496) (-1403.108) -- 0:03:08
533000 -- (-1407.957) [-1405.860] (-1404.351) (-1410.527) * (-1408.156) [-1401.110] (-1403.894) (-1404.721) -- 0:03:08
533500 -- (-1409.486) (-1400.245) (-1404.119) [-1408.727] * (-1406.473) [-1398.241] (-1402.868) (-1411.894) -- 0:03:07
534000 -- [-1402.832] (-1408.036) (-1402.635) (-1401.456) * (-1401.101) (-1401.784) (-1409.978) [-1399.000] -- 0:03:07
534500 -- [-1404.500] (-1401.528) (-1413.494) (-1404.861) * (-1403.413) (-1396.911) [-1407.792] (-1410.601) -- 0:03:07
535000 -- (-1411.011) (-1412.949) [-1407.605] (-1414.002) * (-1401.671) [-1397.123] (-1405.291) (-1413.131) -- 0:03:07
Average standard deviation of split frequencies: 0.008410
535500 -- [-1399.691] (-1416.002) (-1411.576) (-1401.423) * [-1406.471] (-1407.557) (-1405.354) (-1403.335) -- 0:03:07
536000 -- (-1408.467) (-1409.951) [-1408.265] (-1408.165) * [-1404.963] (-1416.205) (-1401.760) (-1401.047) -- 0:03:06
536500 -- (-1407.867) [-1406.583] (-1402.102) (-1416.455) * (-1422.486) [-1408.049] (-1406.084) (-1404.128) -- 0:03:06
537000 -- (-1406.910) (-1403.622) (-1399.078) [-1406.688] * (-1408.243) [-1398.740] (-1404.958) (-1408.471) -- 0:03:06
537500 -- (-1408.607) (-1411.438) (-1411.021) [-1403.131] * (-1419.781) (-1406.302) [-1406.640] (-1407.198) -- 0:03:06
538000 -- (-1407.350) (-1419.624) (-1408.294) [-1403.066] * (-1417.135) (-1401.779) (-1406.540) [-1412.766] -- 0:03:06
538500 -- [-1398.696] (-1406.369) (-1408.205) (-1402.326) * (-1416.311) [-1408.912] (-1413.065) (-1412.180) -- 0:03:05
539000 -- [-1403.190] (-1409.301) (-1411.764) (-1403.634) * [-1401.590] (-1411.844) (-1415.963) (-1400.478) -- 0:03:05
539500 -- (-1397.777) [-1403.361] (-1422.986) (-1410.468) * [-1401.677] (-1409.125) (-1411.371) (-1402.079) -- 0:03:05
540000 -- [-1408.348] (-1417.118) (-1416.213) (-1402.075) * (-1398.042) (-1403.893) [-1403.335] (-1396.317) -- 0:03:05
Average standard deviation of split frequencies: 0.008337
540500 -- (-1403.406) [-1393.145] (-1402.938) (-1408.920) * [-1405.586] (-1393.749) (-1408.960) (-1410.490) -- 0:03:05
541000 -- (-1406.476) (-1403.834) [-1405.243] (-1422.015) * (-1412.224) [-1409.719] (-1406.179) (-1413.663) -- 0:03:04
541500 -- [-1397.997] (-1404.279) (-1414.152) (-1412.311) * [-1402.871] (-1402.624) (-1423.931) (-1414.184) -- 0:03:04
542000 -- (-1404.303) (-1410.006) [-1412.950] (-1412.254) * [-1403.838] (-1396.726) (-1412.164) (-1403.446) -- 0:03:04
542500 -- (-1401.328) (-1415.072) (-1405.899) [-1398.787] * (-1407.289) (-1397.949) (-1418.347) [-1403.873] -- 0:03:04
543000 -- [-1402.972] (-1412.262) (-1405.708) (-1406.817) * (-1418.555) [-1406.145] (-1416.995) (-1410.966) -- 0:03:04
543500 -- (-1413.515) (-1402.870) (-1423.858) [-1405.768] * (-1408.934) [-1395.856] (-1414.133) (-1411.160) -- 0:03:03
544000 -- (-1408.870) (-1405.504) (-1400.038) [-1406.112] * [-1401.716] (-1405.598) (-1418.467) (-1408.026) -- 0:03:03
544500 -- (-1416.042) (-1412.110) [-1404.867] (-1406.681) * (-1406.632) (-1402.745) (-1408.519) [-1398.568] -- 0:03:03
545000 -- (-1412.287) (-1416.386) [-1402.694] (-1417.020) * (-1405.226) (-1404.811) (-1426.943) [-1401.711] -- 0:03:03
Average standard deviation of split frequencies: 0.008256
545500 -- (-1418.736) [-1406.219] (-1408.445) (-1400.920) * [-1400.201] (-1410.293) (-1410.660) (-1400.391) -- 0:03:03
546000 -- (-1416.484) (-1416.583) (-1411.331) [-1404.321] * [-1411.061] (-1402.419) (-1420.898) (-1405.720) -- 0:03:02
546500 -- (-1410.440) (-1402.567) (-1409.121) [-1400.162] * (-1408.662) [-1409.113] (-1409.102) (-1412.682) -- 0:03:02
547000 -- (-1403.643) [-1401.620] (-1405.891) (-1408.087) * (-1402.823) (-1420.849) [-1405.878] (-1401.479) -- 0:03:02
547500 -- (-1411.464) (-1408.050) (-1407.940) [-1398.422] * (-1410.653) (-1414.493) (-1400.140) [-1403.444] -- 0:03:02
548000 -- (-1408.553) [-1403.645] (-1399.267) (-1403.242) * [-1402.870] (-1417.388) (-1406.250) (-1398.355) -- 0:03:02
548500 -- (-1401.695) (-1410.869) [-1414.241] (-1411.866) * [-1406.910] (-1401.112) (-1408.190) (-1401.652) -- 0:03:01
549000 -- [-1405.502] (-1413.999) (-1404.442) (-1418.634) * [-1404.531] (-1403.200) (-1400.418) (-1411.003) -- 0:03:01
549500 -- (-1407.652) (-1411.082) [-1406.043] (-1408.957) * [-1394.137] (-1414.446) (-1397.715) (-1414.509) -- 0:03:01
550000 -- (-1408.243) (-1414.934) [-1405.089] (-1415.025) * (-1403.773) (-1402.508) [-1397.390] (-1410.771) -- 0:03:01
Average standard deviation of split frequencies: 0.008454
550500 -- [-1402.926] (-1413.372) (-1406.420) (-1415.338) * (-1401.184) (-1398.666) [-1404.129] (-1408.826) -- 0:03:01
551000 -- [-1403.718] (-1403.938) (-1411.286) (-1400.527) * [-1404.379] (-1399.817) (-1407.605) (-1400.135) -- 0:03:00
551500 -- (-1417.704) [-1404.041] (-1413.366) (-1409.162) * (-1422.660) [-1409.544] (-1408.615) (-1409.365) -- 0:03:00
552000 -- (-1419.881) (-1401.863) [-1404.085] (-1401.599) * [-1406.061] (-1415.573) (-1405.640) (-1413.534) -- 0:03:00
552500 -- [-1413.731] (-1395.940) (-1413.475) (-1407.942) * [-1405.892] (-1414.042) (-1405.643) (-1405.944) -- 0:03:00
553000 -- (-1404.501) [-1396.040] (-1414.342) (-1403.485) * (-1409.601) (-1413.223) (-1412.159) [-1398.422] -- 0:03:00
553500 -- (-1404.960) (-1393.183) [-1403.553] (-1401.009) * [-1409.063] (-1415.499) (-1420.761) (-1406.965) -- 0:02:59
554000 -- (-1416.053) (-1405.262) (-1408.772) [-1407.202] * (-1398.373) (-1404.159) (-1414.451) [-1400.950] -- 0:03:00
554500 -- (-1405.737) [-1407.184] (-1405.006) (-1404.814) * (-1412.118) [-1400.545] (-1404.449) (-1405.017) -- 0:02:59
555000 -- [-1408.084] (-1406.745) (-1404.302) (-1405.168) * (-1411.774) (-1402.649) (-1404.826) [-1407.339] -- 0:02:59
Average standard deviation of split frequencies: 0.008055
555500 -- (-1413.093) [-1401.705] (-1403.853) (-1410.326) * (-1417.791) [-1400.500] (-1408.132) (-1410.659) -- 0:02:59
556000 -- (-1413.224) (-1408.200) [-1407.613] (-1407.698) * (-1401.572) (-1408.624) [-1405.938] (-1401.683) -- 0:02:58
556500 -- (-1401.595) (-1411.847) [-1402.988] (-1417.828) * [-1406.348] (-1406.758) (-1415.437) (-1404.088) -- 0:02:59
557000 -- (-1413.667) [-1401.774] (-1405.244) (-1406.424) * (-1406.681) [-1404.550] (-1403.511) (-1408.822) -- 0:02:58
557500 -- (-1405.205) (-1399.188) [-1404.224] (-1417.304) * (-1413.514) [-1399.392] (-1396.817) (-1407.751) -- 0:02:58
558000 -- (-1409.657) (-1407.995) (-1400.301) [-1408.117] * (-1430.699) (-1403.368) [-1409.313] (-1414.783) -- 0:02:58
558500 -- [-1410.219] (-1410.081) (-1405.088) (-1413.159) * (-1411.134) (-1408.713) [-1397.804] (-1411.690) -- 0:02:57
559000 -- (-1409.403) (-1407.519) [-1410.565] (-1407.941) * (-1401.069) (-1406.738) [-1393.619] (-1405.917) -- 0:02:58
559500 -- (-1408.183) (-1408.150) (-1403.256) [-1402.663] * (-1413.687) [-1410.059] (-1413.882) (-1405.877) -- 0:02:57
560000 -- [-1409.471] (-1410.321) (-1409.134) (-1413.128) * (-1409.350) [-1412.552] (-1408.936) (-1424.421) -- 0:02:57
Average standard deviation of split frequencies: 0.007830
560500 -- (-1415.558) (-1406.729) [-1404.579] (-1417.510) * (-1408.042) (-1418.769) [-1399.500] (-1410.949) -- 0:02:57
561000 -- (-1411.995) [-1405.045] (-1401.646) (-1396.671) * (-1410.663) (-1412.334) (-1428.734) [-1409.975] -- 0:02:56
561500 -- (-1406.272) [-1407.126] (-1412.486) (-1407.018) * (-1415.922) [-1402.755] (-1413.106) (-1406.015) -- 0:02:57
562000 -- (-1412.625) (-1407.982) (-1404.327) [-1401.663] * (-1406.187) (-1403.502) (-1413.610) [-1405.386] -- 0:02:56
562500 -- (-1413.379) (-1402.142) (-1400.712) [-1399.012] * (-1411.165) (-1406.068) (-1414.520) [-1395.220] -- 0:02:56
563000 -- (-1414.900) [-1406.715] (-1408.625) (-1414.460) * [-1403.722] (-1400.069) (-1417.517) (-1403.119) -- 0:02:56
563500 -- (-1417.231) (-1418.710) [-1405.631] (-1411.118) * [-1408.283] (-1402.345) (-1421.579) (-1411.453) -- 0:02:55
564000 -- (-1417.711) (-1416.287) (-1417.987) [-1398.360] * [-1404.260] (-1419.132) (-1413.546) (-1409.603) -- 0:02:56
564500 -- (-1410.623) (-1412.013) (-1408.614) [-1403.619] * [-1403.815] (-1402.212) (-1404.361) (-1408.717) -- 0:02:55
565000 -- (-1408.507) [-1405.837] (-1414.150) (-1405.386) * [-1403.486] (-1406.804) (-1413.705) (-1405.919) -- 0:02:55
Average standard deviation of split frequencies: 0.007704
565500 -- [-1397.417] (-1414.042) (-1411.544) (-1413.399) * (-1400.847) (-1407.695) (-1413.633) [-1406.039] -- 0:02:55
566000 -- (-1414.925) (-1410.266) (-1407.065) [-1408.078] * (-1413.782) (-1406.765) (-1409.225) [-1413.715] -- 0:02:54
566500 -- (-1407.113) (-1413.071) (-1410.580) [-1400.961] * (-1411.337) [-1406.951] (-1397.889) (-1412.280) -- 0:02:55
567000 -- (-1403.835) (-1414.724) (-1402.564) [-1401.128] * (-1407.784) [-1419.112] (-1406.417) (-1404.585) -- 0:02:54
567500 -- (-1417.897) [-1404.909] (-1408.105) (-1407.579) * (-1407.611) (-1422.813) (-1418.908) [-1410.665] -- 0:02:54
568000 -- (-1405.109) (-1403.645) (-1410.972) [-1401.247] * (-1404.822) (-1408.433) (-1406.003) [-1401.476] -- 0:02:54
568500 -- (-1413.965) (-1403.295) (-1415.957) [-1398.363] * (-1401.876) (-1400.381) (-1403.303) [-1398.219] -- 0:02:53
569000 -- (-1419.862) [-1401.311] (-1416.749) (-1400.953) * (-1405.669) (-1400.445) (-1406.431) [-1409.297] -- 0:02:54
569500 -- (-1432.462) (-1405.835) (-1401.919) [-1410.279] * (-1396.585) (-1401.502) (-1412.108) [-1404.630] -- 0:02:53
570000 -- (-1414.912) [-1404.048] (-1405.975) (-1416.714) * (-1405.243) (-1403.287) (-1399.811) [-1405.764] -- 0:02:53
Average standard deviation of split frequencies: 0.008415
570500 -- (-1424.506) [-1399.546] (-1407.760) (-1412.252) * (-1406.620) (-1403.658) [-1396.153] (-1404.622) -- 0:02:53
571000 -- (-1418.212) [-1403.806] (-1406.645) (-1413.923) * (-1405.761) (-1409.420) [-1409.733] (-1416.945) -- 0:02:52
571500 -- [-1405.978] (-1400.611) (-1413.031) (-1415.320) * (-1416.015) [-1402.945] (-1404.340) (-1410.616) -- 0:02:53
572000 -- [-1408.268] (-1406.114) (-1409.017) (-1403.898) * (-1419.878) (-1408.890) (-1409.121) [-1401.448] -- 0:02:52
572500 -- (-1409.849) [-1407.051] (-1408.124) (-1403.937) * (-1412.397) (-1406.714) (-1408.181) [-1408.096] -- 0:02:52
573000 -- (-1406.000) (-1419.281) [-1401.201] (-1401.211) * (-1404.633) [-1408.858] (-1410.283) (-1409.442) -- 0:02:52
573500 -- (-1395.629) [-1405.351] (-1406.801) (-1409.317) * (-1402.411) (-1407.308) [-1402.561] (-1415.430) -- 0:02:51
574000 -- (-1400.841) (-1405.808) [-1411.526] (-1397.954) * (-1400.839) (-1409.449) [-1403.114] (-1403.148) -- 0:02:51
574500 -- (-1406.849) (-1408.733) [-1399.637] (-1407.157) * [-1412.543] (-1414.295) (-1405.405) (-1400.511) -- 0:02:51
575000 -- [-1418.516] (-1402.509) (-1403.743) (-1420.398) * (-1411.984) [-1408.659] (-1404.994) (-1403.580) -- 0:02:51
Average standard deviation of split frequencies: 0.008849
575500 -- (-1399.024) [-1404.504] (-1411.781) (-1414.242) * [-1406.971] (-1421.948) (-1405.914) (-1405.214) -- 0:02:51
576000 -- [-1406.969] (-1407.428) (-1412.178) (-1405.872) * (-1407.696) (-1419.335) [-1410.442] (-1408.399) -- 0:02:50
576500 -- (-1410.419) [-1399.604] (-1413.112) (-1418.255) * [-1405.391] (-1410.462) (-1405.844) (-1406.417) -- 0:02:51
577000 -- (-1401.874) [-1399.958] (-1410.967) (-1410.517) * (-1403.969) (-1426.809) (-1418.625) [-1406.989] -- 0:02:50
577500 -- (-1405.380) (-1398.968) (-1407.540) [-1423.515] * (-1413.632) (-1408.937) (-1421.323) [-1404.448] -- 0:02:50
578000 -- [-1417.337] (-1415.837) (-1405.667) (-1400.742) * (-1411.779) [-1405.230] (-1414.240) (-1418.458) -- 0:02:50
578500 -- (-1404.145) (-1405.275) (-1400.670) [-1400.224] * [-1409.050] (-1412.706) (-1406.290) (-1426.345) -- 0:02:49
579000 -- (-1408.828) (-1405.328) [-1413.531] (-1406.938) * (-1410.041) [-1401.949] (-1420.100) (-1417.553) -- 0:02:50
579500 -- [-1401.686] (-1412.971) (-1416.491) (-1405.999) * (-1411.681) [-1405.893] (-1416.331) (-1410.227) -- 0:02:49
580000 -- [-1403.849] (-1401.670) (-1422.547) (-1397.936) * (-1404.536) [-1402.144] (-1423.749) (-1403.843) -- 0:02:49
Average standard deviation of split frequencies: 0.008778
580500 -- (-1409.824) (-1402.327) (-1414.170) [-1405.598] * (-1409.652) (-1400.047) (-1414.794) [-1399.451] -- 0:02:49
581000 -- (-1403.485) [-1405.065] (-1404.180) (-1397.129) * (-1411.800) (-1399.076) (-1411.059) [-1407.556] -- 0:02:48
581500 -- (-1396.585) (-1401.949) [-1401.607] (-1417.051) * [-1396.749] (-1408.604) (-1405.846) (-1405.291) -- 0:02:49
582000 -- (-1409.451) [-1402.384] (-1403.725) (-1405.599) * (-1404.738) (-1404.111) (-1417.253) [-1406.914] -- 0:02:48
582500 -- (-1415.316) [-1396.172] (-1412.323) (-1406.828) * (-1400.265) (-1401.583) [-1404.537] (-1406.344) -- 0:02:48
583000 -- (-1414.901) [-1407.519] (-1402.767) (-1410.022) * (-1410.136) [-1395.842] (-1405.017) (-1410.791) -- 0:02:48
583500 -- (-1418.460) (-1409.321) (-1409.392) [-1404.039] * [-1400.466] (-1406.656) (-1411.248) (-1407.951) -- 0:02:47
584000 -- (-1403.102) (-1410.238) [-1400.355] (-1419.859) * [-1408.603] (-1419.045) (-1407.287) (-1405.391) -- 0:02:48
584500 -- [-1411.307] (-1400.820) (-1414.241) (-1414.413) * [-1406.348] (-1408.761) (-1408.389) (-1417.418) -- 0:02:47
585000 -- [-1397.264] (-1410.141) (-1407.466) (-1425.662) * (-1417.603) (-1407.872) [-1400.923] (-1400.704) -- 0:02:47
Average standard deviation of split frequencies: 0.009000
585500 -- (-1408.926) (-1415.279) [-1411.390] (-1422.712) * [-1405.427] (-1415.895) (-1407.178) (-1418.457) -- 0:02:47
586000 -- [-1418.723] (-1407.534) (-1413.164) (-1401.879) * (-1403.503) [-1406.167] (-1414.220) (-1417.532) -- 0:02:46
586500 -- (-1417.630) [-1404.637] (-1402.464) (-1401.785) * (-1401.252) (-1407.121) [-1401.785] (-1424.086) -- 0:02:47
587000 -- (-1408.343) (-1399.400) (-1395.332) [-1398.258] * (-1409.490) (-1413.455) (-1420.135) [-1403.078] -- 0:02:46
587500 -- (-1413.216) (-1408.769) (-1399.324) [-1401.180] * [-1404.480] (-1421.496) (-1420.597) (-1409.828) -- 0:02:46
588000 -- (-1411.227) [-1401.757] (-1412.840) (-1405.240) * [-1402.106] (-1409.062) (-1402.254) (-1408.106) -- 0:02:46
588500 -- (-1417.656) (-1413.735) (-1415.306) [-1403.262] * (-1407.762) [-1403.278] (-1405.900) (-1419.806) -- 0:02:45
589000 -- (-1407.668) [-1407.293] (-1402.102) (-1402.646) * (-1404.204) (-1409.981) [-1410.456] (-1409.412) -- 0:02:46
589500 -- [-1401.629] (-1395.024) (-1405.732) (-1407.336) * (-1397.737) (-1405.803) (-1418.361) [-1401.363] -- 0:02:45
590000 -- (-1402.845) [-1402.696] (-1423.292) (-1409.369) * [-1401.085] (-1407.092) (-1406.829) (-1403.006) -- 0:02:45
Average standard deviation of split frequencies: 0.009228
590500 -- (-1403.307) (-1401.063) (-1411.895) [-1404.402] * (-1402.851) (-1412.347) (-1405.010) [-1398.814] -- 0:02:45
591000 -- (-1405.598) [-1404.763] (-1421.283) (-1410.365) * [-1398.036] (-1402.415) (-1405.007) (-1402.355) -- 0:02:44
591500 -- (-1402.199) [-1411.182] (-1403.832) (-1414.201) * (-1409.209) (-1422.899) (-1407.125) [-1407.485] -- 0:02:45
592000 -- [-1402.077] (-1403.191) (-1413.807) (-1420.417) * (-1415.843) (-1404.826) (-1414.321) [-1402.859] -- 0:02:44
592500 -- (-1409.529) (-1410.621) (-1411.314) [-1413.092] * (-1410.693) [-1403.663] (-1408.645) (-1402.157) -- 0:02:44
593000 -- (-1405.395) (-1410.432) (-1409.760) [-1401.747] * [-1401.763] (-1402.812) (-1412.171) (-1414.566) -- 0:02:44
593500 -- (-1412.478) [-1408.867] (-1414.350) (-1398.198) * (-1406.121) (-1404.183) (-1408.376) [-1412.845] -- 0:02:44
594000 -- (-1427.634) (-1411.040) (-1410.976) [-1401.273] * (-1410.243) (-1398.942) (-1405.484) [-1399.452] -- 0:02:44
594500 -- [-1405.716] (-1411.428) (-1410.206) (-1408.171) * (-1406.515) [-1399.225] (-1400.129) (-1405.824) -- 0:02:43
595000 -- [-1402.221] (-1415.387) (-1412.512) (-1411.255) * [-1398.843] (-1403.093) (-1414.400) (-1401.256) -- 0:02:43
Average standard deviation of split frequencies: 0.009294
595500 -- (-1405.363) [-1407.646] (-1415.927) (-1416.064) * (-1395.624) (-1410.444) [-1407.618] (-1408.834) -- 0:02:43
596000 -- (-1401.679) (-1410.584) [-1407.143] (-1420.137) * (-1403.154) (-1403.791) [-1399.606] (-1410.871) -- 0:02:43
596500 -- (-1401.976) (-1406.423) (-1408.652) [-1407.866] * (-1402.435) [-1408.068] (-1398.138) (-1404.367) -- 0:02:43
597000 -- [-1408.598] (-1410.983) (-1416.666) (-1405.371) * (-1413.694) [-1401.639] (-1412.478) (-1401.266) -- 0:02:42
597500 -- (-1412.657) (-1407.849) (-1413.969) [-1405.462] * [-1408.761] (-1409.513) (-1411.893) (-1419.531) -- 0:02:42
598000 -- (-1420.158) (-1407.542) (-1404.335) [-1413.971] * (-1408.012) [-1407.389] (-1414.620) (-1404.319) -- 0:02:42
598500 -- (-1407.028) [-1402.479] (-1417.411) (-1406.847) * (-1410.862) (-1416.033) [-1405.190] (-1401.147) -- 0:02:42
599000 -- [-1403.603] (-1416.653) (-1398.386) (-1412.554) * [-1408.799] (-1405.181) (-1407.973) (-1412.800) -- 0:02:42
599500 -- [-1407.004] (-1408.736) (-1414.116) (-1411.088) * [-1410.636] (-1403.082) (-1415.850) (-1420.834) -- 0:02:41
600000 -- (-1401.086) (-1404.599) [-1400.740] (-1415.210) * [-1408.847] (-1416.558) (-1408.288) (-1403.168) -- 0:02:41
Average standard deviation of split frequencies: 0.009418
600500 -- [-1399.699] (-1402.329) (-1406.418) (-1408.318) * [-1403.058] (-1416.179) (-1402.335) (-1403.208) -- 0:02:41
601000 -- (-1402.879) [-1415.542] (-1416.494) (-1406.693) * (-1413.128) [-1404.878] (-1405.884) (-1411.745) -- 0:02:41
601500 -- (-1404.692) (-1411.190) (-1408.660) [-1409.621] * [-1405.148] (-1409.722) (-1418.230) (-1402.389) -- 0:02:40
602000 -- (-1406.264) [-1400.894] (-1415.087) (-1405.837) * (-1416.848) [-1402.832] (-1405.487) (-1410.599) -- 0:02:40
602500 -- [-1409.169] (-1404.847) (-1400.321) (-1407.729) * (-1410.866) [-1409.850] (-1420.818) (-1401.635) -- 0:02:40
603000 -- [-1407.834] (-1399.297) (-1406.296) (-1408.537) * (-1409.093) (-1407.566) (-1409.838) [-1406.132] -- 0:02:40
603500 -- [-1408.159] (-1402.803) (-1400.146) (-1423.650) * (-1405.891) (-1404.993) (-1419.893) [-1408.396] -- 0:02:40
604000 -- [-1412.785] (-1429.496) (-1403.660) (-1409.725) * (-1410.846) [-1409.594] (-1416.012) (-1404.340) -- 0:02:39
604500 -- (-1416.471) [-1398.775] (-1409.864) (-1401.034) * (-1416.494) [-1420.550] (-1409.032) (-1405.492) -- 0:02:39
605000 -- (-1416.858) [-1394.333] (-1412.519) (-1400.965) * (-1414.844) (-1415.468) (-1403.448) [-1415.913] -- 0:02:39
Average standard deviation of split frequencies: 0.009529
605500 -- (-1409.777) (-1404.309) (-1411.140) [-1404.780] * (-1412.287) (-1408.612) (-1413.723) [-1404.818] -- 0:02:39
606000 -- (-1407.406) [-1403.049] (-1404.065) (-1410.082) * (-1424.585) (-1402.960) (-1412.369) [-1401.445] -- 0:02:39
606500 -- (-1410.712) (-1404.201) [-1406.396] (-1404.161) * (-1416.841) [-1403.590] (-1402.682) (-1410.537) -- 0:02:38
607000 -- (-1403.423) [-1408.496] (-1398.735) (-1416.204) * (-1405.921) [-1406.313] (-1406.874) (-1399.393) -- 0:02:38
607500 -- [-1403.057] (-1406.906) (-1395.351) (-1420.807) * [-1413.182] (-1417.285) (-1407.791) (-1405.250) -- 0:02:38
608000 -- (-1408.491) [-1398.461] (-1407.012) (-1430.074) * [-1399.746] (-1423.579) (-1409.916) (-1395.195) -- 0:02:38
608500 -- (-1417.293) (-1403.964) [-1410.178] (-1404.407) * (-1405.413) (-1424.531) (-1403.452) [-1401.132] -- 0:02:38
609000 -- [-1404.617] (-1406.296) (-1401.349) (-1412.003) * (-1411.796) (-1417.176) [-1401.820] (-1404.655) -- 0:02:37
609500 -- (-1415.442) [-1404.295] (-1403.530) (-1411.845) * (-1414.750) [-1405.038] (-1407.838) (-1404.269) -- 0:02:37
610000 -- (-1425.278) [-1396.226] (-1400.520) (-1407.011) * (-1413.931) (-1411.234) [-1404.616] (-1415.762) -- 0:02:37
Average standard deviation of split frequencies: 0.009408
610500 -- (-1417.611) (-1406.964) (-1408.295) [-1401.395] * (-1414.301) (-1414.488) (-1400.241) [-1399.849] -- 0:02:37
611000 -- (-1417.298) [-1407.823] (-1410.354) (-1409.483) * (-1415.056) (-1405.408) (-1410.869) [-1404.394] -- 0:02:37
611500 -- [-1408.559] (-1404.199) (-1403.438) (-1412.563) * (-1408.319) (-1409.510) [-1409.840] (-1403.213) -- 0:02:36
612000 -- (-1412.725) (-1399.030) [-1409.065] (-1410.063) * (-1407.869) (-1410.425) [-1405.836] (-1407.799) -- 0:02:36
612500 -- (-1414.171) [-1397.715] (-1407.052) (-1409.212) * (-1414.223) (-1407.837) (-1401.315) [-1406.128] -- 0:02:36
613000 -- (-1401.210) (-1398.717) [-1397.347] (-1410.287) * (-1404.344) (-1407.741) [-1408.922] (-1407.674) -- 0:02:36
613500 -- [-1399.588] (-1409.407) (-1393.498) (-1410.732) * [-1410.150] (-1406.808) (-1417.982) (-1407.870) -- 0:02:36
614000 -- (-1403.337) (-1415.325) [-1404.409] (-1412.314) * (-1405.514) (-1415.177) [-1397.366] (-1403.423) -- 0:02:35
614500 -- [-1399.379] (-1408.618) (-1405.648) (-1415.891) * (-1408.579) (-1405.187) [-1400.920] (-1416.361) -- 0:02:35
615000 -- [-1402.677] (-1414.519) (-1410.155) (-1406.213) * (-1412.263) [-1396.993] (-1400.873) (-1411.140) -- 0:02:35
Average standard deviation of split frequencies: 0.009805
615500 -- [-1412.537] (-1421.312) (-1420.822) (-1400.714) * (-1401.333) (-1411.199) [-1399.388] (-1403.419) -- 0:02:35
616000 -- [-1411.568] (-1407.691) (-1416.268) (-1407.526) * (-1404.208) (-1406.417) [-1400.087] (-1411.933) -- 0:02:35
616500 -- [-1409.658] (-1416.422) (-1408.100) (-1416.506) * [-1408.056] (-1404.102) (-1405.733) (-1405.004) -- 0:02:34
617000 -- (-1407.746) [-1398.597] (-1408.597) (-1416.000) * (-1405.374) (-1395.605) [-1405.321] (-1408.861) -- 0:02:34
617500 -- (-1412.018) (-1409.264) [-1396.370] (-1426.130) * (-1416.481) [-1396.973] (-1419.663) (-1396.149) -- 0:02:34
618000 -- (-1404.533) [-1401.163] (-1401.598) (-1422.542) * (-1406.394) (-1413.173) (-1404.417) [-1399.657] -- 0:02:34
618500 -- (-1408.362) (-1401.147) (-1406.020) [-1408.202] * [-1408.007] (-1414.534) (-1406.921) (-1415.640) -- 0:02:34
619000 -- (-1405.997) [-1402.756] (-1410.210) (-1416.698) * (-1410.658) [-1393.872] (-1405.138) (-1402.954) -- 0:02:33
619500 -- (-1407.069) (-1406.683) [-1413.123] (-1413.810) * (-1399.054) [-1407.902] (-1411.814) (-1397.277) -- 0:02:33
620000 -- [-1415.194] (-1400.609) (-1412.432) (-1404.950) * (-1404.533) [-1401.597] (-1411.729) (-1405.863) -- 0:02:33
Average standard deviation of split frequencies: 0.009446
620500 -- [-1414.231] (-1399.611) (-1415.711) (-1403.019) * (-1399.084) (-1399.190) (-1407.824) [-1405.770] -- 0:02:33
621000 -- [-1400.765] (-1413.577) (-1413.187) (-1412.014) * [-1404.417] (-1401.859) (-1404.135) (-1398.674) -- 0:02:33
621500 -- [-1406.417] (-1411.947) (-1419.848) (-1405.286) * (-1414.584) (-1401.860) [-1407.227] (-1409.296) -- 0:02:32
622000 -- (-1402.492) (-1403.963) (-1412.824) [-1408.617] * (-1408.304) (-1400.368) (-1409.726) [-1410.679] -- 0:02:32
622500 -- [-1400.724] (-1410.289) (-1410.561) (-1406.462) * (-1416.711) [-1399.173] (-1406.743) (-1408.945) -- 0:02:32
623000 -- (-1399.155) (-1409.716) [-1404.671] (-1415.275) * [-1410.014] (-1419.757) (-1401.156) (-1411.924) -- 0:02:32
623500 -- [-1410.113] (-1407.884) (-1411.697) (-1401.782) * (-1419.866) (-1402.332) (-1397.620) [-1409.569] -- 0:02:32
624000 -- (-1404.558) [-1407.033] (-1418.864) (-1411.629) * (-1414.586) (-1405.166) [-1406.244] (-1412.370) -- 0:02:31
624500 -- (-1407.930) [-1412.768] (-1408.423) (-1417.309) * (-1417.286) (-1401.142) [-1404.941] (-1407.836) -- 0:02:31
625000 -- (-1405.436) (-1420.758) (-1406.706) [-1405.589] * (-1415.374) [-1401.398] (-1410.390) (-1401.824) -- 0:02:31
Average standard deviation of split frequencies: 0.009837
625500 -- (-1405.003) (-1411.138) [-1405.188] (-1399.198) * (-1426.714) [-1392.490] (-1402.362) (-1414.283) -- 0:02:31
626000 -- [-1401.957] (-1416.322) (-1404.285) (-1409.056) * (-1408.493) [-1410.842] (-1411.936) (-1410.923) -- 0:02:31
626500 -- [-1401.396] (-1410.389) (-1410.321) (-1420.402) * (-1406.926) (-1409.237) (-1408.503) [-1405.556] -- 0:02:30
627000 -- [-1403.390] (-1406.926) (-1401.171) (-1403.800) * (-1411.912) (-1410.848) [-1403.591] (-1404.754) -- 0:02:30
627500 -- (-1402.222) [-1399.184] (-1409.310) (-1405.144) * (-1408.112) (-1406.437) [-1406.529] (-1408.396) -- 0:02:30
628000 -- (-1407.047) (-1402.036) [-1405.701] (-1407.424) * (-1414.449) [-1411.191] (-1407.305) (-1411.971) -- 0:02:30
628500 -- (-1415.968) [-1408.967] (-1400.600) (-1404.267) * [-1403.985] (-1414.473) (-1409.731) (-1412.873) -- 0:02:30
629000 -- (-1416.246) (-1411.146) [-1394.773] (-1411.418) * [-1410.031] (-1412.402) (-1408.452) (-1403.192) -- 0:02:29
629500 -- (-1409.134) (-1405.271) [-1401.622] (-1410.128) * (-1409.425) (-1408.257) (-1408.365) [-1404.509] -- 0:02:29
630000 -- [-1406.903] (-1411.286) (-1410.013) (-1413.713) * [-1405.391] (-1420.398) (-1414.889) (-1408.691) -- 0:02:29
Average standard deviation of split frequencies: 0.009717
630500 -- (-1406.284) (-1406.451) (-1403.181) [-1406.198] * [-1407.120] (-1409.927) (-1402.314) (-1398.762) -- 0:02:29
631000 -- [-1409.378] (-1423.425) (-1401.084) (-1408.475) * [-1410.604] (-1407.183) (-1397.304) (-1412.856) -- 0:02:29
631500 -- (-1405.173) (-1418.607) (-1408.827) [-1402.113] * (-1401.447) (-1415.354) (-1413.378) [-1400.099] -- 0:02:28
632000 -- (-1414.571) (-1411.030) [-1404.585] (-1405.148) * (-1407.083) (-1399.160) (-1402.293) [-1397.430] -- 0:02:28
632500 -- (-1415.614) (-1415.366) [-1396.417] (-1401.823) * (-1407.879) (-1411.615) [-1405.062] (-1414.835) -- 0:02:28
633000 -- [-1407.110] (-1403.244) (-1405.379) (-1402.464) * (-1405.035) (-1410.059) (-1396.432) [-1400.126] -- 0:02:28
633500 -- (-1408.861) [-1413.193] (-1410.673) (-1420.462) * (-1412.971) (-1417.649) (-1406.440) [-1410.536] -- 0:02:28
634000 -- (-1408.032) (-1413.204) (-1408.043) [-1396.989] * [-1408.491] (-1418.997) (-1410.955) (-1399.698) -- 0:02:27
634500 -- (-1410.973) [-1402.035] (-1409.961) (-1408.763) * (-1411.042) (-1403.682) [-1410.569] (-1406.280) -- 0:02:27
635000 -- (-1406.380) (-1415.808) [-1402.098] (-1417.606) * (-1409.598) [-1407.915] (-1407.970) (-1406.364) -- 0:02:27
Average standard deviation of split frequencies: 0.009450
635500 -- (-1403.576) (-1411.935) (-1404.581) [-1412.805] * (-1411.061) [-1404.918] (-1412.140) (-1407.571) -- 0:02:26
636000 -- (-1421.350) (-1414.968) [-1401.231] (-1412.802) * (-1403.250) (-1398.418) [-1404.788] (-1408.764) -- 0:02:27
636500 -- (-1403.366) (-1414.828) [-1403.300] (-1415.436) * (-1414.806) [-1406.383] (-1403.422) (-1419.208) -- 0:02:26
637000 -- (-1407.365) (-1409.364) [-1403.273] (-1409.225) * [-1396.242] (-1408.343) (-1404.911) (-1407.061) -- 0:02:26
637500 -- (-1402.216) [-1414.485] (-1412.603) (-1418.874) * (-1407.113) (-1420.265) [-1397.973] (-1411.174) -- 0:02:26
638000 -- (-1409.342) (-1406.065) (-1406.097) [-1401.363] * (-1404.052) [-1404.695] (-1421.114) (-1423.174) -- 0:02:25
638500 -- (-1412.153) [-1399.074] (-1404.902) (-1416.368) * (-1411.975) (-1413.284) (-1417.287) [-1405.060] -- 0:02:26
639000 -- (-1411.301) (-1399.772) (-1405.323) [-1412.081] * (-1409.130) (-1409.780) (-1424.336) [-1403.581] -- 0:02:25
639500 -- (-1417.325) (-1414.221) (-1408.054) [-1402.998] * (-1409.161) [-1405.641] (-1406.744) (-1413.776) -- 0:02:25
640000 -- (-1400.622) [-1405.744] (-1412.199) (-1409.430) * (-1411.946) (-1411.376) (-1418.022) [-1405.379] -- 0:02:25
Average standard deviation of split frequencies: 0.009152
640500 -- [-1403.641] (-1406.791) (-1397.149) (-1406.481) * (-1409.627) [-1399.796] (-1409.003) (-1410.434) -- 0:02:24
641000 -- [-1402.578] (-1414.273) (-1404.305) (-1403.857) * (-1398.744) [-1398.846] (-1412.086) (-1416.049) -- 0:02:25
641500 -- (-1406.072) [-1402.980] (-1401.464) (-1406.591) * [-1410.601] (-1407.957) (-1420.482) (-1407.885) -- 0:02:24
642000 -- (-1400.374) (-1408.889) [-1411.506] (-1404.018) * [-1406.666] (-1404.952) (-1418.908) (-1401.262) -- 0:02:24
642500 -- [-1409.668] (-1401.999) (-1412.169) (-1403.526) * (-1406.798) (-1408.610) [-1400.709] (-1401.094) -- 0:02:24
643000 -- (-1405.743) (-1412.242) [-1402.258] (-1406.046) * [-1405.214] (-1405.418) (-1409.761) (-1408.906) -- 0:02:23
643500 -- (-1400.684) [-1409.046] (-1413.557) (-1404.064) * (-1406.798) (-1409.283) [-1399.692] (-1414.037) -- 0:02:24
644000 -- (-1409.577) (-1400.530) (-1416.432) [-1393.926] * [-1408.062] (-1406.646) (-1407.986) (-1403.982) -- 0:02:23
644500 -- (-1409.887) [-1401.414] (-1406.618) (-1405.383) * (-1408.303) (-1407.055) (-1404.569) [-1399.918] -- 0:02:23
645000 -- [-1399.130] (-1399.452) (-1412.424) (-1402.291) * (-1401.369) (-1412.356) (-1403.872) [-1396.607] -- 0:02:23
Average standard deviation of split frequencies: 0.009669
645500 -- (-1408.250) (-1404.616) (-1401.140) [-1403.439] * [-1403.243] (-1408.861) (-1404.121) (-1404.391) -- 0:02:22
646000 -- [-1399.301] (-1412.466) (-1411.536) (-1405.233) * (-1412.777) (-1422.089) [-1398.442] (-1413.091) -- 0:02:23
646500 -- (-1412.538) (-1406.561) [-1409.357] (-1411.492) * [-1400.611] (-1414.538) (-1401.821) (-1400.903) -- 0:02:22
647000 -- (-1404.341) [-1394.082] (-1413.781) (-1411.437) * (-1409.899) (-1415.371) [-1399.465] (-1414.535) -- 0:02:22
647500 -- (-1410.907) (-1403.305) [-1408.934] (-1397.946) * (-1395.333) (-1414.100) (-1399.671) [-1414.295] -- 0:02:22
648000 -- (-1413.706) (-1407.637) [-1416.716] (-1406.511) * [-1400.715] (-1411.748) (-1411.139) (-1407.746) -- 0:02:21
648500 -- (-1408.662) (-1402.382) (-1405.240) [-1405.056] * [-1400.475] (-1418.125) (-1412.595) (-1407.212) -- 0:02:22
649000 -- (-1431.976) [-1404.486] (-1406.768) (-1403.252) * (-1402.447) (-1415.818) (-1410.004) [-1412.265] -- 0:02:21
649500 -- (-1403.290) [-1403.606] (-1429.271) (-1411.052) * [-1403.026] (-1403.875) (-1411.667) (-1402.931) -- 0:02:21
650000 -- (-1406.580) (-1402.640) (-1417.571) [-1407.030] * (-1411.227) (-1415.833) [-1397.972] (-1413.282) -- 0:02:21
Average standard deviation of split frequencies: 0.009554
650500 -- (-1410.439) [-1399.605] (-1427.857) (-1411.139) * [-1406.565] (-1405.100) (-1404.538) (-1404.458) -- 0:02:21
651000 -- [-1404.734] (-1416.365) (-1408.202) (-1415.101) * (-1410.513) (-1404.675) (-1406.942) [-1404.089] -- 0:02:20
651500 -- (-1411.547) (-1405.161) [-1403.216] (-1417.773) * (-1413.998) (-1404.070) (-1416.333) [-1404.829] -- 0:02:20
652000 -- (-1409.925) [-1402.321] (-1403.204) (-1409.913) * (-1407.510) (-1403.017) (-1410.267) [-1409.390] -- 0:02:20
652500 -- [-1410.191] (-1407.860) (-1422.518) (-1422.070) * (-1402.426) [-1402.258] (-1403.983) (-1402.017) -- 0:02:20
653000 -- (-1402.069) (-1409.122) (-1418.089) [-1410.505] * (-1413.200) (-1405.198) (-1411.687) [-1399.656] -- 0:02:19
653500 -- [-1400.821] (-1402.990) (-1407.384) (-1405.221) * [-1402.440] (-1402.052) (-1408.761) (-1409.646) -- 0:02:19
654000 -- (-1417.457) [-1402.776] (-1407.025) (-1407.468) * (-1410.545) [-1404.970] (-1403.578) (-1415.470) -- 0:02:19
654500 -- (-1403.885) (-1409.037) (-1420.217) [-1412.154] * [-1407.042] (-1404.799) (-1415.158) (-1417.412) -- 0:02:19
655000 -- (-1407.836) (-1415.016) (-1406.744) [-1409.618] * [-1404.380] (-1407.469) (-1403.618) (-1409.398) -- 0:02:19
Average standard deviation of split frequencies: 0.010150
655500 -- (-1398.521) (-1413.219) (-1418.675) [-1409.977] * (-1409.509) (-1399.280) [-1399.333] (-1417.959) -- 0:02:18
656000 -- [-1404.887] (-1407.298) (-1402.921) (-1419.608) * (-1413.874) [-1406.483] (-1407.678) (-1403.863) -- 0:02:18
656500 -- (-1417.502) (-1409.998) [-1402.358] (-1420.036) * (-1404.000) (-1404.811) (-1416.706) [-1400.585] -- 0:02:18
657000 -- (-1398.854) (-1406.379) [-1397.872] (-1415.894) * (-1409.761) (-1414.727) (-1418.712) [-1408.044] -- 0:02:18
657500 -- (-1408.995) (-1408.524) [-1398.550] (-1406.519) * (-1418.144) (-1406.487) (-1413.740) [-1401.614] -- 0:02:18
658000 -- (-1401.100) [-1396.663] (-1397.659) (-1404.732) * (-1409.550) (-1417.224) [-1401.305] (-1403.064) -- 0:02:17
658500 -- (-1409.412) (-1401.280) [-1404.835] (-1420.913) * (-1407.461) (-1402.329) [-1410.975] (-1407.615) -- 0:02:17
659000 -- [-1400.582] (-1410.255) (-1414.505) (-1415.320) * [-1412.671] (-1409.756) (-1403.867) (-1406.161) -- 0:02:17
659500 -- (-1403.854) [-1401.732] (-1404.874) (-1400.799) * (-1409.252) (-1398.297) (-1409.358) [-1404.982] -- 0:02:17
660000 -- (-1413.505) (-1414.976) [-1406.899] (-1407.822) * (-1400.884) [-1397.645] (-1410.239) (-1409.348) -- 0:02:17
Average standard deviation of split frequencies: 0.009053
660500 -- (-1405.746) (-1408.529) [-1403.623] (-1407.422) * (-1400.552) (-1409.957) [-1408.951] (-1409.844) -- 0:02:16
661000 -- [-1403.596] (-1403.148) (-1408.784) (-1414.016) * (-1409.433) (-1407.289) [-1405.965] (-1403.719) -- 0:02:16
661500 -- [-1406.466] (-1409.791) (-1409.317) (-1415.759) * (-1420.033) (-1411.031) [-1403.789] (-1400.651) -- 0:02:16
662000 -- (-1417.448) (-1398.859) (-1412.125) [-1400.595] * [-1402.210] (-1412.294) (-1412.818) (-1409.405) -- 0:02:16
662500 -- (-1408.232) [-1400.356] (-1413.588) (-1401.353) * (-1415.049) (-1416.284) (-1409.173) [-1408.539] -- 0:02:16
663000 -- [-1412.353] (-1401.169) (-1413.887) (-1394.122) * (-1419.641) (-1418.500) (-1405.902) [-1408.931] -- 0:02:15
663500 -- (-1410.082) [-1406.959] (-1412.728) (-1402.207) * (-1403.705) (-1414.194) (-1398.240) [-1402.406] -- 0:02:15
664000 -- (-1418.629) (-1404.218) (-1409.602) [-1406.725] * (-1404.955) (-1409.223) [-1396.168] (-1406.660) -- 0:02:15
664500 -- [-1408.464] (-1403.490) (-1419.567) (-1410.272) * (-1409.688) [-1410.179] (-1405.586) (-1408.845) -- 0:02:15
665000 -- (-1411.582) (-1405.290) [-1408.748] (-1407.519) * (-1408.580) (-1408.695) [-1397.447] (-1416.903) -- 0:02:15
Average standard deviation of split frequencies: 0.009157
665500 -- [-1405.616] (-1407.238) (-1406.536) (-1415.921) * (-1407.523) [-1404.009] (-1411.040) (-1409.866) -- 0:02:14
666000 -- [-1399.337] (-1396.397) (-1405.412) (-1414.322) * (-1405.034) [-1404.453] (-1406.187) (-1405.756) -- 0:02:14
666500 -- (-1407.590) (-1403.703) (-1419.667) [-1397.629] * (-1420.217) [-1401.416] (-1404.203) (-1405.829) -- 0:02:14
667000 -- [-1413.974] (-1410.909) (-1414.876) (-1409.128) * (-1415.624) (-1415.930) (-1414.885) [-1414.940] -- 0:02:14
667500 -- (-1415.872) (-1411.719) [-1411.087] (-1405.633) * [-1411.898] (-1411.845) (-1414.803) (-1405.462) -- 0:02:13
668000 -- (-1413.107) [-1417.452] (-1403.731) (-1407.969) * (-1412.863) (-1406.992) (-1399.474) [-1408.499] -- 0:02:13
668500 -- (-1413.131) (-1411.038) [-1397.993] (-1408.356) * (-1407.832) (-1422.781) [-1409.659] (-1408.382) -- 0:02:13
669000 -- (-1411.395) (-1408.741) (-1416.531) [-1406.136] * (-1414.035) (-1402.710) (-1406.293) [-1404.971] -- 0:02:13
669500 -- (-1411.944) (-1403.342) (-1412.261) [-1401.148] * (-1416.563) (-1396.830) [-1406.003] (-1415.866) -- 0:02:13
670000 -- (-1407.339) [-1405.035] (-1415.554) (-1407.639) * (-1406.157) (-1397.125) (-1406.000) [-1418.718] -- 0:02:12
Average standard deviation of split frequencies: 0.009840
670500 -- (-1406.962) [-1401.768] (-1403.287) (-1407.684) * [-1408.322] (-1414.758) (-1406.158) (-1410.718) -- 0:02:12
671000 -- [-1407.294] (-1405.052) (-1410.802) (-1407.743) * (-1402.968) [-1397.238] (-1409.750) (-1408.880) -- 0:02:12
671500 -- (-1404.999) (-1398.737) [-1404.794] (-1415.595) * (-1408.718) [-1412.429] (-1412.521) (-1415.411) -- 0:02:12
672000 -- (-1406.685) (-1413.755) [-1399.642] (-1409.830) * (-1410.977) (-1409.710) (-1415.869) [-1400.100] -- 0:02:12
672500 -- (-1404.026) (-1416.105) [-1411.713] (-1404.193) * (-1407.213) [-1398.032] (-1397.061) (-1401.128) -- 0:02:11
673000 -- (-1418.449) (-1417.805) [-1399.598] (-1413.983) * (-1410.013) [-1410.080] (-1404.325) (-1407.175) -- 0:02:11
673500 -- [-1406.218] (-1410.110) (-1402.486) (-1403.325) * (-1411.298) (-1408.200) [-1408.023] (-1414.624) -- 0:02:11
674000 -- [-1399.845] (-1409.450) (-1409.874) (-1409.129) * (-1401.026) [-1401.037] (-1417.301) (-1409.223) -- 0:02:11
674500 -- (-1400.313) [-1399.421] (-1424.749) (-1407.342) * [-1398.912] (-1414.433) (-1407.403) (-1407.631) -- 0:02:11
675000 -- (-1397.729) (-1403.666) (-1411.409) [-1396.420] * (-1397.513) [-1407.413] (-1409.556) (-1414.841) -- 0:02:10
Average standard deviation of split frequencies: 0.010111
675500 -- (-1419.969) [-1399.786] (-1408.832) (-1404.025) * [-1398.311] (-1412.888) (-1404.551) (-1414.695) -- 0:02:10
676000 -- [-1414.880] (-1408.276) (-1413.802) (-1412.198) * [-1403.909] (-1409.028) (-1419.250) (-1414.199) -- 0:02:10
676500 -- (-1405.576) [-1408.836] (-1406.766) (-1406.149) * (-1399.913) (-1413.459) [-1398.851] (-1409.441) -- 0:02:10
677000 -- (-1400.017) (-1407.934) [-1409.056] (-1407.194) * [-1410.645] (-1410.610) (-1404.549) (-1410.338) -- 0:02:10
677500 -- (-1405.779) (-1407.388) [-1400.352] (-1407.675) * [-1398.698] (-1403.814) (-1411.656) (-1402.213) -- 0:02:09
678000 -- [-1401.261] (-1410.919) (-1406.394) (-1410.759) * (-1405.889) (-1408.355) (-1418.967) [-1404.459] -- 0:02:09
678500 -- (-1409.324) [-1403.772] (-1401.711) (-1403.667) * (-1405.122) (-1405.754) (-1415.140) [-1402.607] -- 0:02:09
679000 -- (-1411.065) (-1410.088) (-1419.697) [-1410.600] * (-1412.967) [-1397.659] (-1417.700) (-1396.262) -- 0:02:09
679500 -- [-1400.360] (-1410.472) (-1410.421) (-1418.025) * [-1408.814] (-1410.600) (-1417.895) (-1410.700) -- 0:02:09
680000 -- (-1404.419) [-1396.833] (-1406.002) (-1412.718) * (-1404.545) [-1404.431] (-1413.854) (-1408.660) -- 0:02:08
Average standard deviation of split frequencies: 0.010345
680500 -- [-1404.702] (-1403.557) (-1406.458) (-1406.230) * (-1409.111) (-1401.485) (-1409.070) [-1412.019] -- 0:02:08
681000 -- (-1404.132) (-1407.720) [-1412.223] (-1402.648) * [-1400.662] (-1404.585) (-1417.616) (-1406.710) -- 0:02:08
681500 -- (-1406.734) [-1406.740] (-1401.101) (-1404.186) * (-1411.718) (-1405.207) [-1407.844] (-1413.500) -- 0:02:08
682000 -- (-1415.790) (-1407.069) [-1407.871] (-1405.877) * (-1403.864) [-1401.777] (-1409.038) (-1410.543) -- 0:02:08
682500 -- (-1417.284) (-1407.069) (-1404.517) [-1407.326] * (-1404.515) (-1408.818) [-1401.455] (-1418.049) -- 0:02:07
683000 -- (-1405.454) [-1406.281] (-1416.054) (-1425.695) * [-1400.643] (-1408.908) (-1415.009) (-1421.655) -- 0:02:07
683500 -- (-1398.131) (-1405.965) [-1412.725] (-1406.537) * (-1409.764) [-1412.471] (-1408.827) (-1413.737) -- 0:02:07
684000 -- [-1407.027] (-1413.345) (-1423.338) (-1404.231) * (-1399.602) (-1404.303) [-1419.772] (-1411.443) -- 0:02:07
684500 -- (-1415.309) (-1405.094) [-1406.837] (-1420.650) * (-1407.068) (-1412.276) [-1406.540] (-1411.420) -- 0:02:07
685000 -- (-1403.546) (-1406.198) (-1413.028) [-1411.027] * (-1414.866) (-1407.746) [-1401.080] (-1405.854) -- 0:02:06
Average standard deviation of split frequencies: 0.010265
685500 -- (-1411.282) (-1411.323) [-1408.882] (-1416.470) * (-1409.123) [-1401.556] (-1400.852) (-1405.816) -- 0:02:06
686000 -- (-1405.625) [-1402.796] (-1408.037) (-1409.084) * (-1405.721) (-1403.622) [-1403.777] (-1405.286) -- 0:02:06
686500 -- [-1407.516] (-1405.161) (-1412.200) (-1408.376) * (-1402.410) [-1413.562] (-1402.866) (-1422.819) -- 0:02:06
687000 -- [-1413.822] (-1414.913) (-1415.110) (-1405.248) * (-1416.632) [-1410.975] (-1408.257) (-1408.715) -- 0:02:06
687500 -- (-1406.300) (-1412.228) [-1402.029] (-1402.940) * (-1402.861) [-1404.181] (-1402.033) (-1414.483) -- 0:02:05
688000 -- (-1413.917) (-1405.148) (-1420.123) [-1408.670] * (-1408.716) [-1403.289] (-1404.648) (-1409.178) -- 0:02:05
688500 -- [-1410.901] (-1406.844) (-1414.504) (-1404.474) * (-1405.937) (-1405.612) (-1419.629) [-1400.551] -- 0:02:05
689000 -- (-1408.376) [-1405.624] (-1414.265) (-1408.439) * [-1403.675] (-1412.281) (-1406.623) (-1405.386) -- 0:02:05
689500 -- [-1405.414] (-1408.862) (-1401.695) (-1399.480) * (-1402.538) (-1410.760) (-1408.001) [-1404.175] -- 0:02:05
690000 -- [-1401.159] (-1403.873) (-1414.152) (-1410.050) * [-1401.291] (-1412.351) (-1406.368) (-1409.803) -- 0:02:04
Average standard deviation of split frequencies: 0.010537
690500 -- [-1400.668] (-1407.908) (-1406.172) (-1414.675) * (-1413.639) (-1414.300) [-1403.670] (-1399.128) -- 0:02:04
691000 -- (-1411.108) (-1413.775) (-1412.821) [-1410.517] * [-1408.449] (-1416.556) (-1402.249) (-1404.973) -- 0:02:04
691500 -- [-1407.994] (-1402.853) (-1404.038) (-1404.259) * [-1412.710] (-1406.893) (-1409.045) (-1402.738) -- 0:02:04
692000 -- (-1411.580) (-1410.602) (-1406.366) [-1402.630] * (-1405.537) (-1399.489) [-1399.926] (-1406.325) -- 0:02:04
692500 -- (-1410.129) [-1398.900] (-1415.039) (-1414.114) * (-1415.952) (-1409.257) [-1399.056] (-1400.326) -- 0:02:03
693000 -- (-1409.881) [-1395.711] (-1405.891) (-1412.026) * (-1402.852) [-1405.542] (-1402.691) (-1411.456) -- 0:02:03
693500 -- (-1416.190) [-1410.268] (-1411.928) (-1414.951) * (-1408.343) (-1407.739) [-1408.346] (-1417.090) -- 0:02:03
694000 -- (-1415.792) (-1407.996) [-1406.378] (-1426.787) * (-1405.102) (-1413.880) [-1403.079] (-1407.008) -- 0:02:03
694500 -- (-1412.157) (-1405.101) [-1393.833] (-1417.656) * (-1404.448) (-1412.560) [-1400.876] (-1407.368) -- 0:02:03
695000 -- [-1409.387] (-1401.067) (-1409.844) (-1409.255) * (-1399.289) (-1398.794) (-1412.419) [-1412.740] -- 0:02:02
Average standard deviation of split frequencies: 0.010075
695500 -- (-1419.317) (-1403.431) [-1411.132] (-1416.989) * (-1399.220) [-1403.444] (-1413.608) (-1405.157) -- 0:02:03
696000 -- (-1416.745) [-1404.867] (-1404.619) (-1413.931) * (-1411.454) (-1400.700) (-1413.817) [-1412.812] -- 0:02:02
696500 -- [-1405.675] (-1400.925) (-1407.639) (-1413.119) * (-1403.905) [-1397.622] (-1399.775) (-1403.316) -- 0:02:02
697000 -- (-1407.498) (-1408.656) [-1401.659] (-1404.296) * (-1410.672) (-1406.559) (-1409.595) [-1403.385] -- 0:02:02
697500 -- (-1400.833) [-1401.683] (-1407.464) (-1412.557) * (-1403.364) [-1420.324] (-1402.811) (-1412.367) -- 0:02:01
698000 -- (-1407.701) [-1402.699] (-1409.080) (-1413.442) * (-1416.635) (-1407.096) [-1403.154] (-1418.576) -- 0:02:02
698500 -- (-1406.121) (-1394.098) (-1408.959) [-1403.968] * (-1424.976) [-1398.624] (-1409.083) (-1402.784) -- 0:02:01
699000 -- [-1402.339] (-1403.881) (-1406.905) (-1408.176) * (-1424.356) (-1405.007) (-1403.318) [-1408.097] -- 0:02:01
699500 -- (-1406.131) [-1401.056] (-1403.737) (-1410.596) * [-1407.282] (-1408.516) (-1409.480) (-1413.346) -- 0:02:01
700000 -- (-1410.597) (-1406.333) (-1404.980) [-1408.995] * (-1403.904) [-1400.650] (-1402.807) (-1421.004) -- 0:02:00
Average standard deviation of split frequencies: 0.009587
700500 -- (-1406.206) [-1398.944] (-1416.678) (-1404.676) * (-1418.184) [-1399.223] (-1415.751) (-1406.952) -- 0:02:00
701000 -- (-1412.798) (-1406.140) [-1394.995] (-1409.102) * (-1406.305) [-1393.307] (-1408.806) (-1409.254) -- 0:02:00
701500 -- (-1403.912) [-1402.087] (-1409.616) (-1405.677) * [-1394.125] (-1399.244) (-1408.109) (-1411.745) -- 0:02:00
702000 -- (-1406.295) (-1418.803) [-1400.263] (-1414.374) * (-1411.891) (-1408.925) [-1403.999] (-1415.173) -- 0:02:00
702500 -- (-1407.050) [-1398.925] (-1402.698) (-1409.803) * (-1403.393) (-1412.889) (-1409.564) [-1399.663] -- 0:01:59
703000 -- (-1399.127) [-1402.471] (-1413.527) (-1412.635) * [-1407.667] (-1412.002) (-1413.584) (-1410.630) -- 0:01:59
703500 -- (-1404.970) (-1411.349) [-1412.499] (-1406.148) * (-1413.678) (-1424.327) (-1414.917) [-1396.221] -- 0:01:59
704000 -- (-1410.911) (-1413.021) (-1403.587) [-1405.048] * (-1413.352) [-1410.232] (-1415.309) (-1410.228) -- 0:01:59
704500 -- (-1414.919) [-1393.323] (-1403.396) (-1416.572) * (-1417.769) (-1404.777) (-1417.230) [-1402.637] -- 0:01:59
705000 -- (-1404.835) [-1401.095] (-1413.777) (-1405.201) * (-1410.506) (-1421.783) [-1410.750] (-1407.769) -- 0:01:59
Average standard deviation of split frequencies: 0.009348
705500 -- (-1407.557) (-1404.946) (-1404.588) [-1398.723] * (-1407.019) (-1406.333) (-1412.711) [-1407.594] -- 0:01:58
706000 -- (-1410.290) (-1398.881) (-1397.024) [-1401.118] * (-1415.053) (-1403.105) [-1406.198] (-1410.064) -- 0:01:58
706500 -- (-1405.968) [-1400.486] (-1404.951) (-1414.880) * [-1408.171] (-1398.139) (-1409.698) (-1407.694) -- 0:01:58
707000 -- [-1403.797] (-1407.314) (-1415.043) (-1404.973) * (-1406.653) [-1401.977] (-1404.478) (-1403.860) -- 0:01:58
707500 -- (-1409.245) [-1415.378] (-1412.416) (-1411.748) * (-1402.685) (-1417.886) [-1401.852] (-1402.829) -- 0:01:58
708000 -- [-1405.621] (-1410.072) (-1411.193) (-1410.212) * (-1405.976) (-1411.558) (-1412.010) [-1407.101] -- 0:01:57
708500 -- (-1407.618) [-1401.205] (-1400.574) (-1411.705) * (-1415.649) [-1408.105] (-1422.336) (-1415.356) -- 0:01:57
709000 -- (-1411.492) (-1406.091) (-1409.441) [-1399.438] * (-1400.350) [-1401.329] (-1416.582) (-1410.479) -- 0:01:57
709500 -- (-1410.323) [-1412.497] (-1420.079) (-1408.005) * [-1405.937] (-1405.821) (-1404.503) (-1416.525) -- 0:01:57
710000 -- [-1399.717] (-1407.935) (-1407.705) (-1405.320) * (-1412.640) (-1404.315) [-1405.585] (-1409.700) -- 0:01:56
Average standard deviation of split frequencies: 0.009535
710500 -- [-1404.353] (-1416.698) (-1410.777) (-1417.334) * (-1412.153) (-1404.641) (-1402.925) [-1396.850] -- 0:01:56
711000 -- (-1419.824) [-1405.006] (-1405.988) (-1407.994) * (-1410.565) (-1399.309) [-1404.644] (-1413.535) -- 0:01:56
711500 -- (-1405.727) (-1406.779) [-1406.248] (-1410.773) * (-1408.375) [-1403.718] (-1407.159) (-1409.908) -- 0:01:56
712000 -- (-1414.596) (-1409.138) (-1406.245) [-1401.423] * (-1411.115) (-1409.535) [-1401.919] (-1414.106) -- 0:01:56
712500 -- [-1408.789] (-1405.045) (-1405.145) (-1408.949) * (-1408.366) (-1409.649) [-1412.590] (-1409.623) -- 0:01:55
713000 -- (-1404.583) [-1405.189] (-1413.569) (-1411.490) * (-1398.974) (-1410.441) (-1415.227) [-1398.314] -- 0:01:55
713500 -- [-1407.453] (-1413.227) (-1416.607) (-1403.057) * (-1415.579) [-1405.265] (-1407.376) (-1403.589) -- 0:01:55
714000 -- [-1402.293] (-1406.526) (-1409.821) (-1418.095) * [-1404.148] (-1405.728) (-1417.865) (-1399.490) -- 0:01:55
714500 -- (-1404.959) [-1401.137] (-1411.173) (-1414.840) * (-1411.656) (-1411.133) (-1424.872) [-1403.842] -- 0:01:55
715000 -- [-1406.781] (-1403.502) (-1406.822) (-1394.896) * (-1409.272) (-1404.182) (-1415.363) [-1402.546] -- 0:01:54
Average standard deviation of split frequencies: 0.009423
715500 -- (-1402.147) (-1405.234) (-1404.587) [-1398.260] * [-1410.268] (-1413.124) (-1430.424) (-1411.506) -- 0:01:54
716000 -- (-1409.231) [-1407.493] (-1413.199) (-1406.072) * [-1410.023] (-1419.538) (-1424.154) (-1402.669) -- 0:01:54
716500 -- [-1404.710] (-1412.709) (-1407.969) (-1406.017) * [-1409.812] (-1410.977) (-1410.911) (-1406.198) -- 0:01:54
717000 -- (-1407.858) [-1406.689] (-1408.357) (-1412.246) * (-1402.637) (-1411.108) (-1401.198) [-1409.432] -- 0:01:54
717500 -- [-1407.450] (-1413.902) (-1409.212) (-1400.011) * (-1407.063) [-1394.884] (-1397.077) (-1421.931) -- 0:01:53
718000 -- (-1407.447) (-1412.535) (-1410.014) [-1401.435] * [-1400.557] (-1400.997) (-1399.891) (-1402.590) -- 0:01:53
718500 -- [-1409.483] (-1408.680) (-1411.326) (-1410.068) * (-1407.645) (-1410.860) [-1401.072] (-1407.593) -- 0:01:53
719000 -- (-1414.499) (-1410.937) [-1402.375] (-1412.927) * [-1401.585] (-1410.353) (-1408.015) (-1403.325) -- 0:01:53
719500 -- (-1417.600) (-1419.765) [-1405.954] (-1415.409) * [-1398.846] (-1406.689) (-1408.133) (-1404.790) -- 0:01:53
720000 -- (-1411.194) (-1412.130) (-1403.485) [-1409.453] * (-1403.795) (-1414.611) (-1406.110) [-1395.255] -- 0:01:52
Average standard deviation of split frequencies: 0.009239
720500 -- (-1423.952) [-1402.189] (-1403.920) (-1405.161) * (-1410.372) [-1404.423] (-1409.859) (-1413.522) -- 0:01:52
721000 -- (-1427.459) (-1401.585) (-1404.556) [-1400.970] * (-1414.248) [-1402.578] (-1404.958) (-1405.655) -- 0:01:52
721500 -- (-1403.085) [-1401.624] (-1407.172) (-1409.637) * (-1408.927) [-1399.794] (-1409.431) (-1422.721) -- 0:01:52
722000 -- (-1406.246) [-1401.996] (-1409.242) (-1404.335) * (-1409.525) [-1406.593] (-1405.446) (-1408.732) -- 0:01:52
722500 -- (-1407.240) [-1408.764] (-1408.142) (-1411.347) * [-1401.493] (-1408.782) (-1423.215) (-1410.375) -- 0:01:51
723000 -- (-1404.712) (-1410.316) [-1408.718] (-1417.768) * (-1405.260) (-1419.645) (-1406.052) [-1403.756] -- 0:01:51
723500 -- (-1410.957) [-1398.081] (-1403.630) (-1407.685) * (-1408.064) (-1417.917) (-1407.582) [-1410.276] -- 0:01:51
724000 -- (-1407.487) (-1415.098) [-1400.845] (-1421.659) * [-1397.474] (-1399.822) (-1407.778) (-1405.548) -- 0:01:51
724500 -- (-1413.740) (-1420.593) [-1408.166] (-1410.157) * (-1404.776) (-1415.347) [-1401.610] (-1412.442) -- 0:01:51
725000 -- (-1407.399) (-1408.526) (-1413.021) [-1404.015] * [-1394.246] (-1414.660) (-1409.051) (-1411.763) -- 0:01:50
Average standard deviation of split frequencies: 0.009577
725500 -- (-1404.877) [-1412.766] (-1412.477) (-1409.101) * (-1402.338) (-1410.203) (-1400.329) [-1402.767] -- 0:01:50
726000 -- [-1399.857] (-1416.877) (-1405.871) (-1409.959) * (-1400.734) [-1408.069] (-1411.252) (-1406.780) -- 0:01:50
726500 -- (-1406.821) (-1410.070) [-1420.993] (-1408.849) * (-1408.439) [-1394.306] (-1397.790) (-1399.954) -- 0:01:50
727000 -- [-1410.047] (-1406.718) (-1403.449) (-1415.831) * (-1400.932) (-1399.113) [-1406.881] (-1406.127) -- 0:01:50
727500 -- (-1406.519) (-1412.067) [-1397.696] (-1429.940) * (-1403.457) (-1414.703) (-1404.656) [-1404.305] -- 0:01:49
728000 -- (-1412.291) (-1400.977) [-1411.528] (-1409.026) * (-1397.656) (-1406.718) [-1404.439] (-1408.853) -- 0:01:49
728500 -- (-1414.116) (-1410.982) (-1409.185) [-1401.509] * (-1405.398) (-1401.490) (-1401.917) [-1411.251] -- 0:01:49
729000 -- [-1400.360] (-1400.964) (-1407.024) (-1401.474) * (-1409.356) (-1401.932) [-1408.784] (-1409.880) -- 0:01:49
729500 -- (-1413.453) [-1398.717] (-1405.855) (-1402.315) * (-1414.828) (-1400.061) (-1406.651) [-1409.660] -- 0:01:49
730000 -- [-1398.582] (-1416.729) (-1394.885) (-1407.968) * [-1399.217] (-1409.692) (-1408.512) (-1408.540) -- 0:01:48
Average standard deviation of split frequencies: 0.009234
730500 -- [-1402.514] (-1406.853) (-1399.679) (-1406.298) * (-1411.630) (-1402.143) [-1414.227] (-1408.140) -- 0:01:48
731000 -- (-1409.583) (-1408.776) (-1405.781) [-1402.532] * (-1406.555) (-1406.475) (-1401.716) [-1400.513] -- 0:01:48
731500 -- (-1401.789) (-1409.576) (-1411.107) [-1409.616] * (-1403.850) (-1408.404) [-1405.940] (-1407.600) -- 0:01:48
732000 -- (-1401.465) [-1403.836] (-1415.187) (-1412.257) * [-1402.299] (-1401.800) (-1405.246) (-1408.399) -- 0:01:48
732500 -- [-1398.866] (-1412.004) (-1401.422) (-1402.957) * (-1406.267) (-1405.596) (-1401.552) [-1404.345] -- 0:01:47
733000 -- (-1405.774) (-1410.708) [-1407.659] (-1411.613) * [-1400.374] (-1401.556) (-1404.658) (-1405.614) -- 0:01:47
733500 -- (-1403.247) (-1416.783) (-1405.558) [-1405.675] * (-1404.169) (-1415.660) [-1405.207] (-1412.098) -- 0:01:47
734000 -- [-1404.862] (-1413.726) (-1411.337) (-1396.929) * (-1410.271) (-1419.201) (-1410.798) [-1407.856] -- 0:01:47
734500 -- [-1411.618] (-1416.216) (-1408.687) (-1403.190) * (-1403.014) [-1406.350] (-1399.308) (-1415.843) -- 0:01:46
735000 -- (-1409.340) (-1410.904) (-1414.569) [-1401.092] * (-1415.402) [-1405.974] (-1406.189) (-1403.458) -- 0:01:46
Average standard deviation of split frequencies: 0.008767
735500 -- (-1407.900) [-1400.411] (-1410.059) (-1397.886) * (-1416.142) (-1400.630) [-1400.557] (-1404.800) -- 0:01:46
736000 -- (-1407.379) (-1401.420) (-1407.967) [-1398.483] * (-1418.338) (-1409.594) (-1418.210) [-1403.888] -- 0:01:46
736500 -- (-1410.677) (-1407.603) (-1407.092) [-1396.797] * (-1411.399) [-1409.301] (-1404.597) (-1405.833) -- 0:01:46
737000 -- (-1396.790) [-1412.297] (-1411.077) (-1411.161) * [-1407.132] (-1408.042) (-1406.718) (-1406.037) -- 0:01:45
737500 -- [-1398.272] (-1420.984) (-1404.869) (-1409.813) * [-1403.231] (-1424.557) (-1411.726) (-1405.268) -- 0:01:46
738000 -- (-1408.039) [-1402.895] (-1412.708) (-1400.727) * (-1418.970) (-1416.945) [-1410.507] (-1405.405) -- 0:01:45
738500 -- [-1398.486] (-1400.118) (-1409.693) (-1416.311) * (-1408.696) (-1420.752) [-1407.602] (-1406.267) -- 0:01:45
739000 -- (-1405.740) [-1404.575] (-1407.665) (-1411.090) * (-1410.426) (-1414.837) (-1412.137) [-1411.306] -- 0:01:45
739500 -- (-1404.462) (-1397.340) [-1406.235] (-1430.864) * (-1415.144) [-1407.729] (-1413.071) (-1402.452) -- 0:01:44
740000 -- [-1403.362] (-1398.726) (-1413.902) (-1405.701) * (-1410.869) (-1408.681) [-1401.513] (-1402.110) -- 0:01:45
Average standard deviation of split frequencies: 0.009149
740500 -- [-1406.043] (-1407.385) (-1409.096) (-1407.182) * (-1410.410) [-1406.212] (-1414.001) (-1398.690) -- 0:01:44
741000 -- [-1404.731] (-1406.758) (-1409.859) (-1404.531) * (-1408.116) [-1405.865] (-1402.448) (-1411.064) -- 0:01:44
741500 -- (-1404.084) [-1402.712] (-1408.071) (-1402.117) * (-1418.354) (-1406.037) (-1414.606) [-1403.957] -- 0:01:44
742000 -- [-1399.439] (-1411.084) (-1415.500) (-1414.906) * (-1416.563) [-1403.442] (-1414.841) (-1397.752) -- 0:01:43
742500 -- (-1406.486) [-1413.300] (-1404.249) (-1415.911) * (-1411.376) [-1403.067] (-1409.721) (-1406.444) -- 0:01:44
743000 -- (-1412.283) [-1395.965] (-1408.552) (-1410.030) * (-1404.211) (-1400.567) [-1409.440] (-1415.959) -- 0:01:43
743500 -- (-1413.730) (-1396.405) [-1406.603] (-1402.588) * (-1402.973) [-1399.754] (-1404.700) (-1415.418) -- 0:01:43
744000 -- (-1406.568) (-1406.230) [-1402.452] (-1415.896) * (-1408.525) (-1405.511) [-1405.087] (-1416.036) -- 0:01:43
744500 -- (-1410.169) [-1397.991] (-1418.776) (-1408.473) * [-1409.111] (-1407.279) (-1407.659) (-1404.859) -- 0:01:42
745000 -- (-1420.942) [-1396.776] (-1412.458) (-1408.009) * (-1405.689) (-1401.323) [-1408.363] (-1405.900) -- 0:01:43
Average standard deviation of split frequencies: 0.009479
745500 -- (-1405.475) (-1406.531) [-1417.612] (-1408.520) * [-1403.234] (-1413.365) (-1412.333) (-1408.560) -- 0:01:42
746000 -- (-1407.637) [-1404.183] (-1403.787) (-1409.836) * (-1404.153) (-1404.568) (-1404.008) [-1403.943] -- 0:01:42
746500 -- [-1405.848] (-1409.018) (-1414.755) (-1405.522) * (-1405.917) (-1410.830) [-1402.554] (-1399.025) -- 0:01:42
747000 -- [-1404.845] (-1406.981) (-1407.274) (-1412.241) * (-1418.174) (-1413.951) (-1400.662) [-1399.789] -- 0:01:42
747500 -- [-1406.233] (-1405.154) (-1410.055) (-1413.981) * (-1402.864) [-1404.132] (-1411.660) (-1404.727) -- 0:01:42
748000 -- (-1412.814) (-1412.796) [-1406.595] (-1412.476) * (-1411.640) (-1402.942) (-1404.431) [-1401.990] -- 0:01:41
748500 -- (-1412.074) [-1423.395] (-1405.197) (-1400.790) * (-1404.876) [-1404.660] (-1401.098) (-1413.802) -- 0:01:41
749000 -- (-1409.287) (-1411.665) (-1408.606) [-1398.435] * (-1408.281) (-1423.193) [-1401.483] (-1404.879) -- 0:01:41
749500 -- (-1409.283) (-1407.450) (-1401.951) [-1403.985] * [-1402.336] (-1423.609) (-1416.261) (-1406.780) -- 0:01:41
750000 -- (-1411.014) (-1419.307) (-1417.094) [-1401.753] * [-1410.322] (-1417.144) (-1410.857) (-1402.655) -- 0:01:41
Average standard deviation of split frequencies: 0.009655
750500 -- (-1400.654) (-1403.521) (-1404.770) [-1401.116] * (-1412.753) [-1401.778] (-1412.023) (-1400.341) -- 0:01:40
751000 -- (-1412.111) [-1403.685] (-1422.630) (-1398.070) * (-1413.091) [-1403.158] (-1404.514) (-1411.801) -- 0:01:40
751500 -- (-1412.250) [-1403.810] (-1410.310) (-1412.163) * (-1407.027) [-1405.079] (-1400.197) (-1403.109) -- 0:01:40
752000 -- [-1399.826] (-1408.182) (-1410.665) (-1409.616) * (-1415.889) (-1412.097) (-1405.080) [-1406.562] -- 0:01:40
752500 -- (-1401.639) [-1405.696] (-1421.749) (-1406.281) * (-1407.647) (-1403.333) (-1406.049) [-1405.198] -- 0:01:39
753000 -- (-1416.574) (-1401.843) (-1427.938) [-1404.258] * (-1403.288) (-1407.019) [-1404.001] (-1411.819) -- 0:01:39
753500 -- (-1404.693) (-1403.351) (-1410.212) [-1403.253] * [-1405.656] (-1404.809) (-1406.064) (-1409.664) -- 0:01:39
754000 -- (-1404.298) (-1408.028) [-1401.198] (-1409.457) * (-1409.395) [-1403.033] (-1411.715) (-1402.117) -- 0:01:39
754500 -- (-1399.914) (-1412.759) [-1405.432] (-1414.113) * (-1409.015) (-1397.656) [-1400.020] (-1400.446) -- 0:01:39
755000 -- (-1408.396) (-1415.066) (-1404.523) [-1404.177] * [-1406.575] (-1409.252) (-1408.929) (-1401.716) -- 0:01:38
Average standard deviation of split frequencies: 0.010055
755500 -- [-1403.551] (-1403.021) (-1415.303) (-1411.934) * [-1410.511] (-1404.201) (-1406.753) (-1410.568) -- 0:01:38
756000 -- (-1422.899) (-1404.589) (-1417.172) [-1402.754] * (-1413.453) [-1408.420] (-1404.881) (-1412.339) -- 0:01:38
756500 -- (-1409.537) (-1414.383) [-1400.877] (-1411.123) * (-1406.158) [-1403.459] (-1409.772) (-1409.750) -- 0:01:38
757000 -- (-1407.480) (-1410.726) [-1404.475] (-1415.347) * (-1411.299) (-1399.130) [-1400.074] (-1415.647) -- 0:01:38
757500 -- (-1404.771) (-1413.771) (-1404.528) [-1409.384] * (-1413.205) [-1410.376] (-1399.784) (-1416.586) -- 0:01:37
758000 -- (-1400.014) [-1414.137] (-1409.165) (-1409.445) * (-1408.827) (-1415.950) [-1398.338] (-1407.430) -- 0:01:37
758500 -- [-1406.091] (-1410.980) (-1420.395) (-1405.602) * (-1404.103) (-1400.941) [-1399.823] (-1410.122) -- 0:01:37
759000 -- (-1411.658) (-1413.004) [-1401.998] (-1403.337) * [-1404.392] (-1402.734) (-1419.544) (-1405.183) -- 0:01:37
759500 -- (-1418.198) (-1427.103) (-1400.119) [-1409.770] * (-1409.144) (-1402.565) [-1406.909] (-1411.557) -- 0:01:37
760000 -- (-1403.156) (-1409.774) [-1405.061] (-1411.706) * (-1407.995) (-1399.513) [-1409.126] (-1404.546) -- 0:01:36
Average standard deviation of split frequencies: 0.009567
760500 -- [-1400.143] (-1405.430) (-1405.798) (-1409.439) * (-1407.509) (-1405.248) [-1406.613] (-1420.444) -- 0:01:36
761000 -- (-1407.101) [-1402.541] (-1410.003) (-1412.683) * (-1416.162) (-1404.219) [-1405.392] (-1407.161) -- 0:01:36
761500 -- (-1414.679) [-1402.811] (-1407.523) (-1400.813) * (-1419.634) [-1403.822] (-1407.450) (-1411.709) -- 0:01:36
762000 -- (-1408.853) (-1406.576) (-1403.248) [-1400.636] * (-1409.233) (-1405.091) (-1410.574) [-1407.644] -- 0:01:36
762500 -- (-1401.793) (-1410.292) [-1405.075] (-1411.044) * [-1407.279] (-1408.638) (-1403.320) (-1406.752) -- 0:01:35
763000 -- (-1412.201) (-1412.970) (-1399.688) [-1405.715] * (-1408.954) (-1419.513) [-1411.712] (-1407.239) -- 0:01:35
763500 -- (-1407.603) (-1408.960) (-1403.134) [-1406.028] * [-1406.785] (-1422.478) (-1407.824) (-1410.182) -- 0:01:35
764000 -- [-1410.072] (-1415.194) (-1398.093) (-1412.779) * [-1410.406] (-1419.404) (-1406.163) (-1412.578) -- 0:01:35
764500 -- (-1407.282) (-1402.008) (-1399.120) [-1407.463] * (-1396.960) (-1412.560) (-1408.515) [-1411.023] -- 0:01:35
765000 -- (-1404.475) (-1413.845) [-1399.547] (-1418.613) * [-1406.381] (-1418.538) (-1408.407) (-1410.378) -- 0:01:34
Average standard deviation of split frequencies: 0.009770
765500 -- (-1408.328) [-1396.750] (-1401.015) (-1411.081) * [-1403.942] (-1400.082) (-1416.823) (-1403.365) -- 0:01:34
766000 -- (-1403.545) (-1406.544) (-1410.592) [-1403.373] * (-1406.051) (-1405.616) (-1412.527) [-1405.374] -- 0:01:34
766500 -- (-1406.157) (-1411.090) [-1410.190] (-1411.409) * (-1397.045) [-1407.019] (-1408.867) (-1406.936) -- 0:01:34
767000 -- [-1400.458] (-1420.709) (-1404.979) (-1412.450) * [-1406.526] (-1404.034) (-1399.956) (-1409.260) -- 0:01:34
767500 -- (-1409.918) (-1405.988) [-1404.926] (-1415.203) * (-1412.208) (-1418.861) (-1406.804) [-1410.789] -- 0:01:33
768000 -- [-1418.004] (-1408.287) (-1405.588) (-1427.247) * (-1407.623) (-1411.560) [-1397.494] (-1421.066) -- 0:01:33
768500 -- (-1407.044) (-1413.160) [-1401.552] (-1415.006) * (-1413.515) (-1414.557) (-1412.217) [-1402.502] -- 0:01:33
769000 -- [-1405.132] (-1406.778) (-1403.170) (-1417.607) * (-1410.395) (-1406.420) (-1402.589) [-1398.647] -- 0:01:33
769500 -- (-1399.991) [-1399.473] (-1404.689) (-1415.256) * [-1399.198] (-1415.572) (-1403.514) (-1409.424) -- 0:01:33
770000 -- [-1403.572] (-1406.794) (-1413.374) (-1405.240) * (-1398.706) (-1402.701) (-1403.005) [-1396.252] -- 0:01:32
Average standard deviation of split frequencies: 0.009787
770500 -- (-1412.363) (-1412.345) [-1402.183] (-1406.205) * [-1403.362] (-1416.831) (-1411.975) (-1401.443) -- 0:01:32
771000 -- (-1419.480) (-1398.478) [-1397.630] (-1415.566) * [-1407.486] (-1401.941) (-1408.699) (-1408.928) -- 0:01:32
771500 -- (-1407.545) (-1398.559) [-1404.391] (-1410.178) * (-1410.696) [-1394.791] (-1410.797) (-1406.723) -- 0:01:32
772000 -- (-1408.720) (-1409.043) [-1405.078] (-1410.954) * [-1402.001] (-1412.471) (-1407.456) (-1399.513) -- 0:01:32
772500 -- (-1401.754) (-1410.655) (-1408.764) [-1398.773] * [-1400.325] (-1413.884) (-1409.767) (-1403.143) -- 0:01:31
773000 -- (-1412.013) (-1420.253) [-1406.755] (-1405.684) * [-1404.468] (-1405.005) (-1407.674) (-1419.895) -- 0:01:31
773500 -- [-1399.575] (-1414.677) (-1417.616) (-1408.839) * (-1403.889) [-1405.488] (-1424.160) (-1410.339) -- 0:01:31
774000 -- [-1403.308] (-1414.034) (-1401.290) (-1406.573) * [-1399.832] (-1411.046) (-1406.663) (-1413.042) -- 0:01:31
774500 -- (-1408.996) (-1402.359) (-1402.234) [-1401.376] * (-1405.179) (-1406.732) (-1408.497) [-1401.937] -- 0:01:31
775000 -- (-1404.051) (-1403.000) (-1406.702) [-1412.792] * (-1413.006) [-1407.550] (-1408.576) (-1407.221) -- 0:01:30
Average standard deviation of split frequencies: 0.009454
775500 -- (-1408.256) (-1411.813) [-1407.393] (-1406.706) * (-1412.262) (-1409.044) (-1409.652) [-1408.525] -- 0:01:30
776000 -- [-1404.892] (-1411.007) (-1413.078) (-1406.476) * (-1418.838) (-1411.234) [-1409.341] (-1404.937) -- 0:01:30
776500 -- (-1405.090) [-1397.046] (-1419.396) (-1410.877) * (-1408.488) [-1401.161] (-1403.226) (-1423.475) -- 0:01:30
777000 -- (-1400.819) (-1406.485) [-1410.364] (-1408.522) * (-1408.580) [-1401.619] (-1409.280) (-1418.391) -- 0:01:30
777500 -- [-1400.033] (-1412.529) (-1414.824) (-1404.577) * (-1414.961) [-1393.551] (-1395.966) (-1424.750) -- 0:01:29
778000 -- (-1407.415) (-1405.901) [-1404.672] (-1411.869) * (-1405.711) (-1407.940) [-1397.629] (-1411.693) -- 0:01:29
778500 -- (-1409.918) (-1406.962) [-1409.216] (-1411.045) * [-1404.408] (-1400.518) (-1413.428) (-1417.231) -- 0:01:29
779000 -- (-1419.210) (-1416.166) [-1398.189] (-1415.094) * (-1417.110) [-1405.839] (-1407.723) (-1417.440) -- 0:01:29
779500 -- (-1405.086) (-1423.832) [-1409.573] (-1408.091) * [-1404.893] (-1412.833) (-1417.672) (-1407.905) -- 0:01:29
780000 -- [-1404.774] (-1404.770) (-1406.594) (-1399.475) * (-1407.533) (-1416.499) (-1407.010) [-1398.888] -- 0:01:28
Average standard deviation of split frequencies: 0.009360
780500 -- (-1413.068) (-1411.320) (-1410.002) [-1398.670] * (-1407.197) [-1405.288] (-1416.091) (-1400.891) -- 0:01:28
781000 -- [-1410.913] (-1417.608) (-1401.454) (-1405.563) * (-1404.560) (-1404.282) [-1403.943] (-1401.767) -- 0:01:28
781500 -- (-1411.212) (-1409.324) [-1410.863] (-1411.165) * [-1406.904] (-1409.758) (-1407.673) (-1397.765) -- 0:01:28
782000 -- (-1411.534) [-1410.673] (-1399.301) (-1410.274) * [-1398.939] (-1412.551) (-1409.071) (-1405.995) -- 0:01:28
782500 -- (-1407.798) (-1412.564) (-1417.258) [-1405.335] * (-1402.478) (-1408.100) (-1410.421) [-1407.228] -- 0:01:27
783000 -- (-1406.649) (-1410.192) [-1406.970] (-1414.520) * [-1406.863] (-1404.020) (-1409.373) (-1407.721) -- 0:01:27
783500 -- (-1406.543) (-1404.077) [-1407.749] (-1408.707) * (-1407.695) [-1402.819] (-1406.602) (-1411.432) -- 0:01:27
784000 -- [-1404.319] (-1416.009) (-1410.166) (-1408.830) * (-1407.612) (-1397.122) (-1406.078) [-1413.051] -- 0:01:27
784500 -- [-1406.142] (-1404.500) (-1405.085) (-1410.767) * (-1408.657) [-1402.139] (-1413.677) (-1410.224) -- 0:01:27
785000 -- (-1410.478) (-1404.646) [-1401.336] (-1410.823) * (-1416.180) (-1406.472) (-1405.823) [-1416.919] -- 0:01:26
Average standard deviation of split frequencies: 0.009071
785500 -- (-1415.618) (-1402.672) (-1407.540) [-1414.675] * (-1420.783) (-1416.190) (-1414.246) [-1401.428] -- 0:01:26
786000 -- [-1403.293] (-1406.305) (-1406.899) (-1406.931) * (-1400.631) [-1400.604] (-1404.407) (-1407.112) -- 0:01:26
786500 -- (-1410.592) (-1412.647) (-1409.044) [-1408.511] * (-1410.107) (-1404.812) [-1404.722] (-1405.546) -- 0:01:26
787000 -- [-1403.279] (-1403.668) (-1402.906) (-1413.988) * [-1406.586] (-1414.550) (-1407.857) (-1404.601) -- 0:01:26
787500 -- (-1403.827) [-1396.222] (-1408.283) (-1400.536) * [-1413.826] (-1414.454) (-1414.055) (-1404.965) -- 0:01:25
788000 -- [-1403.937] (-1402.949) (-1415.735) (-1406.784) * (-1394.363) [-1404.930] (-1411.631) (-1409.062) -- 0:01:25
788500 -- (-1404.071) [-1408.826] (-1416.408) (-1403.776) * (-1400.231) (-1410.714) (-1417.627) [-1407.769] -- 0:01:25
789000 -- (-1405.548) (-1405.448) (-1423.031) [-1403.548] * [-1406.227] (-1418.179) (-1405.938) (-1410.103) -- 0:01:25
789500 -- (-1412.322) [-1410.796] (-1412.087) (-1407.299) * (-1407.672) (-1410.912) [-1399.213] (-1407.789) -- 0:01:24
790000 -- (-1406.225) (-1424.503) (-1403.515) [-1412.570] * (-1398.636) (-1408.318) (-1411.976) [-1407.511] -- 0:01:24
Average standard deviation of split frequencies: 0.009651
790500 -- (-1414.530) [-1399.661] (-1404.807) (-1412.203) * [-1399.287] (-1419.856) (-1404.939) (-1402.851) -- 0:01:24
791000 -- [-1406.521] (-1403.500) (-1410.732) (-1409.726) * [-1400.407] (-1405.875) (-1407.488) (-1406.988) -- 0:01:24
791500 -- (-1407.216) (-1417.345) [-1411.200] (-1405.399) * [-1401.014] (-1401.413) (-1418.071) (-1407.019) -- 0:01:24
792000 -- (-1416.470) (-1413.003) [-1405.446] (-1402.349) * (-1403.198) [-1400.862] (-1429.396) (-1407.177) -- 0:01:23
792500 -- (-1405.067) [-1405.843] (-1413.034) (-1401.641) * (-1410.677) [-1412.784] (-1400.539) (-1409.352) -- 0:01:23
793000 -- (-1415.351) [-1403.331] (-1408.514) (-1415.423) * (-1406.464) [-1407.288] (-1398.468) (-1414.040) -- 0:01:23
793500 -- (-1406.806) (-1403.587) (-1410.353) [-1410.648] * (-1422.444) (-1415.727) [-1397.981] (-1404.144) -- 0:01:23
794000 -- (-1408.536) (-1415.331) (-1407.150) [-1403.185] * (-1416.828) (-1421.339) (-1405.164) [-1405.914] -- 0:01:23
794500 -- [-1397.603] (-1409.917) (-1403.482) (-1408.202) * [-1399.926] (-1402.712) (-1410.943) (-1409.718) -- 0:01:22
795000 -- (-1407.708) [-1407.099] (-1409.245) (-1421.534) * (-1397.676) (-1396.228) (-1408.640) [-1400.853] -- 0:01:22
Average standard deviation of split frequencies: 0.009809
795500 -- (-1414.907) [-1403.003] (-1408.726) (-1413.833) * (-1404.573) (-1411.598) (-1400.324) [-1404.395] -- 0:01:22
796000 -- [-1413.488] (-1408.353) (-1407.331) (-1405.252) * (-1410.075) (-1414.704) [-1405.135] (-1414.128) -- 0:01:22
796500 -- (-1407.328) (-1416.225) [-1405.164] (-1413.276) * (-1413.641) [-1404.582] (-1405.809) (-1397.881) -- 0:01:22
797000 -- (-1419.198) [-1404.880] (-1410.543) (-1410.044) * (-1414.907) (-1419.515) (-1407.520) [-1405.977] -- 0:01:21
797500 -- (-1403.730) (-1406.338) [-1403.119] (-1413.389) * (-1413.405) [-1408.944] (-1399.504) (-1403.966) -- 0:01:21
798000 -- (-1404.477) (-1404.885) (-1417.075) [-1400.493] * (-1417.185) (-1415.907) [-1404.133] (-1402.219) -- 0:01:21
798500 -- (-1413.338) (-1416.492) (-1413.513) [-1401.574] * (-1408.222) (-1412.424) (-1405.246) [-1409.624] -- 0:01:21
799000 -- (-1417.521) [-1404.951] (-1408.582) (-1421.601) * (-1411.498) (-1418.251) [-1405.867] (-1410.038) -- 0:01:21
799500 -- (-1421.016) (-1405.662) (-1407.689) [-1402.399] * (-1399.914) (-1410.791) [-1400.494] (-1405.594) -- 0:01:20
800000 -- [-1409.052] (-1408.994) (-1410.135) (-1401.506) * (-1397.843) (-1404.490) (-1404.285) [-1413.439] -- 0:01:20
Average standard deviation of split frequencies: 0.009935
800500 -- (-1407.353) (-1400.693) (-1427.983) [-1399.706] * (-1407.659) [-1399.126] (-1404.476) (-1416.819) -- 0:01:20
801000 -- (-1412.485) [-1405.164] (-1409.636) (-1410.815) * (-1417.879) (-1406.137) [-1404.338] (-1413.473) -- 0:01:20
801500 -- [-1398.920] (-1418.076) (-1402.902) (-1418.819) * (-1406.158) [-1413.179] (-1402.204) (-1416.927) -- 0:01:19
802000 -- (-1414.196) (-1419.375) [-1405.970] (-1405.011) * (-1400.679) [-1414.166] (-1413.191) (-1416.406) -- 0:01:19
802500 -- (-1411.279) (-1411.185) (-1412.112) [-1407.906] * (-1403.050) [-1400.765] (-1402.436) (-1412.330) -- 0:01:19
803000 -- (-1404.610) (-1416.308) (-1409.492) [-1399.805] * (-1406.364) (-1399.343) (-1407.201) [-1402.418] -- 0:01:19
803500 -- [-1403.518] (-1409.255) (-1409.008) (-1407.510) * [-1407.423] (-1399.164) (-1419.539) (-1400.708) -- 0:01:19
804000 -- [-1397.669] (-1400.262) (-1409.962) (-1409.156) * [-1400.003] (-1398.888) (-1419.327) (-1415.396) -- 0:01:18
804500 -- (-1400.373) (-1399.986) [-1409.596] (-1402.279) * [-1404.164] (-1402.751) (-1417.881) (-1415.492) -- 0:01:18
805000 -- (-1403.410) (-1398.473) (-1423.508) [-1404.303] * (-1407.316) [-1397.487] (-1407.709) (-1406.523) -- 0:01:18
Average standard deviation of split frequencies: 0.009321
805500 -- [-1396.716] (-1414.163) (-1408.798) (-1424.552) * (-1401.505) (-1410.790) [-1405.821] (-1405.727) -- 0:01:18
806000 -- (-1409.765) (-1406.627) (-1410.317) [-1407.874] * (-1409.260) [-1400.904] (-1412.282) (-1397.010) -- 0:01:18
806500 -- (-1403.826) (-1411.623) (-1408.002) [-1408.411] * (-1408.490) (-1406.549) (-1411.639) [-1403.448] -- 0:01:17
807000 -- [-1398.798] (-1398.253) (-1419.586) (-1413.626) * (-1402.784) [-1398.901] (-1407.497) (-1404.819) -- 0:01:17
807500 -- [-1398.323] (-1406.328) (-1417.556) (-1411.373) * (-1414.501) (-1406.195) [-1399.573] (-1404.086) -- 0:01:17
808000 -- (-1407.599) (-1411.071) [-1397.098] (-1404.813) * (-1402.383) [-1402.255] (-1407.628) (-1410.732) -- 0:01:17
808500 -- (-1406.372) (-1413.883) (-1411.134) [-1397.896] * (-1404.663) (-1399.612) [-1398.021] (-1414.617) -- 0:01:17
809000 -- (-1406.079) (-1407.096) [-1402.280] (-1404.407) * (-1401.536) (-1403.027) [-1408.860] (-1413.767) -- 0:01:16
809500 -- (-1410.546) (-1412.254) (-1401.909) [-1408.891] * (-1408.655) (-1410.597) (-1406.145) [-1408.374] -- 0:01:16
810000 -- [-1405.711] (-1423.797) (-1403.186) (-1395.915) * (-1405.093) (-1402.606) [-1405.465] (-1407.925) -- 0:01:16
Average standard deviation of split frequencies: 0.009231
810500 -- [-1402.511] (-1411.752) (-1409.371) (-1409.800) * [-1400.941] (-1414.285) (-1421.122) (-1410.942) -- 0:01:16
811000 -- (-1412.434) [-1400.878] (-1401.573) (-1401.474) * (-1411.932) (-1405.417) [-1408.438] (-1415.811) -- 0:01:16
811500 -- (-1417.713) (-1403.075) [-1409.977] (-1407.253) * (-1417.392) [-1401.492] (-1406.564) (-1406.001) -- 0:01:15
812000 -- (-1405.243) [-1403.415] (-1409.509) (-1411.039) * [-1405.012] (-1403.170) (-1406.828) (-1405.977) -- 0:01:15
812500 -- (-1413.000) [-1396.048] (-1400.489) (-1404.102) * (-1407.448) (-1401.609) [-1407.533] (-1404.038) -- 0:01:15
813000 -- (-1410.763) (-1403.459) [-1407.230] (-1397.360) * [-1402.786] (-1405.335) (-1413.758) (-1406.460) -- 0:01:15
813500 -- (-1405.038) (-1407.331) (-1407.943) [-1400.425] * (-1404.772) [-1402.518] (-1404.085) (-1399.575) -- 0:01:15
814000 -- (-1401.507) (-1406.249) (-1412.772) [-1401.445] * (-1407.757) [-1399.099] (-1397.840) (-1417.499) -- 0:01:14
814500 -- (-1412.966) (-1400.679) [-1402.172] (-1408.432) * [-1411.439] (-1410.063) (-1405.098) (-1412.187) -- 0:01:14
815000 -- [-1397.829] (-1405.092) (-1404.582) (-1413.668) * (-1403.737) [-1405.954] (-1413.952) (-1410.431) -- 0:01:14
Average standard deviation of split frequencies: 0.009279
815500 -- [-1399.820] (-1412.895) (-1412.096) (-1395.942) * (-1413.540) (-1410.142) [-1403.887] (-1421.690) -- 0:01:14
816000 -- (-1408.956) (-1407.870) (-1401.514) [-1397.396] * (-1416.716) (-1413.180) [-1408.467] (-1414.333) -- 0:01:14
816500 -- [-1402.064] (-1409.936) (-1419.878) (-1413.700) * (-1417.351) (-1396.221) [-1411.003] (-1413.537) -- 0:01:13
817000 -- [-1405.739] (-1401.538) (-1405.562) (-1402.189) * (-1411.666) (-1402.068) [-1406.034] (-1412.310) -- 0:01:13
817500 -- (-1408.333) (-1401.193) [-1402.422] (-1406.428) * (-1406.041) [-1397.716] (-1411.782) (-1421.326) -- 0:01:13
818000 -- (-1412.050) (-1400.663) [-1398.330] (-1413.052) * (-1415.149) (-1399.387) (-1409.218) [-1405.587] -- 0:01:13
818500 -- (-1414.299) (-1404.663) [-1406.956] (-1414.133) * [-1414.696] (-1400.515) (-1403.026) (-1404.200) -- 0:01:13
819000 -- (-1419.994) (-1397.216) [-1409.578] (-1419.636) * (-1402.983) [-1403.545] (-1402.395) (-1411.165) -- 0:01:12
819500 -- (-1415.619) (-1400.730) (-1408.770) [-1401.270] * (-1407.955) (-1398.128) [-1396.760] (-1414.043) -- 0:01:12
820000 -- (-1410.199) (-1408.577) [-1410.052] (-1408.973) * (-1414.359) (-1407.781) (-1397.397) [-1406.040] -- 0:01:12
Average standard deviation of split frequencies: 0.009227
820500 -- (-1410.500) [-1403.462] (-1407.106) (-1408.574) * (-1407.602) [-1398.005] (-1409.732) (-1409.613) -- 0:01:12
821000 -- (-1407.766) (-1408.767) (-1396.695) [-1404.757] * [-1401.219] (-1402.100) (-1398.548) (-1417.654) -- 0:01:12
821500 -- (-1403.498) (-1411.843) [-1405.475] (-1408.503) * (-1415.753) [-1393.552] (-1405.499) (-1407.666) -- 0:01:11
822000 -- [-1401.988] (-1414.342) (-1414.315) (-1403.638) * (-1407.481) [-1399.127] (-1406.548) (-1413.894) -- 0:01:11
822500 -- [-1402.358] (-1404.715) (-1405.312) (-1403.945) * (-1417.568) (-1410.729) (-1404.584) [-1402.920] -- 0:01:11
823000 -- (-1410.269) (-1417.933) (-1412.835) [-1412.426] * (-1414.571) (-1404.922) [-1401.966] (-1406.617) -- 0:01:11
823500 -- (-1412.580) (-1407.828) [-1403.895] (-1408.640) * (-1416.438) (-1415.974) (-1409.666) [-1406.796] -- 0:01:11
824000 -- (-1409.579) (-1410.796) [-1402.845] (-1406.889) * (-1416.600) (-1403.797) [-1401.392] (-1421.727) -- 0:01:10
824500 -- (-1403.198) (-1406.360) (-1407.282) [-1409.572] * [-1409.099] (-1405.283) (-1407.177) (-1413.196) -- 0:01:10
825000 -- [-1403.591] (-1412.434) (-1395.618) (-1405.830) * (-1407.025) (-1412.391) [-1396.251] (-1410.583) -- 0:01:10
Average standard deviation of split frequencies: 0.009203
825500 -- (-1416.780) [-1396.425] (-1406.574) (-1409.695) * (-1410.511) [-1405.028] (-1405.553) (-1405.762) -- 0:01:10
826000 -- [-1403.449] (-1400.961) (-1405.260) (-1413.246) * (-1418.925) (-1409.618) [-1410.392] (-1407.849) -- 0:01:10
826500 -- [-1401.542] (-1407.354) (-1416.084) (-1403.446) * [-1405.240] (-1408.245) (-1408.345) (-1421.810) -- 0:01:09
827000 -- (-1406.479) [-1402.573] (-1405.288) (-1399.978) * [-1399.720] (-1402.989) (-1413.164) (-1414.201) -- 0:01:09
827500 -- [-1404.725] (-1404.497) (-1413.970) (-1410.464) * (-1409.148) (-1406.496) (-1406.063) [-1404.732] -- 0:01:09
828000 -- (-1401.367) (-1408.304) [-1410.282] (-1409.675) * (-1401.757) (-1409.185) (-1416.726) [-1407.039] -- 0:01:09
828500 -- [-1404.571] (-1412.126) (-1411.187) (-1413.100) * [-1405.158] (-1419.552) (-1407.049) (-1396.844) -- 0:01:09
829000 -- (-1423.353) (-1406.307) [-1400.603] (-1402.503) * (-1408.434) (-1409.151) [-1405.343] (-1412.326) -- 0:01:08
829500 -- (-1420.902) (-1400.513) (-1412.248) [-1395.076] * [-1406.751] (-1409.445) (-1406.702) (-1412.901) -- 0:01:08
830000 -- (-1415.211) [-1404.084] (-1406.781) (-1407.163) * [-1398.378] (-1408.214) (-1401.422) (-1416.712) -- 0:01:08
Average standard deviation of split frequencies: 0.008938
830500 -- [-1406.429] (-1405.946) (-1412.941) (-1407.627) * (-1405.604) [-1404.132] (-1410.252) (-1401.384) -- 0:01:08
831000 -- (-1403.405) [-1397.659] (-1405.526) (-1413.646) * (-1400.838) [-1406.844] (-1406.950) (-1399.943) -- 0:01:08
831500 -- [-1399.983] (-1401.371) (-1406.196) (-1397.419) * (-1412.224) [-1404.080] (-1408.752) (-1410.353) -- 0:01:07
832000 -- (-1406.023) (-1408.545) [-1402.086] (-1421.533) * (-1416.931) [-1398.941] (-1399.153) (-1408.536) -- 0:01:07
832500 -- (-1400.624) (-1414.773) [-1400.585] (-1400.680) * [-1401.687] (-1406.497) (-1407.103) (-1400.968) -- 0:01:07
833000 -- (-1401.442) (-1411.099) (-1410.372) [-1399.158] * (-1405.636) [-1399.529] (-1410.224) (-1405.340) -- 0:01:07
833500 -- (-1404.751) (-1406.091) (-1410.965) [-1402.166] * (-1412.602) (-1408.406) [-1396.753] (-1401.404) -- 0:01:07
834000 -- (-1417.670) [-1404.409] (-1414.494) (-1397.804) * [-1396.570] (-1402.135) (-1409.464) (-1414.736) -- 0:01:06
834500 -- (-1406.619) (-1406.872) (-1416.926) [-1401.700] * [-1397.865] (-1403.821) (-1419.331) (-1418.368) -- 0:01:06
835000 -- [-1401.331] (-1413.089) (-1408.924) (-1407.069) * (-1414.026) (-1405.760) (-1415.403) [-1408.566] -- 0:01:06
Average standard deviation of split frequencies: 0.008458
835500 -- (-1404.663) (-1420.563) (-1410.570) [-1397.353] * (-1403.967) (-1404.253) (-1410.403) [-1408.715] -- 0:01:06
836000 -- (-1410.767) (-1411.871) [-1398.625] (-1393.354) * (-1405.652) [-1405.461] (-1416.339) (-1414.620) -- 0:01:06
836500 -- (-1421.569) (-1413.584) (-1414.129) [-1400.578] * (-1414.826) [-1398.106] (-1403.078) (-1401.906) -- 0:01:05
837000 -- (-1409.418) (-1410.056) (-1399.826) [-1399.146] * (-1412.269) (-1406.840) [-1403.695] (-1401.256) -- 0:01:05
837500 -- (-1405.789) [-1410.310] (-1408.595) (-1403.351) * (-1408.456) (-1423.960) (-1403.153) [-1409.096] -- 0:01:05
838000 -- (-1403.471) [-1404.906] (-1413.849) (-1403.094) * (-1402.109) [-1408.155] (-1407.600) (-1420.172) -- 0:01:05
838500 -- (-1409.193) (-1412.521) (-1408.820) [-1403.825] * (-1402.836) [-1405.071] (-1407.774) (-1405.653) -- 0:01:05
839000 -- (-1412.306) (-1407.947) (-1405.891) [-1410.947] * (-1413.017) (-1407.613) [-1403.909] (-1408.844) -- 0:01:04
839500 -- (-1409.150) [-1411.265] (-1411.093) (-1402.953) * [-1397.744] (-1399.281) (-1403.345) (-1412.710) -- 0:01:04
840000 -- (-1410.517) [-1402.729] (-1410.040) (-1412.242) * [-1396.734] (-1403.052) (-1406.382) (-1407.431) -- 0:01:04
Average standard deviation of split frequencies: 0.009042
840500 -- (-1416.610) (-1400.765) (-1416.043) [-1411.473] * (-1421.667) (-1398.602) (-1397.284) [-1404.995] -- 0:01:04
841000 -- (-1419.110) (-1401.660) [-1406.112] (-1406.388) * (-1417.057) (-1400.921) [-1409.772] (-1405.304) -- 0:01:04
841500 -- (-1413.480) (-1414.902) [-1405.637] (-1416.045) * (-1417.043) [-1398.762] (-1407.287) (-1411.493) -- 0:01:03
842000 -- (-1404.178) (-1413.338) (-1414.173) [-1408.897] * [-1409.308] (-1410.450) (-1418.391) (-1401.987) -- 0:01:03
842500 -- (-1405.196) (-1407.503) [-1408.030] (-1412.695) * (-1395.848) [-1407.361] (-1423.986) (-1414.882) -- 0:01:03
843000 -- (-1412.766) [-1402.273] (-1404.253) (-1399.524) * [-1403.164] (-1408.807) (-1413.973) (-1404.679) -- 0:01:03
843500 -- (-1407.201) [-1410.325] (-1409.368) (-1406.051) * (-1406.130) [-1399.375] (-1430.377) (-1404.211) -- 0:01:03
844000 -- [-1402.948] (-1405.998) (-1416.006) (-1399.178) * (-1406.023) (-1406.420) [-1402.850] (-1411.099) -- 0:01:02
844500 -- (-1418.760) (-1426.147) (-1408.498) [-1407.860] * (-1403.850) [-1411.193] (-1401.058) (-1415.473) -- 0:01:02
845000 -- (-1411.331) (-1413.149) (-1411.298) [-1406.345] * (-1411.185) [-1402.387] (-1394.541) (-1403.393) -- 0:01:02
Average standard deviation of split frequencies: 0.009264
845500 -- (-1401.990) (-1406.534) [-1411.304] (-1409.764) * (-1411.507) (-1410.757) [-1403.139] (-1409.341) -- 0:01:02
846000 -- (-1412.955) (-1405.809) [-1403.173] (-1420.789) * [-1405.101] (-1412.753) (-1405.387) (-1405.988) -- 0:01:02
846500 -- (-1400.975) (-1401.620) (-1405.819) [-1415.786] * (-1410.614) (-1406.350) (-1399.912) [-1394.771] -- 0:01:01
847000 -- (-1413.039) [-1405.933] (-1423.888) (-1409.920) * (-1412.607) [-1411.061] (-1405.979) (-1395.503) -- 0:01:01
847500 -- (-1402.675) (-1405.843) (-1413.468) [-1404.590] * (-1406.118) (-1396.263) (-1401.711) [-1405.226] -- 0:01:01
848000 -- (-1416.921) [-1408.078] (-1416.228) (-1414.610) * [-1408.029] (-1397.842) (-1406.795) (-1410.323) -- 0:01:01
848500 -- [-1412.864] (-1403.903) (-1412.760) (-1400.021) * (-1407.676) (-1417.632) (-1404.243) [-1408.180] -- 0:01:01
849000 -- [-1414.357] (-1409.256) (-1414.766) (-1414.996) * [-1399.839] (-1405.928) (-1402.225) (-1406.180) -- 0:01:00
849500 -- (-1418.925) (-1413.376) [-1401.579] (-1416.631) * (-1407.114) [-1396.870] (-1406.380) (-1415.866) -- 0:01:00
850000 -- (-1419.236) (-1410.091) (-1401.374) [-1405.695] * (-1407.240) (-1403.215) [-1407.326] (-1406.852) -- 0:01:00
Average standard deviation of split frequencies: 0.008832
850500 -- [-1400.182] (-1408.507) (-1401.134) (-1409.171) * (-1403.163) (-1409.715) (-1406.370) [-1399.334] -- 0:01:00
851000 -- [-1410.417] (-1411.782) (-1413.343) (-1402.091) * [-1405.445] (-1415.447) (-1406.052) (-1403.367) -- 0:01:00
851500 -- [-1402.988] (-1412.690) (-1429.037) (-1409.687) * (-1404.938) (-1403.547) (-1412.327) [-1407.098] -- 0:00:59
852000 -- (-1407.690) (-1412.853) (-1420.821) [-1405.654] * (-1415.961) [-1411.305] (-1394.663) (-1406.244) -- 0:00:59
852500 -- (-1415.938) (-1413.487) (-1413.652) [-1400.072] * (-1406.354) (-1402.841) [-1401.156] (-1409.043) -- 0:00:59
853000 -- [-1406.149] (-1400.575) (-1405.472) (-1404.992) * [-1405.007] (-1403.944) (-1413.302) (-1398.898) -- 0:00:59
853500 -- (-1408.792) (-1413.341) (-1408.892) [-1402.039] * (-1411.014) [-1410.460] (-1410.607) (-1412.904) -- 0:00:59
854000 -- [-1402.947] (-1412.661) (-1403.088) (-1396.770) * (-1409.051) [-1401.696] (-1407.532) (-1407.359) -- 0:00:58
854500 -- (-1405.076) [-1403.310] (-1404.972) (-1402.474) * [-1404.503] (-1413.398) (-1400.439) (-1406.133) -- 0:00:58
855000 -- [-1400.789] (-1414.207) (-1397.684) (-1400.948) * (-1399.266) (-1413.691) [-1406.778] (-1408.948) -- 0:00:58
Average standard deviation of split frequencies: 0.008502
855500 -- (-1401.673) (-1411.142) [-1405.635] (-1402.412) * [-1406.616] (-1404.456) (-1413.632) (-1408.118) -- 0:00:58
856000 -- [-1400.273] (-1407.927) (-1413.194) (-1409.947) * (-1397.508) (-1399.680) (-1406.275) [-1401.026] -- 0:00:58
856500 -- (-1400.195) [-1400.313] (-1409.794) (-1411.677) * (-1409.111) [-1400.676] (-1405.756) (-1407.557) -- 0:00:57
857000 -- (-1408.204) [-1404.390] (-1412.855) (-1416.791) * (-1417.368) (-1409.847) [-1396.759] (-1404.329) -- 0:00:57
857500 -- (-1417.180) [-1401.675] (-1411.056) (-1404.026) * (-1410.157) (-1411.993) [-1408.311] (-1406.743) -- 0:00:57
858000 -- (-1407.576) (-1400.310) (-1406.054) [-1399.932] * (-1416.609) (-1428.690) [-1412.129] (-1402.209) -- 0:00:57
858500 -- [-1405.864] (-1401.080) (-1418.260) (-1407.867) * [-1403.881] (-1416.412) (-1403.536) (-1404.399) -- 0:00:57
859000 -- (-1421.169) [-1402.609] (-1413.909) (-1408.672) * (-1409.584) (-1412.651) [-1402.686] (-1411.429) -- 0:00:56
859500 -- (-1414.369) [-1405.608] (-1400.139) (-1398.223) * (-1413.073) (-1405.520) [-1403.088] (-1418.716) -- 0:00:56
860000 -- (-1402.374) (-1413.233) [-1397.433] (-1400.064) * (-1404.793) (-1400.333) [-1399.705] (-1406.415) -- 0:00:56
Average standard deviation of split frequencies: 0.008421
860500 -- (-1407.336) (-1411.834) (-1400.137) [-1400.123] * (-1423.515) (-1411.208) [-1408.620] (-1412.468) -- 0:00:56
861000 -- [-1399.799] (-1414.952) (-1416.272) (-1413.331) * (-1414.455) (-1402.646) (-1401.305) [-1406.445] -- 0:00:56
861500 -- (-1401.443) [-1399.824] (-1410.622) (-1418.165) * (-1410.093) (-1408.336) [-1403.579] (-1417.751) -- 0:00:55
862000 -- (-1413.741) [-1404.024] (-1401.159) (-1413.129) * (-1406.297) [-1411.050] (-1407.581) (-1413.028) -- 0:00:55
862500 -- (-1406.635) (-1403.180) (-1404.050) [-1402.581] * [-1404.483] (-1401.273) (-1411.657) (-1414.316) -- 0:00:55
863000 -- [-1400.274] (-1407.269) (-1400.295) (-1415.201) * (-1406.488) [-1401.570] (-1406.911) (-1411.448) -- 0:00:55
863500 -- [-1402.784] (-1403.673) (-1399.541) (-1406.855) * (-1401.850) (-1414.127) [-1407.081] (-1419.073) -- 0:00:55
864000 -- (-1414.688) (-1404.408) [-1402.771] (-1410.704) * [-1399.729] (-1410.224) (-1408.387) (-1402.348) -- 0:00:54
864500 -- (-1418.597) (-1407.966) (-1404.599) [-1401.802] * (-1411.200) (-1408.364) (-1415.364) [-1398.874] -- 0:00:54
865000 -- (-1410.208) [-1403.804] (-1410.833) (-1404.611) * [-1403.861] (-1421.376) (-1414.061) (-1399.769) -- 0:00:54
Average standard deviation of split frequencies: 0.008471
865500 -- (-1400.870) (-1408.284) (-1404.360) [-1400.094] * [-1407.212] (-1414.847) (-1404.138) (-1402.686) -- 0:00:54
866000 -- (-1412.959) [-1400.530] (-1402.263) (-1413.171) * (-1413.069) (-1418.435) [-1410.959] (-1403.144) -- 0:00:54
866500 -- (-1413.614) [-1398.633] (-1406.926) (-1405.710) * [-1400.967] (-1421.663) (-1411.738) (-1406.418) -- 0:00:53
867000 -- (-1406.880) [-1403.574] (-1412.159) (-1420.085) * (-1403.733) [-1405.987] (-1405.860) (-1417.854) -- 0:00:53
867500 -- [-1407.994] (-1409.916) (-1416.716) (-1409.070) * [-1404.204] (-1412.415) (-1406.907) (-1416.633) -- 0:00:53
868000 -- [-1406.727] (-1400.610) (-1410.387) (-1404.767) * (-1406.237) [-1402.821] (-1413.312) (-1414.286) -- 0:00:53
868500 -- [-1405.970] (-1408.863) (-1406.278) (-1413.796) * (-1418.050) (-1406.773) [-1397.274] (-1422.794) -- 0:00:52
869000 -- (-1412.720) [-1407.986] (-1406.268) (-1404.892) * (-1411.029) (-1399.437) [-1400.151] (-1411.470) -- 0:00:52
869500 -- (-1405.060) [-1410.450] (-1405.417) (-1400.288) * (-1418.497) [-1401.448] (-1394.583) (-1412.498) -- 0:00:52
870000 -- [-1399.919] (-1398.821) (-1424.439) (-1403.203) * (-1402.145) [-1405.008] (-1412.989) (-1403.762) -- 0:00:52
Average standard deviation of split frequencies: 0.007952
870500 -- (-1405.608) (-1411.016) (-1413.035) [-1416.125] * (-1401.637) (-1412.906) [-1394.747] (-1403.225) -- 0:00:52
871000 -- [-1401.372] (-1414.884) (-1407.194) (-1411.252) * (-1411.185) [-1407.896] (-1412.101) (-1400.724) -- 0:00:51
871500 -- (-1405.181) (-1418.880) [-1402.168] (-1416.277) * (-1409.870) (-1399.646) (-1409.455) [-1401.248] -- 0:00:51
872000 -- (-1414.673) (-1407.568) (-1406.617) [-1406.017] * (-1406.811) (-1410.600) [-1403.841] (-1402.363) -- 0:00:51
872500 -- [-1409.822] (-1415.407) (-1406.335) (-1404.086) * (-1402.351) (-1401.888) (-1407.265) [-1407.884] -- 0:00:51
873000 -- (-1415.127) (-1410.540) [-1405.517] (-1408.230) * (-1407.133) (-1408.646) [-1408.292] (-1401.274) -- 0:00:51
873500 -- (-1403.288) (-1419.151) [-1402.853] (-1407.521) * [-1397.751] (-1418.643) (-1409.359) (-1411.597) -- 0:00:50
874000 -- (-1408.779) (-1418.887) (-1410.934) [-1404.466] * (-1406.612) [-1402.254] (-1405.271) (-1412.131) -- 0:00:50
874500 -- [-1409.843] (-1413.880) (-1422.977) (-1403.511) * (-1401.584) (-1408.779) [-1408.435] (-1414.249) -- 0:00:50
875000 -- (-1406.870) (-1410.146) [-1410.445] (-1404.845) * (-1415.995) (-1413.702) [-1402.342] (-1408.885) -- 0:00:50
Average standard deviation of split frequencies: 0.008173
875500 -- (-1401.843) [-1404.301] (-1409.549) (-1397.220) * (-1403.418) (-1414.502) [-1407.546] (-1410.982) -- 0:00:50
876000 -- (-1403.569) [-1395.971] (-1417.540) (-1408.961) * (-1405.637) [-1405.814] (-1408.104) (-1408.671) -- 0:00:50
876500 -- (-1412.525) [-1401.128] (-1408.013) (-1416.477) * [-1401.650] (-1418.025) (-1410.685) (-1404.761) -- 0:00:49
877000 -- (-1413.392) [-1405.849] (-1405.320) (-1408.895) * (-1409.795) (-1410.972) [-1402.515] (-1403.714) -- 0:00:49
877500 -- (-1406.370) (-1408.596) (-1400.323) [-1405.110] * [-1401.433] (-1406.863) (-1420.598) (-1418.867) -- 0:00:49
878000 -- [-1400.781] (-1402.947) (-1407.047) (-1411.483) * [-1408.604] (-1406.300) (-1425.136) (-1417.102) -- 0:00:49
878500 -- (-1407.505) (-1409.411) [-1410.291] (-1407.857) * (-1416.216) [-1409.624] (-1418.171) (-1407.034) -- 0:00:49
879000 -- (-1405.302) (-1403.224) [-1406.944] (-1404.647) * (-1408.830) (-1412.267) (-1418.355) [-1402.479] -- 0:00:48
879500 -- (-1407.107) (-1406.027) (-1429.587) [-1396.621] * (-1408.909) [-1412.189] (-1412.967) (-1403.480) -- 0:00:48
880000 -- [-1400.129] (-1415.514) (-1408.706) (-1410.939) * [-1406.611] (-1421.830) (-1408.504) (-1416.456) -- 0:00:48
Average standard deviation of split frequencies: 0.008364
880500 -- (-1405.550) (-1417.036) (-1405.633) [-1402.348] * [-1402.219] (-1405.946) (-1410.002) (-1406.976) -- 0:00:48
881000 -- (-1405.786) (-1405.354) [-1401.792] (-1407.999) * (-1409.635) (-1405.980) (-1414.836) [-1403.576] -- 0:00:48
881500 -- (-1406.022) (-1408.658) (-1407.033) [-1400.405] * (-1409.098) (-1404.680) (-1416.891) [-1410.669] -- 0:00:47
882000 -- (-1403.659) (-1415.434) [-1405.599] (-1408.817) * [-1404.392] (-1401.757) (-1416.672) (-1416.977) -- 0:00:47
882500 -- [-1403.174] (-1412.748) (-1407.162) (-1411.497) * (-1412.967) (-1400.638) (-1407.987) [-1405.893] -- 0:00:47
883000 -- (-1403.194) (-1415.210) [-1404.181] (-1402.525) * (-1410.819) (-1410.199) [-1404.299] (-1398.874) -- 0:00:47
883500 -- (-1407.386) [-1403.270] (-1413.692) (-1410.203) * (-1409.346) (-1418.094) (-1406.497) [-1399.490] -- 0:00:47
884000 -- (-1416.657) (-1402.130) [-1404.465] (-1406.805) * [-1397.685] (-1411.287) (-1406.646) (-1404.152) -- 0:00:46
884500 -- (-1412.861) [-1406.257] (-1402.761) (-1406.381) * (-1403.105) [-1414.262] (-1402.860) (-1408.308) -- 0:00:46
885000 -- (-1411.741) [-1406.509] (-1408.586) (-1415.842) * [-1400.006] (-1412.038) (-1416.047) (-1405.735) -- 0:00:46
Average standard deviation of split frequencies: 0.008347
885500 -- [-1407.966] (-1412.675) (-1409.296) (-1411.347) * (-1404.729) (-1417.846) (-1404.946) [-1398.568] -- 0:00:46
886000 -- (-1410.004) (-1411.319) (-1404.529) [-1405.355] * (-1402.850) [-1402.546] (-1408.871) (-1405.297) -- 0:00:46
886500 -- (-1408.171) (-1412.446) (-1407.150) [-1405.651] * (-1404.337) [-1404.102] (-1413.941) (-1409.721) -- 0:00:45
887000 -- (-1406.425) [-1413.571] (-1407.485) (-1399.611) * [-1405.366] (-1417.558) (-1408.365) (-1404.083) -- 0:00:45
887500 -- (-1403.230) (-1415.953) (-1411.661) [-1395.348] * [-1403.820] (-1402.042) (-1402.899) (-1409.277) -- 0:00:45
888000 -- (-1406.237) [-1405.817] (-1420.051) (-1400.983) * [-1400.484] (-1415.764) (-1412.550) (-1403.115) -- 0:00:45
888500 -- (-1413.603) (-1407.016) (-1415.999) [-1410.140] * [-1402.264] (-1396.706) (-1421.107) (-1412.338) -- 0:00:44
889000 -- (-1410.067) [-1416.312] (-1404.170) (-1411.771) * (-1405.567) [-1400.123] (-1406.529) (-1409.930) -- 0:00:44
889500 -- [-1396.294] (-1406.579) (-1411.372) (-1409.984) * (-1413.848) (-1401.967) [-1402.128] (-1412.544) -- 0:00:44
890000 -- (-1414.391) (-1413.612) (-1412.402) [-1407.133] * (-1405.144) [-1405.445] (-1407.339) (-1405.265) -- 0:00:44
Average standard deviation of split frequencies: 0.008336
890500 -- [-1400.464] (-1405.937) (-1400.268) (-1408.884) * (-1402.668) [-1400.395] (-1405.628) (-1410.980) -- 0:00:44
891000 -- (-1402.856) (-1409.032) [-1405.505] (-1412.195) * (-1411.076) (-1410.367) (-1417.990) [-1411.667] -- 0:00:43
891500 -- (-1421.224) [-1405.828] (-1405.366) (-1405.110) * (-1407.919) [-1411.968] (-1400.950) (-1416.554) -- 0:00:43
892000 -- (-1404.431) (-1418.940) [-1400.709] (-1410.443) * (-1419.692) [-1408.161] (-1411.506) (-1408.916) -- 0:00:43
892500 -- (-1405.218) [-1402.181] (-1401.712) (-1412.811) * (-1405.840) (-1414.402) [-1399.248] (-1420.031) -- 0:00:43
893000 -- (-1418.677) (-1405.812) [-1402.793] (-1412.314) * (-1416.091) (-1408.770) (-1407.990) [-1413.482] -- 0:00:43
893500 -- (-1405.668) [-1400.662] (-1418.406) (-1418.966) * (-1409.219) (-1404.105) (-1414.981) [-1401.030] -- 0:00:42
894000 -- [-1403.614] (-1418.800) (-1413.315) (-1411.432) * [-1398.278] (-1411.154) (-1412.623) (-1407.636) -- 0:00:42
894500 -- (-1409.090) (-1406.564) (-1411.922) [-1405.357] * (-1405.947) (-1412.125) (-1411.191) [-1404.012] -- 0:00:42
895000 -- [-1397.140] (-1402.081) (-1407.417) (-1406.416) * (-1402.156) (-1406.044) (-1416.124) [-1407.823] -- 0:00:42
Average standard deviation of split frequencies: 0.008023
895500 -- (-1400.313) [-1413.904] (-1403.747) (-1413.201) * (-1405.913) [-1405.186] (-1420.890) (-1401.147) -- 0:00:42
896000 -- [-1406.329] (-1409.408) (-1408.967) (-1413.052) * [-1392.531] (-1403.253) (-1407.191) (-1408.523) -- 0:00:41
896500 -- (-1411.657) (-1406.806) [-1412.091] (-1409.229) * (-1404.517) (-1410.181) [-1405.601] (-1412.481) -- 0:00:41
897000 -- (-1401.279) (-1400.675) [-1396.065] (-1405.653) * [-1400.979] (-1400.594) (-1415.961) (-1409.622) -- 0:00:41
897500 -- (-1404.452) (-1404.122) [-1405.456] (-1409.376) * (-1400.087) [-1401.831] (-1409.307) (-1410.076) -- 0:00:41
898000 -- (-1412.225) (-1398.592) [-1408.130] (-1414.176) * (-1413.154) (-1399.385) [-1411.137] (-1403.366) -- 0:00:41
898500 -- (-1410.947) (-1406.595) [-1403.927] (-1406.342) * (-1405.512) (-1412.254) (-1410.554) [-1414.841] -- 0:00:40
899000 -- (-1407.353) (-1404.505) (-1418.359) [-1410.654] * (-1405.904) [-1405.068] (-1420.790) (-1408.638) -- 0:00:40
899500 -- (-1418.988) (-1413.870) (-1406.138) [-1403.488] * (-1405.048) (-1402.823) [-1405.087] (-1410.598) -- 0:00:40
900000 -- (-1413.297) [-1403.147] (-1397.413) (-1424.368) * [-1400.688] (-1400.015) (-1407.065) (-1407.523) -- 0:00:40
Average standard deviation of split frequencies: 0.007916
900500 -- (-1415.722) (-1401.647) (-1421.924) [-1407.004] * (-1403.231) (-1404.535) (-1414.256) [-1403.764] -- 0:00:40
901000 -- (-1418.815) (-1406.619) (-1414.859) [-1400.880] * (-1406.573) (-1406.142) [-1408.971] (-1405.266) -- 0:00:39
901500 -- (-1422.120) (-1409.846) [-1402.182] (-1411.908) * [-1407.159] (-1406.297) (-1409.763) (-1406.984) -- 0:00:39
902000 -- (-1408.560) [-1398.227] (-1404.015) (-1399.189) * (-1400.222) (-1413.060) (-1408.916) [-1401.155] -- 0:00:39
902500 -- (-1406.206) (-1398.541) (-1405.917) [-1406.811] * (-1411.431) (-1402.828) (-1409.336) [-1403.747] -- 0:00:39
903000 -- (-1399.648) [-1401.512] (-1411.932) (-1403.636) * (-1422.431) (-1413.220) [-1400.033] (-1406.450) -- 0:00:39
903500 -- (-1402.740) (-1401.865) [-1402.907] (-1404.923) * (-1408.299) (-1414.599) (-1408.266) [-1403.621] -- 0:00:38
904000 -- [-1404.975] (-1409.551) (-1408.117) (-1411.295) * (-1408.573) (-1408.902) (-1399.773) [-1402.538] -- 0:00:38
904500 -- (-1408.812) [-1411.582] (-1402.266) (-1407.329) * (-1412.313) (-1411.172) [-1400.950] (-1396.771) -- 0:00:38
905000 -- (-1420.767) (-1407.536) [-1402.792] (-1398.612) * (-1403.804) (-1417.213) (-1407.597) [-1403.648] -- 0:00:38
Average standard deviation of split frequencies: 0.008065
905500 -- (-1409.690) (-1407.935) [-1402.817] (-1399.348) * (-1419.055) (-1405.018) [-1403.771] (-1404.932) -- 0:00:38
906000 -- (-1426.463) (-1422.172) (-1398.390) [-1405.634] * (-1406.387) (-1414.466) (-1412.933) [-1406.757] -- 0:00:37
906500 -- (-1408.869) (-1400.314) [-1406.126] (-1410.011) * (-1411.875) (-1414.156) (-1402.674) [-1402.354] -- 0:00:37
907000 -- (-1421.212) [-1402.677] (-1399.448) (-1406.238) * (-1401.984) (-1409.920) [-1403.498] (-1411.042) -- 0:00:37
907500 -- (-1409.059) [-1400.274] (-1404.603) (-1410.797) * [-1399.465] (-1402.798) (-1411.046) (-1412.847) -- 0:00:37
908000 -- (-1418.223) (-1424.789) (-1409.766) [-1395.626] * (-1402.332) (-1405.551) [-1403.621] (-1408.067) -- 0:00:37
908500 -- (-1409.872) [-1406.624] (-1413.216) (-1402.392) * (-1415.914) (-1406.909) [-1401.540] (-1399.656) -- 0:00:36
909000 -- (-1406.304) [-1395.338] (-1408.098) (-1416.833) * (-1406.251) (-1407.022) (-1415.435) [-1401.075] -- 0:00:36
909500 -- (-1405.420) (-1413.836) [-1404.026] (-1405.529) * [-1396.804] (-1415.376) (-1415.523) (-1399.842) -- 0:00:36
910000 -- (-1404.623) (-1422.710) [-1404.961] (-1402.488) * [-1405.434] (-1411.769) (-1407.727) (-1416.184) -- 0:00:36
Average standard deviation of split frequencies: 0.008282
910500 -- [-1409.892] (-1403.520) (-1409.164) (-1404.267) * [-1407.928] (-1410.155) (-1405.392) (-1409.967) -- 0:00:36
911000 -- (-1405.951) (-1418.283) (-1400.857) [-1398.513] * (-1408.547) (-1410.801) (-1428.332) [-1399.550] -- 0:00:35
911500 -- [-1410.608] (-1413.900) (-1413.274) (-1402.754) * (-1406.289) (-1406.834) (-1415.478) [-1405.789] -- 0:00:35
912000 -- (-1406.427) (-1407.934) [-1399.856] (-1404.853) * (-1418.003) [-1400.645] (-1418.427) (-1410.091) -- 0:00:35
912500 -- [-1396.413] (-1405.365) (-1409.382) (-1417.302) * (-1415.303) (-1416.477) (-1411.814) [-1400.894] -- 0:00:35
913000 -- (-1401.078) [-1402.345] (-1407.050) (-1399.405) * (-1406.215) [-1407.671] (-1404.509) (-1409.768) -- 0:00:35
913500 -- (-1403.982) (-1426.572) (-1417.815) [-1396.690] * (-1403.313) (-1411.863) (-1411.972) [-1407.203] -- 0:00:34
914000 -- (-1407.430) (-1401.616) (-1410.856) [-1398.632] * (-1414.135) [-1399.858] (-1404.478) (-1403.650) -- 0:00:34
914500 -- (-1400.264) (-1405.697) [-1412.977] (-1408.508) * (-1414.606) [-1406.058] (-1412.841) (-1398.937) -- 0:00:34
915000 -- [-1400.183] (-1401.252) (-1416.393) (-1405.521) * (-1406.812) (-1406.570) (-1400.190) [-1397.791] -- 0:00:34
Average standard deviation of split frequencies: 0.008073
915500 -- (-1411.717) [-1412.887] (-1421.561) (-1415.539) * [-1402.965] (-1400.600) (-1416.178) (-1405.103) -- 0:00:34
916000 -- [-1402.449] (-1412.291) (-1406.912) (-1407.398) * (-1412.309) (-1395.350) (-1414.194) [-1408.035] -- 0:00:33
916500 -- [-1400.952] (-1409.076) (-1407.296) (-1413.388) * (-1402.312) [-1407.367] (-1409.977) (-1416.201) -- 0:00:33
917000 -- [-1395.432] (-1415.375) (-1406.910) (-1406.125) * [-1409.903] (-1410.706) (-1410.977) (-1415.551) -- 0:00:33
917500 -- [-1403.680] (-1411.146) (-1408.006) (-1413.621) * (-1406.375) [-1406.820] (-1411.438) (-1414.001) -- 0:00:33
918000 -- [-1404.468] (-1413.511) (-1410.390) (-1410.606) * (-1410.097) (-1411.704) [-1403.725] (-1413.645) -- 0:00:33
918500 -- (-1414.456) [-1401.690] (-1414.378) (-1402.593) * (-1407.781) (-1403.209) [-1398.288] (-1400.657) -- 0:00:32
919000 -- [-1410.503] (-1408.513) (-1406.384) (-1409.654) * (-1407.257) [-1405.298] (-1401.140) (-1401.000) -- 0:00:32
919500 -- [-1409.822] (-1404.682) (-1408.693) (-1403.784) * (-1406.209) (-1411.119) (-1411.361) [-1401.253] -- 0:00:32
920000 -- [-1411.687] (-1403.542) (-1407.338) (-1402.001) * (-1413.656) [-1405.132] (-1408.034) (-1406.381) -- 0:00:32
Average standard deviation of split frequencies: 0.007584
920500 -- (-1413.420) (-1412.837) [-1405.958] (-1407.896) * (-1410.142) (-1409.335) [-1402.242] (-1400.995) -- 0:00:32
921000 -- (-1423.354) [-1409.874] (-1411.290) (-1407.324) * (-1415.930) (-1416.953) [-1401.858] (-1395.423) -- 0:00:31
921500 -- [-1410.012] (-1406.342) (-1411.854) (-1418.071) * (-1399.492) (-1415.209) [-1406.610] (-1405.105) -- 0:00:31
922000 -- (-1412.141) (-1406.499) (-1399.919) [-1406.761] * (-1409.596) (-1409.017) [-1404.973] (-1426.915) -- 0:00:31
922500 -- (-1407.670) [-1405.144] (-1400.963) (-1399.528) * (-1408.579) (-1415.179) [-1401.058] (-1409.959) -- 0:00:31
923000 -- (-1404.119) (-1408.807) [-1408.544] (-1407.777) * (-1420.481) (-1410.239) (-1402.629) [-1401.431] -- 0:00:31
923500 -- (-1405.745) [-1410.337] (-1406.478) (-1403.877) * (-1415.104) [-1408.904] (-1401.838) (-1406.826) -- 0:00:30
924000 -- [-1404.204] (-1415.408) (-1411.823) (-1413.235) * (-1405.945) (-1404.596) (-1407.116) [-1404.808] -- 0:00:30
924500 -- (-1401.810) [-1403.085] (-1409.641) (-1418.971) * (-1411.211) [-1408.131] (-1397.405) (-1419.743) -- 0:00:30
925000 -- (-1411.680) (-1410.615) [-1413.195] (-1417.937) * (-1401.456) [-1410.714] (-1409.407) (-1408.546) -- 0:00:30
Average standard deviation of split frequencies: 0.007318
925500 -- [-1397.821] (-1407.279) (-1404.082) (-1395.334) * (-1401.130) [-1405.154] (-1407.060) (-1411.492) -- 0:00:30
926000 -- (-1407.126) (-1403.388) (-1406.291) [-1404.239] * (-1416.021) (-1401.440) [-1397.151] (-1405.528) -- 0:00:29
926500 -- (-1403.482) (-1406.709) [-1398.848] (-1412.979) * (-1414.148) [-1406.709] (-1409.339) (-1403.278) -- 0:00:29
927000 -- (-1411.296) (-1406.405) (-1407.852) [-1402.927] * (-1408.540) [-1405.361] (-1415.625) (-1411.941) -- 0:00:29
927500 -- (-1402.484) [-1403.464] (-1412.095) (-1404.544) * [-1407.423] (-1407.204) (-1419.760) (-1416.821) -- 0:00:29
928000 -- (-1417.086) (-1405.025) [-1409.227] (-1415.080) * (-1408.229) (-1406.615) (-1404.701) [-1400.468] -- 0:00:29
928500 -- (-1425.569) [-1405.302] (-1410.100) (-1409.602) * [-1406.166] (-1402.386) (-1404.856) (-1404.619) -- 0:00:28
929000 -- (-1422.452) [-1406.821] (-1412.106) (-1414.839) * (-1417.413) [-1401.916] (-1417.554) (-1411.924) -- 0:00:28
929500 -- (-1418.960) (-1408.452) (-1402.701) [-1400.634] * (-1409.866) (-1416.923) [-1405.482] (-1403.657) -- 0:00:28
930000 -- (-1410.829) (-1400.112) [-1400.966] (-1412.154) * (-1412.992) (-1412.895) [-1407.048] (-1403.993) -- 0:00:28
Average standard deviation of split frequencies: 0.007091
930500 -- [-1404.314] (-1404.748) (-1416.051) (-1409.182) * (-1410.135) (-1410.671) (-1406.762) [-1404.135] -- 0:00:28
931000 -- [-1400.754] (-1402.049) (-1406.709) (-1411.388) * (-1404.699) (-1398.715) [-1404.702] (-1405.364) -- 0:00:27
931500 -- (-1420.415) (-1400.292) [-1405.571] (-1400.674) * (-1403.955) (-1405.329) [-1402.389] (-1406.942) -- 0:00:27
932000 -- (-1421.682) (-1412.130) (-1418.578) [-1397.442] * (-1402.031) (-1410.941) [-1405.023] (-1397.636) -- 0:00:27
932500 -- (-1410.647) (-1411.560) (-1411.416) [-1403.179] * (-1415.268) (-1406.803) [-1411.110] (-1415.118) -- 0:00:27
933000 -- (-1405.321) (-1412.056) [-1398.902] (-1396.408) * (-1406.020) [-1400.341] (-1408.765) (-1434.829) -- 0:00:27
933500 -- (-1413.494) [-1406.443] (-1402.980) (-1400.723) * (-1405.652) (-1411.645) [-1400.335] (-1414.678) -- 0:00:26
934000 -- (-1410.520) (-1407.609) [-1408.478] (-1400.786) * (-1404.708) (-1408.087) (-1414.206) [-1407.768] -- 0:00:26
934500 -- [-1404.993] (-1409.171) (-1400.009) (-1410.008) * [-1404.263] (-1410.659) (-1411.304) (-1403.090) -- 0:00:26
935000 -- (-1414.868) [-1411.120] (-1402.837) (-1404.523) * (-1408.794) (-1402.830) (-1404.415) [-1407.655] -- 0:00:26
Average standard deviation of split frequencies: 0.007460
935500 -- (-1402.183) [-1401.520] (-1405.864) (-1406.975) * (-1413.657) (-1412.705) (-1402.077) [-1395.206] -- 0:00:25
936000 -- [-1399.930] (-1416.397) (-1406.630) (-1411.929) * (-1407.429) [-1396.814] (-1404.749) (-1405.149) -- 0:00:25
936500 -- [-1400.771] (-1403.304) (-1406.934) (-1398.066) * (-1403.596) [-1399.251] (-1411.223) (-1401.155) -- 0:00:25
937000 -- [-1395.809] (-1411.453) (-1412.818) (-1415.054) * (-1412.572) (-1405.697) (-1404.835) [-1400.748] -- 0:00:25
937500 -- [-1404.739] (-1408.155) (-1410.766) (-1407.800) * (-1409.295) (-1412.761) [-1405.058] (-1416.425) -- 0:00:25
938000 -- (-1412.945) (-1410.350) [-1399.432] (-1412.288) * (-1412.076) (-1404.560) [-1401.549] (-1401.961) -- 0:00:24
938500 -- (-1407.907) (-1406.552) [-1409.637] (-1410.384) * (-1398.902) (-1408.978) (-1403.688) [-1396.031] -- 0:00:24
939000 -- (-1411.146) [-1400.631] (-1408.497) (-1425.820) * (-1401.182) (-1411.499) (-1401.353) [-1402.453] -- 0:00:24
939500 -- [-1404.844] (-1397.709) (-1411.940) (-1412.262) * (-1407.684) (-1402.178) (-1414.970) [-1401.900] -- 0:00:24
940000 -- (-1399.846) (-1404.355) [-1404.225] (-1408.566) * (-1411.244) (-1412.435) (-1408.687) [-1402.339] -- 0:00:24
Average standard deviation of split frequencies: 0.007110
940500 -- [-1403.472] (-1410.784) (-1402.095) (-1402.211) * (-1410.617) [-1409.993] (-1416.834) (-1408.739) -- 0:00:23
941000 -- (-1403.818) [-1399.082] (-1406.471) (-1405.493) * (-1410.306) (-1404.127) (-1417.505) [-1409.890] -- 0:00:23
941500 -- (-1409.548) (-1403.579) [-1399.314] (-1429.774) * [-1420.385] (-1405.967) (-1407.590) (-1401.859) -- 0:00:23
942000 -- [-1402.335] (-1405.410) (-1409.072) (-1406.448) * (-1407.880) [-1399.262] (-1400.342) (-1411.860) -- 0:00:23
942500 -- (-1416.371) (-1404.800) (-1412.444) [-1408.713] * (-1406.688) (-1407.367) [-1404.591] (-1406.898) -- 0:00:23
943000 -- (-1410.184) [-1402.966] (-1407.323) (-1406.412) * (-1405.655) [-1406.300] (-1408.727) (-1418.000) -- 0:00:22
943500 -- (-1412.870) [-1403.889] (-1408.068) (-1409.168) * (-1403.117) (-1409.772) [-1404.852] (-1403.572) -- 0:00:22
944000 -- (-1409.759) [-1403.575] (-1407.462) (-1418.595) * (-1416.124) (-1410.055) [-1402.086] (-1399.806) -- 0:00:22
944500 -- (-1416.999) (-1409.625) (-1412.046) [-1404.149] * (-1411.017) [-1401.589] (-1402.241) (-1406.399) -- 0:00:22
945000 -- [-1411.184] (-1404.126) (-1412.747) (-1417.259) * (-1412.982) (-1410.759) [-1406.287] (-1405.957) -- 0:00:22
Average standard deviation of split frequencies: 0.006945
945500 -- (-1409.517) (-1403.273) [-1402.951] (-1420.808) * (-1405.417) [-1409.143] (-1412.898) (-1405.797) -- 0:00:21
946000 -- [-1409.575] (-1416.030) (-1408.813) (-1415.033) * (-1407.304) (-1399.176) (-1414.382) [-1407.625] -- 0:00:21
946500 -- (-1408.155) [-1402.995] (-1403.326) (-1403.137) * (-1413.925) (-1405.926) [-1397.222] (-1407.056) -- 0:00:21
947000 -- (-1411.143) (-1405.344) (-1401.291) [-1406.206] * [-1397.850] (-1403.283) (-1406.031) (-1403.600) -- 0:00:21
947500 -- (-1415.458) (-1402.959) (-1410.434) [-1405.775] * (-1411.426) (-1397.633) [-1406.671] (-1401.259) -- 0:00:21
948000 -- (-1406.878) [-1399.136] (-1406.901) (-1412.209) * [-1403.214] (-1404.998) (-1414.371) (-1398.569) -- 0:00:20
948500 -- (-1407.468) [-1399.786] (-1405.286) (-1422.909) * (-1416.378) [-1396.292] (-1408.269) (-1411.528) -- 0:00:20
949000 -- (-1423.361) (-1405.361) [-1394.633] (-1400.694) * (-1413.395) [-1401.101] (-1419.786) (-1414.311) -- 0:00:20
949500 -- (-1428.203) (-1402.542) [-1407.588] (-1402.138) * (-1414.190) (-1412.345) [-1410.728] (-1404.747) -- 0:00:20
950000 -- (-1425.792) (-1408.801) [-1404.765] (-1404.893) * (-1409.128) (-1409.896) [-1408.623] (-1399.501) -- 0:00:20
Average standard deviation of split frequencies: 0.007035
950500 -- (-1415.689) [-1404.876] (-1407.489) (-1403.343) * (-1403.537) (-1407.631) [-1407.021] (-1412.552) -- 0:00:19
951000 -- (-1421.466) [-1406.992] (-1413.543) (-1405.554) * [-1407.010] (-1415.552) (-1415.380) (-1415.438) -- 0:00:19
951500 -- (-1410.992) [-1398.045] (-1412.444) (-1414.905) * (-1409.044) (-1404.567) [-1416.827] (-1407.881) -- 0:00:19
952000 -- (-1408.796) (-1400.522) (-1405.040) [-1405.325] * [-1408.606] (-1414.911) (-1396.846) (-1414.156) -- 0:00:19
952500 -- (-1412.182) [-1402.515] (-1409.631) (-1410.088) * (-1426.022) [-1403.175] (-1421.334) (-1411.100) -- 0:00:19
953000 -- (-1410.859) (-1402.396) [-1396.826] (-1403.926) * (-1410.782) [-1404.953] (-1412.803) (-1411.597) -- 0:00:18
953500 -- (-1398.510) (-1416.539) (-1400.904) [-1403.388] * (-1408.897) (-1404.825) [-1404.751] (-1406.180) -- 0:00:18
954000 -- [-1398.762] (-1414.086) (-1411.760) (-1412.054) * (-1427.092) (-1405.003) (-1404.617) [-1404.214] -- 0:00:18
954500 -- (-1406.593) (-1412.366) [-1399.095] (-1403.417) * (-1407.053) (-1404.852) (-1415.866) [-1405.156] -- 0:00:18
955000 -- (-1406.418) (-1419.586) (-1412.595) [-1397.999] * (-1402.907) [-1408.721] (-1411.376) (-1403.892) -- 0:00:18
Average standard deviation of split frequencies: 0.007027
955500 -- (-1419.008) (-1411.550) (-1420.602) [-1398.897] * (-1411.995) [-1402.778] (-1410.936) (-1407.152) -- 0:00:17
956000 -- (-1401.144) (-1411.546) (-1408.436) [-1401.572] * [-1404.345] (-1399.830) (-1410.747) (-1417.663) -- 0:00:17
956500 -- (-1414.825) (-1414.635) [-1401.678] (-1408.786) * [-1402.829] (-1411.886) (-1408.170) (-1403.177) -- 0:00:17
957000 -- [-1403.008] (-1416.312) (-1408.472) (-1402.972) * (-1408.208) [-1398.241] (-1411.049) (-1406.800) -- 0:00:17
957500 -- (-1410.089) (-1411.064) [-1398.783] (-1403.982) * (-1405.226) (-1401.439) [-1403.223] (-1401.961) -- 0:00:17
958000 -- (-1407.151) (-1404.673) (-1408.269) [-1404.643] * [-1401.338] (-1406.077) (-1410.092) (-1398.562) -- 0:00:16
958500 -- (-1409.540) (-1400.467) (-1405.615) [-1406.120] * (-1410.597) (-1412.107) (-1411.989) [-1407.312] -- 0:00:16
959000 -- (-1404.363) (-1408.459) [-1405.738] (-1418.190) * [-1404.602] (-1405.693) (-1408.684) (-1406.035) -- 0:00:16
959500 -- (-1415.451) (-1417.390) [-1405.667] (-1403.616) * [-1403.485] (-1400.437) (-1405.340) (-1410.427) -- 0:00:16
960000 -- (-1409.954) (-1419.179) (-1412.705) [-1406.027] * (-1405.911) [-1401.072] (-1412.097) (-1416.473) -- 0:00:16
Average standard deviation of split frequencies: 0.007207
960500 -- (-1413.582) (-1415.250) [-1401.811] (-1404.849) * [-1407.388] (-1397.156) (-1413.717) (-1411.170) -- 0:00:15
961000 -- (-1408.520) (-1410.793) (-1403.437) [-1402.459] * [-1402.329] (-1400.430) (-1409.035) (-1413.097) -- 0:00:15
961500 -- [-1404.128] (-1410.037) (-1406.926) (-1402.621) * (-1405.633) [-1402.120] (-1409.846) (-1412.330) -- 0:00:15
962000 -- (-1403.532) [-1401.986] (-1412.994) (-1400.894) * [-1404.847] (-1404.960) (-1409.257) (-1406.826) -- 0:00:15
962500 -- (-1408.714) (-1416.650) (-1410.911) [-1400.813] * (-1421.651) (-1405.626) (-1407.491) [-1403.940] -- 0:00:15
963000 -- (-1403.389) [-1408.445] (-1409.801) (-1408.534) * (-1405.179) [-1409.971] (-1410.273) (-1409.532) -- 0:00:14
963500 -- [-1405.259] (-1408.498) (-1406.131) (-1404.901) * (-1400.980) (-1404.434) (-1405.802) [-1409.511] -- 0:00:14
964000 -- (-1416.043) (-1411.461) [-1407.906] (-1403.095) * (-1419.171) (-1409.582) [-1401.414] (-1409.068) -- 0:00:14
964500 -- (-1420.176) (-1416.433) (-1409.112) [-1401.982] * [-1406.555] (-1414.770) (-1402.690) (-1414.488) -- 0:00:14
965000 -- [-1414.370] (-1410.143) (-1409.602) (-1399.280) * (-1413.351) (-1407.215) [-1400.920] (-1413.720) -- 0:00:14
Average standard deviation of split frequencies: 0.006588
965500 -- (-1409.410) [-1401.480] (-1404.503) (-1405.126) * (-1411.587) (-1414.829) [-1400.773] (-1404.101) -- 0:00:13
966000 -- [-1413.400] (-1406.717) (-1396.619) (-1403.005) * (-1400.189) (-1413.583) (-1409.729) [-1401.069] -- 0:00:13
966500 -- (-1412.956) (-1406.475) [-1404.773] (-1406.698) * (-1404.338) (-1411.446) [-1398.312] (-1410.374) -- 0:00:13
967000 -- (-1409.767) (-1408.665) [-1409.577] (-1420.106) * (-1407.689) (-1406.828) (-1405.944) [-1400.739] -- 0:00:13
967500 -- (-1400.315) [-1405.887] (-1401.741) (-1422.648) * (-1422.813) (-1411.669) (-1400.613) [-1397.958] -- 0:00:13
968000 -- (-1407.016) [-1395.834] (-1402.423) (-1414.157) * (-1406.683) (-1402.381) (-1419.555) [-1399.595] -- 0:00:12
968500 -- (-1413.050) (-1403.710) (-1404.591) [-1415.097] * (-1417.965) (-1406.470) (-1409.722) [-1402.956] -- 0:00:12
969000 -- (-1418.229) (-1406.052) [-1411.327] (-1409.302) * (-1404.210) [-1402.233] (-1401.591) (-1402.876) -- 0:00:12
969500 -- [-1405.140] (-1408.462) (-1406.565) (-1404.873) * (-1416.877) (-1412.246) [-1398.267] (-1406.369) -- 0:00:12
970000 -- (-1399.821) [-1412.633] (-1410.244) (-1408.103) * [-1407.446] (-1402.563) (-1407.533) (-1410.320) -- 0:00:12
Average standard deviation of split frequencies: 0.006587
970500 -- (-1420.490) (-1397.525) [-1402.949] (-1403.156) * (-1408.771) (-1404.951) (-1405.168) [-1404.714] -- 0:00:11
971000 -- (-1408.095) [-1397.026] (-1410.611) (-1401.099) * (-1410.992) (-1419.038) (-1408.394) [-1394.346] -- 0:00:11
971500 -- (-1400.875) (-1402.051) [-1404.036] (-1415.545) * (-1409.572) [-1409.951] (-1411.601) (-1405.512) -- 0:00:11
972000 -- (-1410.714) [-1402.384] (-1400.556) (-1406.724) * (-1409.531) [-1405.379] (-1409.762) (-1400.608) -- 0:00:11
972500 -- (-1425.761) (-1405.114) [-1407.520] (-1409.076) * (-1415.369) [-1408.824] (-1408.359) (-1405.570) -- 0:00:11
973000 -- (-1415.285) [-1407.521] (-1412.325) (-1415.618) * (-1413.087) (-1404.876) (-1411.802) [-1399.721] -- 0:00:10
973500 -- (-1418.939) (-1403.543) [-1414.230] (-1406.435) * (-1408.099) [-1402.050] (-1411.117) (-1412.866) -- 0:00:10
974000 -- (-1413.112) (-1410.598) (-1407.721) [-1404.458] * (-1416.323) (-1403.055) [-1404.940] (-1405.718) -- 0:00:10
974500 -- [-1414.059] (-1404.916) (-1417.359) (-1406.213) * (-1411.583) [-1406.273] (-1408.492) (-1409.928) -- 0:00:10
975000 -- (-1405.041) [-1405.296] (-1410.675) (-1411.310) * (-1405.752) (-1406.650) [-1398.454] (-1432.173) -- 0:00:10
Average standard deviation of split frequencies: 0.006520
975500 -- (-1403.699) (-1410.466) (-1406.159) [-1404.325] * [-1403.122] (-1407.234) (-1405.233) (-1421.320) -- 0:00:09
976000 -- [-1407.069] (-1406.388) (-1404.191) (-1401.111) * [-1406.015] (-1401.162) (-1408.490) (-1407.640) -- 0:00:09
976500 -- (-1422.643) [-1403.411] (-1406.809) (-1397.661) * (-1404.423) (-1409.928) (-1412.849) [-1400.508] -- 0:00:09
977000 -- (-1409.228) (-1411.021) [-1408.129] (-1409.483) * (-1406.618) (-1409.934) [-1404.092] (-1402.608) -- 0:00:09
977500 -- (-1407.240) (-1407.559) (-1404.180) [-1414.493] * (-1402.701) (-1407.026) (-1416.336) [-1400.994] -- 0:00:09
978000 -- (-1410.959) (-1405.647) [-1402.910] (-1411.233) * (-1414.512) (-1404.027) [-1404.320] (-1419.652) -- 0:00:08
978500 -- (-1413.014) (-1422.838) (-1403.258) [-1414.542] * (-1401.286) (-1405.441) [-1405.191] (-1410.179) -- 0:00:08
979000 -- [-1401.843] (-1416.388) (-1402.320) (-1410.481) * [-1401.770] (-1404.922) (-1409.723) (-1411.286) -- 0:00:08
979500 -- [-1398.606] (-1417.642) (-1408.069) (-1412.358) * (-1416.777) [-1401.904] (-1413.219) (-1406.592) -- 0:00:08
980000 -- [-1398.611] (-1403.747) (-1412.729) (-1406.098) * (-1401.932) (-1404.607) [-1410.884] (-1416.610) -- 0:00:08
Average standard deviation of split frequencies: 0.006309
980500 -- [-1403.890] (-1410.396) (-1412.965) (-1398.687) * (-1410.002) (-1418.343) [-1400.846] (-1411.654) -- 0:00:07
981000 -- (-1406.948) [-1409.425] (-1406.625) (-1402.215) * (-1423.597) (-1415.499) [-1406.404] (-1400.921) -- 0:00:07
981500 -- [-1402.642] (-1406.049) (-1405.238) (-1407.636) * (-1417.165) (-1406.175) (-1405.285) [-1407.384] -- 0:00:07
982000 -- [-1406.718] (-1420.180) (-1419.805) (-1405.640) * (-1402.778) (-1410.925) [-1399.788] (-1405.500) -- 0:00:07
982500 -- (-1398.362) (-1413.670) (-1408.110) [-1401.779] * [-1397.593] (-1422.401) (-1405.630) (-1419.368) -- 0:00:07
983000 -- (-1402.374) (-1405.699) (-1408.290) [-1400.527] * [-1395.988] (-1416.808) (-1403.826) (-1410.674) -- 0:00:06
983500 -- (-1407.093) [-1416.327] (-1406.249) (-1410.950) * [-1399.924] (-1408.247) (-1408.194) (-1412.898) -- 0:00:06
984000 -- [-1398.151] (-1403.695) (-1408.469) (-1408.037) * (-1409.213) (-1409.128) [-1402.975] (-1407.777) -- 0:00:06
984500 -- (-1407.666) [-1403.090] (-1411.585) (-1403.923) * (-1411.600) (-1406.354) (-1418.448) [-1395.124] -- 0:00:06
985000 -- (-1408.131) (-1400.936) (-1421.616) [-1405.328] * (-1400.257) (-1411.598) [-1402.334] (-1408.481) -- 0:00:06
Average standard deviation of split frequencies: 0.005857
985500 -- [-1396.962] (-1414.182) (-1415.053) (-1404.577) * (-1401.618) (-1410.060) [-1404.774] (-1418.629) -- 0:00:05
986000 -- (-1400.360) (-1404.542) (-1406.158) [-1401.680] * (-1404.957) [-1407.749] (-1401.250) (-1411.678) -- 0:00:05
986500 -- [-1403.678] (-1398.097) (-1403.003) (-1404.132) * (-1414.475) (-1412.092) (-1403.286) [-1407.427] -- 0:00:05
987000 -- [-1402.336] (-1409.159) (-1404.737) (-1407.858) * (-1417.807) [-1398.385] (-1413.321) (-1413.071) -- 0:00:05
987500 -- (-1405.126) [-1400.463] (-1405.836) (-1407.665) * (-1407.249) [-1402.616] (-1409.595) (-1395.902) -- 0:00:05
988000 -- [-1406.152] (-1406.709) (-1413.828) (-1413.023) * (-1412.198) (-1402.095) (-1406.053) [-1401.506] -- 0:00:04
988500 -- (-1405.268) [-1396.278] (-1405.798) (-1406.280) * [-1401.570] (-1407.285) (-1411.725) (-1412.294) -- 0:00:04
989000 -- (-1406.394) (-1401.986) (-1401.355) [-1417.159] * [-1395.905] (-1410.333) (-1410.982) (-1407.635) -- 0:00:04
989500 -- (-1403.260) (-1401.195) (-1403.771) [-1399.708] * (-1401.994) [-1411.345] (-1410.934) (-1408.728) -- 0:00:04
990000 -- [-1399.369] (-1400.926) (-1406.118) (-1417.746) * (-1405.492) (-1411.970) [-1406.270] (-1406.042) -- 0:00:04
Average standard deviation of split frequencies: 0.005353
990500 -- (-1408.677) [-1400.799] (-1404.426) (-1412.733) * (-1398.077) [-1401.967] (-1402.907) (-1415.296) -- 0:00:03
991000 -- (-1413.058) [-1408.666] (-1420.781) (-1403.100) * (-1403.360) [-1396.205] (-1412.899) (-1409.547) -- 0:00:03
991500 -- [-1403.884] (-1405.078) (-1424.013) (-1406.788) * (-1410.394) (-1400.361) (-1411.091) [-1402.105] -- 0:00:03
992000 -- (-1402.758) [-1408.487] (-1416.474) (-1411.041) * [-1407.412] (-1419.095) (-1407.830) (-1402.096) -- 0:00:03
992500 -- (-1401.669) [-1409.219] (-1405.816) (-1405.150) * (-1408.054) [-1401.180] (-1412.511) (-1401.427) -- 0:00:03
993000 -- (-1417.823) (-1404.761) [-1399.788] (-1409.914) * (-1411.427) (-1404.515) (-1414.567) [-1407.791] -- 0:00:02
993500 -- (-1408.751) (-1413.004) (-1414.522) [-1413.128] * [-1403.285] (-1424.123) (-1401.516) (-1412.726) -- 0:00:02
994000 -- (-1417.218) (-1399.812) (-1400.674) [-1404.482] * [-1414.444] (-1406.510) (-1408.867) (-1402.262) -- 0:00:02
994500 -- [-1408.456] (-1420.566) (-1413.105) (-1404.876) * [-1405.226] (-1415.655) (-1405.297) (-1409.068) -- 0:00:02
995000 -- (-1401.008) (-1414.515) (-1411.635) [-1401.153] * (-1417.479) (-1402.079) (-1414.094) [-1405.459] -- 0:00:02
Average standard deviation of split frequencies: 0.004881
995500 -- (-1411.515) (-1413.330) (-1411.162) [-1398.917] * (-1418.467) (-1406.481) [-1408.693] (-1405.215) -- 0:00:01
996000 -- (-1411.056) (-1402.689) [-1398.202] (-1410.036) * (-1411.736) (-1403.104) [-1399.589] (-1409.003) -- 0:00:01
996500 -- (-1411.753) (-1408.276) (-1408.409) [-1397.965] * (-1411.387) (-1408.251) [-1397.491] (-1401.971) -- 0:00:01
997000 -- (-1411.548) [-1402.466] (-1405.947) (-1411.199) * (-1417.775) [-1412.150] (-1399.381) (-1411.498) -- 0:00:01
997500 -- [-1405.632] (-1413.259) (-1413.279) (-1402.312) * (-1417.497) [-1403.727] (-1399.281) (-1408.774) -- 0:00:01
998000 -- (-1407.715) [-1407.562] (-1403.235) (-1407.046) * (-1417.958) (-1398.141) [-1402.534] (-1409.292) -- 0:00:00
998500 -- (-1407.595) [-1403.513] (-1414.623) (-1411.035) * (-1415.911) (-1410.803) (-1405.162) [-1408.016] -- 0:00:00
999000 -- (-1422.453) [-1398.359] (-1410.804) (-1406.052) * (-1412.485) (-1403.848) (-1412.701) [-1413.751] -- 0:00:00
999500 -- (-1414.947) [-1402.950] (-1411.609) (-1408.110) * (-1424.578) [-1408.500] (-1416.769) (-1427.802) -- 0:00:00
1000000 -- [-1410.717] (-1402.664) (-1402.950) (-1409.961) * (-1410.505) (-1418.512) (-1401.697) [-1417.375] -- 0:00:00
Average standard deviation of split frequencies: 0.004681
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1410.716906 -- 10.804717
Chain 1 -- -1410.716916 -- 10.804717
Chain 2 -- -1402.664146 -- 15.340737
Chain 2 -- -1402.664169 -- 15.340737
Chain 3 -- -1402.950433 -- 20.758581
Chain 3 -- -1402.950474 -- 20.758581
Chain 4 -- -1409.961193 -- 18.111966
Chain 4 -- -1409.961193 -- 18.111966
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1410.504600 -- 12.886317
Chain 1 -- -1410.504585 -- 12.886317
Chain 2 -- -1418.512185 -- 16.152511
Chain 2 -- -1418.512179 -- 16.152511
Chain 3 -- -1401.696631 -- 18.069393
Chain 3 -- -1401.696626 -- 18.069393
Chain 4 -- -1417.374636 -- 13.867179
Chain 4 -- -1417.374649 -- 13.867179
Analysis completed in 6 mins 43 seconds
Analysis used 402.52 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1389.34
Likelihood of best state for "cold" chain of run 2 was -1389.37
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
52.1 % ( 41 %) Dirichlet(Revmat{all})
66.3 % ( 50 %) Slider(Revmat{all})
29.1 % ( 36 %) Dirichlet(Pi{all})
30.5 % ( 29 %) Slider(Pi{all})
30.2 % ( 25 %) Multiplier(Alpha{1,2})
42.7 % ( 21 %) Multiplier(Alpha{3})
49.8 % ( 31 %) Slider(Pinvar{all})
17.6 % ( 15 %) ExtSPR(Tau{all},V{all})
6.5 % ( 9 %) ExtTBR(Tau{all},V{all})
25.5 % ( 29 %) NNI(Tau{all},V{all})
27.5 % ( 25 %) ParsSPR(Tau{all},V{all})
26.8 % ( 21 %) Multiplier(V{all})
40.8 % ( 44 %) Nodeslider(V{all})
25.7 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
52.3 % ( 44 %) Dirichlet(Revmat{all})
65.3 % ( 52 %) Slider(Revmat{all})
29.3 % ( 19 %) Dirichlet(Pi{all})
30.5 % ( 32 %) Slider(Pi{all})
29.8 % ( 35 %) Multiplier(Alpha{1,2})
42.2 % ( 28 %) Multiplier(Alpha{3})
49.9 % ( 21 %) Slider(Pinvar{all})
17.6 % ( 13 %) ExtSPR(Tau{all},V{all})
6.5 % ( 8 %) ExtTBR(Tau{all},V{all})
25.9 % ( 29 %) NNI(Tau{all},V{all})
27.5 % ( 28 %) ParsSPR(Tau{all},V{all})
26.8 % ( 19 %) Multiplier(V{all})
40.7 % ( 42 %) Nodeslider(V{all})
25.5 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.72 0.50 0.33
2 | 166573 0.74 0.53
3 | 166223 167238 0.76
4 | 166755 166981 166230
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.72 0.50 0.33
2 | 166512 0.74 0.53
3 | 167110 166314 0.76
4 | 165728 167026 167310
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1401.53
| 1 |
| |
| 2 1 2 1 1 2 |
| 22 1 2 1 2 2 2 |
| 1 1 2 22 11 2 1 1 |
| * 11 21 2 2 1 1 21 11 2 21 1|
|2 2 21 1 22 2 * 1 2 2 2 1 2 2 |
| 21 12 1 2 2 1 1*1 22 12* 1 |
| 2 2 12 *1 1 2 122 22 1 2 1 2 |
|1 2 11 21 1 12 1 1 2|
| 2 |
| 1 22 1 2 1 1 |
| 1 |
| 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1407.66
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1397.97 -1416.91
2 -1397.73 -1415.30
--------------------------------------
TOTAL -1397.84 -1416.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.576089 0.040436 1.181268 1.948034 1.559422 1152.11 1276.67 1.000
r(A<->C){all} 0.098913 0.001038 0.039216 0.162479 0.096602 737.94 823.77 1.000
r(A<->G){all} 0.221962 0.002158 0.133351 0.314957 0.219489 574.55 667.95 1.000
r(A<->T){all} 0.171376 0.002830 0.068286 0.269458 0.169705 554.55 569.91 1.000
r(C<->G){all} 0.051327 0.000308 0.020564 0.087596 0.049935 876.27 1066.24 1.000
r(C<->T){all} 0.360973 0.002830 0.260173 0.464100 0.360128 679.42 752.86 1.000
r(G<->T){all} 0.095450 0.000855 0.038454 0.152650 0.092364 910.66 971.12 1.000
pi(A){all} 0.173138 0.000282 0.141803 0.206391 0.172728 1294.15 1305.32 1.001
pi(C){all} 0.314535 0.000428 0.273723 0.354166 0.314167 1154.10 1223.84 1.000
pi(G){all} 0.278350 0.000424 0.240417 0.321302 0.277967 1193.27 1334.14 1.000
pi(T){all} 0.233977 0.000363 0.197657 0.272579 0.233701 1007.43 1022.75 1.000
alpha{1,2} 0.074869 0.000116 0.054041 0.095729 0.074391 1404.65 1452.82 1.000
alpha{3} 2.588000 0.626118 1.257271 4.189710 2.460149 1184.46 1280.65 1.000
pinvar{all} 0.384506 0.002871 0.281405 0.488287 0.385063 1309.37 1376.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
12 -- C12
13 -- C13
Key to taxon bipartitions (saved to file "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-------------------
1 -- .************
2 -- .*...........
3 -- ..*..........
4 -- ...*.........
5 -- ....*........
6 -- .....*.......
7 -- ......*......
8 -- .......*.....
9 -- ........*....
10 -- .........*...
11 -- ..........*..
12 -- ...........*.
13 -- ............*
14 -- ...**********
15 -- .......**....
16 -- .....********
17 -- .........*.**
18 -- ...........**
19 -- ...*.********
20 -- ......***.*..
21 -- ......*...*..
22 -- .....****.*..
23 -- ......*******
24 -- ..***********
25 -- .**..........
26 -- .*.**********
27 -- ......***....
28 -- .......**.*..
29 -- ...**........
-------------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
14 3002 1.000000 0.000000 1.000000 1.000000 2
15 3002 1.000000 0.000000 1.000000 1.000000 2
16 3002 1.000000 0.000000 1.000000 1.000000 2
17 2973 0.990340 0.004240 0.987342 0.993338 2
18 2928 0.975350 0.002827 0.973351 0.977348 2
19 2310 0.769487 0.001884 0.768155 0.770819 2
20 2200 0.732845 0.000000 0.732845 0.732845 2
21 1498 0.499001 0.002827 0.497002 0.500999 2
22 1320 0.439707 0.015075 0.429047 0.450366 2
23 1296 0.431712 0.019786 0.417722 0.445703 2
24 1040 0.346436 0.000942 0.345769 0.347102 2
25 1006 0.335110 0.004711 0.331779 0.338441 2
26 956 0.318454 0.005653 0.314457 0.322452 2
27 638 0.212525 0.008480 0.206529 0.218521 2
28 603 0.200866 0.006124 0.196536 0.205197 2
29 419 0.139574 0.002355 0.137908 0.141239 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.023522 0.000152 0.003549 0.047645 0.021312 1.000 2
length{all}[2] 0.011977 0.000081 0.000228 0.029057 0.009828 1.000 2
length{all}[3] 0.011707 0.000076 0.000016 0.029094 0.009693 1.000 2
length{all}[4] 0.041591 0.000436 0.005784 0.083168 0.038604 1.000 2
length{all}[5] 0.058711 0.000531 0.018029 0.103661 0.055036 1.000 2
length{all}[6] 0.084484 0.000963 0.030465 0.145987 0.080632 1.000 2
length{all}[7] 0.059231 0.000697 0.014521 0.114065 0.055990 1.000 2
length{all}[8] 0.005939 0.000038 0.000002 0.018055 0.004043 1.001 2
length{all}[9] 0.005989 0.000038 0.000000 0.017953 0.004013 1.000 2
length{all}[10] 0.181950 0.002510 0.090369 0.277858 0.177710 1.000 2
length{all}[11] 0.288808 0.005237 0.158656 0.428680 0.281208 1.000 2
length{all}[12] 0.106958 0.001416 0.039902 0.181953 0.103233 1.000 2
length{all}[13] 0.096594 0.001231 0.031783 0.164338 0.092995 1.000 2
length{all}[14] 0.069104 0.000635 0.027550 0.120831 0.066141 1.000 2
length{all}[15] 0.138063 0.001581 0.064711 0.215253 0.133752 1.002 2
length{all}[16] 0.127153 0.001817 0.052083 0.211273 0.121669 1.000 2
length{all}[17] 0.082997 0.001453 0.018760 0.157718 0.077005 1.000 2
length{all}[18] 0.075310 0.001456 0.005481 0.148307 0.070234 1.000 2
length{all}[19] 0.024284 0.000269 0.000034 0.056458 0.021051 1.001 2
length{all}[20] 0.031494 0.000436 0.000012 0.070857 0.027226 1.000 2
length{all}[21] 0.026251 0.000391 0.000160 0.067507 0.021795 0.999 2
length{all}[22] 0.029521 0.000481 0.000043 0.070279 0.025099 1.002 2
length{all}[23] 0.029367 0.000503 0.000155 0.073579 0.024761 0.999 2
length{all}[24] 0.006794 0.000047 0.000002 0.019700 0.004518 0.999 2
length{all}[25] 0.006631 0.000046 0.000025 0.019008 0.004608 1.000 2
length{all}[26] 0.006047 0.000039 0.000002 0.018901 0.004147 1.000 2
length{all}[27] 0.018059 0.000272 0.000003 0.048964 0.014051 0.999 2
length{all}[28] 0.017149 0.000238 0.000072 0.049357 0.012357 1.001 2
length{all}[29] 0.018794 0.000229 0.000065 0.049187 0.014723 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004681
Maximum standard deviation of split frequencies = 0.019786
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
|
| /----------------------------------------------- C4 (4)
| |
| | /----------------------------------- C6 (6)
+ | |
| /----77----+ | /----------------------- C7 (7)
| | | | |
| | | | | /------------ C8 (8)
| | | |-----73----+----100---+
| | \----100----+ | \------------ C9 (9)
| | | |
| | | \----------------------- C11 (11)
\----100----+ |
| | /----------------------- C10 (10)
| | |
| \-----99----+ /------------ C12 (12)
| \----98----+
| \------------ C13 (13)
|
\---------------------------------------------------------- C5 (5)
Phylogram (based on average branch lengths):
/--- C1 (1)
|
|- C2 (2)
|
|- C3 (3)
|
| /----- C4 (4)
| |
| | /----------- C6 (6)
+ | |
| /--+ | /-------- C7 (7)
| | | | |
| | | | | /- C8 (8)
| | | |---+-----------------+
| | \---------------+ | \- C9 (9)
| | | |
| | | \-------------------------------------- C11 (11)
\--------+ |
| | /------------------------ C10 (10)
| | |
| \----------+ /-------------- C12 (12)
| \--------+
| \------------- C13 (13)
|
\------- C5 (5)
|------------| 0.100 expected changes per site
Calculating tree probabilities...
Credible sets of trees (414 trees sampled):
50 % credible set contains 17 trees
90 % credible set contains 160 trees
95 % credible set contains 264 trees
99 % credible set contains 384 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 13 ls = 414
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Reading seq #12: C12
Reading seq #13: C13
Sequences read..
Counting site patterns.. 0:00
114 patterns at 138 / 138 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11 12 13
624 bytes for distance
111264 bytes for conP
15504 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, ((4, (6, (7, (8, 9), 11), (10, (12, 13)))), 5)); MP score: 179
445056 bytes for conP, adjusted
0.014389 0.014273 0.009488 0.068839 0.000000 0.058819 0.131036 0.091067 0.020184 0.064773 0.159761 0.000495 0.000465 0.236267 0.053470 0.217727 0.043931 0.130261 0.084576 0.071964 0.300000 1.300000
ntime & nrate & np: 20 2 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 22
lnL0 = -1686.516234
Iterating by ming2
Initial: fx= 1686.516234
x= 0.01439 0.01427 0.00949 0.06884 0.00000 0.05882 0.13104 0.09107 0.02018 0.06477 0.15976 0.00050 0.00047 0.23627 0.05347 0.21773 0.04393 0.13026 0.08458 0.07196 0.30000 1.30000
1 h-m-p 0.0000 0.0000 672.3098 ++ 1685.317760 m 0.0000 27 | 1/22
2 h-m-p 0.0000 0.0000 433.1995 ++ 1685.294311 m 0.0000 52 | 2/22
3 h-m-p 0.0000 0.0001 925.2054 +YCYYYYYYYY 1676.557129 9 0.0001 88 | 2/22
4 h-m-p 0.0000 0.0002 964.8890 +CYCYCCC 1652.818501 6 0.0002 124 | 2/22
5 h-m-p 0.0000 0.0001 4161.7410 +YYCCCC 1629.589054 5 0.0001 158 | 2/22
6 h-m-p 0.0001 0.0004 1164.9135 ++ 1596.823168 m 0.0004 183 | 2/22
7 h-m-p -0.0000 -0.0000 579.6554
h-m-p: -1.82994684e-20 -9.14973422e-20 5.79655385e+02 1596.823168
.. | 2/22
8 h-m-p 0.0000 0.0008 409.2066 +++CYCYYCCC 1555.959368 7 0.0008 245 | 2/22
9 h-m-p 0.0000 0.0000 4210.2197 +YCYYC 1534.550786 4 0.0000 277 | 2/22
10 h-m-p 0.0000 0.0001 2288.5657 ++ 1511.314064 m 0.0001 302 | 2/22
11 h-m-p 0.0000 0.0000 2417.5508 ++ 1499.907893 m 0.0000 327 | 2/22
12 h-m-p 0.0000 0.0002 1184.5630 ++ 1445.583131 m 0.0002 352 | 2/22
13 h-m-p 0.0000 0.0000 1436.7315
h-m-p: 2.92155736e-19 1.46077868e-18 1.43673149e+03 1445.583131
.. | 2/22
14 h-m-p 0.0000 0.0004 60126.9335 -CYCCYC 1440.374901 5 0.0000 409 | 2/22
15 h-m-p 0.0000 0.0004 579.3019 +++ 1330.156695 m 0.0004 435 | 3/22
16 h-m-p 0.0001 0.0007 118.2320 +YYYCCC 1325.805343 5 0.0005 468 | 3/22
17 h-m-p 0.0002 0.0008 276.7692 +CYYCC 1313.356875 4 0.0007 501 | 3/22
18 h-m-p 0.0000 0.0002 1131.9222 +YCYCCC 1305.488284 5 0.0001 535 | 3/22
19 h-m-p 0.0000 0.0001 859.5813 +CYCCC 1300.263450 4 0.0001 568 | 3/22
20 h-m-p 0.0001 0.0003 94.4711 +YCCC 1299.880863 3 0.0001 599 | 3/22
21 h-m-p 0.0003 0.0055 47.8093 +CYC 1299.068798 2 0.0011 628 | 3/22
22 h-m-p 0.0003 0.0021 182.4672 +YYCCC 1296.688323 4 0.0008 660 | 3/22
23 h-m-p 0.0008 0.0504 181.5356 YCCCC 1293.042356 4 0.0018 692 | 3/22
24 h-m-p 0.0014 0.0068 69.0197 CCCCC 1291.020064 4 0.0024 725 | 3/22
25 h-m-p 0.0022 0.0110 62.3937 CCCCC 1289.495602 4 0.0024 758 | 3/22
26 h-m-p 0.0012 0.0068 122.8868 CCC 1287.974077 2 0.0014 787 | 3/22
27 h-m-p 0.0012 0.0059 152.9063 CYCCCC 1285.441419 5 0.0018 821 | 3/22
28 h-m-p 0.0051 0.0254 19.7869 CC 1285.296468 1 0.0013 848 | 3/22
29 h-m-p 0.0033 0.0166 6.8138 CCC 1285.266910 2 0.0012 877 | 3/22
30 h-m-p 0.0026 0.0832 3.0136 YC 1285.199515 1 0.0049 903 | 3/22
31 h-m-p 0.0040 0.0592 3.7160 YCCC 1284.870253 3 0.0084 933 | 3/22
32 h-m-p 0.0059 0.0322 5.2568 ++ 1277.882892 m 0.0322 958 | 3/22
33 h-m-p -0.0000 -0.0000 53.4394
h-m-p: -1.70918745e-19 -8.54593723e-19 5.34394140e+01 1277.882892
.. | 3/22
34 h-m-p 0.0000 0.0005 202.7603 ++CYYCC 1274.314665 4 0.0003 1014 | 3/22
35 h-m-p 0.0000 0.0002 105.8994 +YYCCCC 1273.599551 5 0.0001 1048 | 3/22
36 h-m-p 0.0002 0.0026 70.5270 +YYC 1272.566487 2 0.0006 1076 | 3/22
37 h-m-p 0.0001 0.0005 33.5971 CCCCC 1272.506516 4 0.0001 1109 | 3/22
38 h-m-p 0.0001 0.0066 30.7602 +CYC 1272.349989 2 0.0006 1138 | 3/22
39 h-m-p 0.0021 0.0179 9.1014 YC 1272.311622 1 0.0011 1164 | 3/22
40 h-m-p 0.0023 0.0722 4.3574 CC 1272.308052 1 0.0005 1191 | 3/22
41 h-m-p 0.0003 0.0418 5.9502 +C 1272.296578 0 0.0014 1217 | 3/22
42 h-m-p 0.0024 0.2121 3.4238 YC 1272.292786 1 0.0011 1243 | 3/22
43 h-m-p 0.0019 0.0839 1.9459 CC 1272.290067 1 0.0016 1270 | 3/22
44 h-m-p 0.0039 0.4047 0.7911 +YC 1272.278528 1 0.0127 1297 | 3/22
45 h-m-p 0.0016 0.0914 6.1144 +YC 1272.245126 1 0.0043 1343 | 3/22
46 h-m-p 0.0017 0.0508 15.2675 +CYC 1272.103756 2 0.0065 1372 | 3/22
47 h-m-p 0.0017 0.0092 59.1607 CCC 1271.961510 2 0.0017 1401 | 3/22
48 h-m-p 0.0046 0.0232 19.6765 YC 1271.898211 1 0.0023 1427 | 3/22
49 h-m-p 0.0121 0.0605 2.8865 YC 1271.891635 1 0.0016 1453 | 3/22
50 h-m-p 0.0037 0.2046 1.3022 C 1271.884699 0 0.0037 1478 | 3/22
51 h-m-p 0.0017 0.1337 2.8356 ++YCC 1271.795186 2 0.0208 1508 | 3/22
52 h-m-p 0.0026 0.0131 22.1369 CCCC 1271.659783 3 0.0040 1539 | 3/22
53 h-m-p 0.2108 1.0538 0.2005 -CC 1271.657295 1 0.0165 1567 | 3/22
54 h-m-p 0.0049 1.0181 0.6790 ++CCC 1271.545374 2 0.1006 1617 | 3/22
55 h-m-p 1.6000 8.0000 0.0036 YC 1271.539754 1 0.9745 1662 | 3/22
56 h-m-p 0.7529 8.0000 0.0047 C 1271.539514 0 0.7381 1706 | 3/22
57 h-m-p 1.6000 8.0000 0.0002 Y 1271.539491 0 0.9253 1750 | 3/22
58 h-m-p 1.6000 8.0000 0.0000 Y 1271.539490 0 0.9120 1794 | 3/22
59 h-m-p 1.4563 8.0000 0.0000 Y 1271.539490 0 0.9652 1838 | 3/22
60 h-m-p 1.6000 8.0000 0.0000 C 1271.539490 0 2.5487 1882 | 3/22
61 h-m-p 1.6000 8.0000 0.0000 ---C 1271.539490 0 0.0063 1929
Out..
lnL = -1271.539490
1930 lfun, 1930 eigenQcodon, 38600 P(t)
Time used: 0:11
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, ((4, (6, (7, (8, 9), 11), (10, (12, 13)))), 5)); MP score: 179
0.022724 0.017763 0.009380 0.065640 0.000000 0.062196 0.125528 0.087781 0.027474 0.061068 0.148870 0.002258 0.008213 0.218736 0.054803 0.203251 0.043862 0.127663 0.085286 0.075570 2.514544 0.500545 0.139499
ntime & nrate & np: 20 2 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.460776
np = 23
lnL0 = -1446.937663
Iterating by ming2
Initial: fx= 1446.937663
x= 0.02272 0.01776 0.00938 0.06564 0.00000 0.06220 0.12553 0.08778 0.02747 0.06107 0.14887 0.00226 0.00821 0.21874 0.05480 0.20325 0.04386 0.12766 0.08529 0.07557 2.51454 0.50054 0.13950
1 h-m-p 0.0000 0.0000 753.2716 ++ 1441.130765 m 0.0000 28 | 1/23
2 h-m-p 0.0000 0.0000 466.4818 ++ 1432.898217 m 0.0000 54 | 2/23
3 h-m-p 0.0000 0.0000 12445.3552 ++ 1408.083909 m 0.0000 80 | 2/23
4 h-m-p 0.0000 0.0000 10701.3965
h-m-p: 8.35029885e-20 4.17514942e-19 1.07013965e+04 1408.083909
.. | 2/23
5 h-m-p 0.0000 0.0002 141996.4821 -CCYYCYYCCC 1401.556620 9 0.0000 145 | 2/23
6 h-m-p 0.0000 0.0002 404.5064 ++ 1358.737813 m 0.0002 171 | 3/23
7 h-m-p 0.0000 0.0000 637.8945 +YYYYCYCCC 1355.089426 8 0.0000 209 | 3/23
8 h-m-p 0.0000 0.0002 551.5559 +YYYCYCYCC 1343.809791 8 0.0002 247 | 3/23
9 h-m-p 0.0001 0.0008 874.2169 +CCCC 1317.854661 3 0.0005 280 | 3/23
10 h-m-p 0.0005 0.0023 81.0998 +YCCC 1314.645742 3 0.0015 312 | 3/23
11 h-m-p 0.0003 0.0013 62.2967 ++ 1312.291797 m 0.0013 338 | 3/23
12 h-m-p 0.0011 0.0056 36.9288 CCC 1311.854695 2 0.0010 368 | 3/23
13 h-m-p 0.0003 0.0017 23.1194 +CCC 1311.648650 2 0.0012 399 | 3/23
14 h-m-p 0.0025 0.0136 11.3890 YCC 1311.590125 2 0.0015 428 | 3/23
15 h-m-p 0.0020 0.0102 8.1808 YC 1311.573610 1 0.0012 455 | 3/23
16 h-m-p 0.0030 0.0360 3.3414 ------------.. | 3/23
17 h-m-p 0.0000 0.0003 144.5857 ++CYCCC 1307.532125 4 0.0003 527 | 3/23
18 h-m-p 0.0000 0.0001 345.8371 ++ 1305.823302 m 0.0001 553 | 4/23
19 h-m-p 0.0000 0.0001 858.1184 YCYCCC 1304.291952 5 0.0000 587 | 4/23
20 h-m-p 0.0002 0.0012 143.0259 ++ 1296.761693 m 0.0012 613 | 4/23
21 h-m-p 0.0000 0.0000 788.9450
h-m-p: 1.22337229e-20 6.11686144e-20 7.88945043e+02 1296.761693
.. | 4/23
22 h-m-p 0.0000 0.0003 428.0098 ++YYYC 1292.951645 3 0.0001 667 | 4/23
23 h-m-p 0.0001 0.0003 86.3791 +YYCYCC 1292.058364 5 0.0002 701 | 4/23
24 h-m-p 0.0001 0.0006 299.5744 +CYCCCC 1285.341678 5 0.0005 738 | 4/23
25 h-m-p 0.0000 0.0001 2621.8393 +YCYCCC 1275.917982 5 0.0001 773 | 4/23
26 h-m-p 0.0000 0.0001 142.4792 +YYCC 1275.526247 3 0.0001 804 | 4/23
27 h-m-p 0.0007 0.0061 16.7018 CCC 1275.401338 2 0.0010 834 | 4/23
28 h-m-p 0.0018 0.0089 6.4915 CC 1275.383955 1 0.0007 862 | 4/23
29 h-m-p 0.0011 0.0167 4.2525 CC 1275.368392 1 0.0011 890 | 4/23
30 h-m-p 0.0010 0.0332 4.5640 YC 1275.311143 1 0.0025 917 | 4/23
31 h-m-p 0.0018 0.0431 6.3162 YCCC 1275.081847 3 0.0039 948 | 4/23
32 h-m-p 0.0030 0.0174 8.1049 YCCCC 1273.998512 4 0.0059 981 | 4/23
33 h-m-p 0.0008 0.0041 17.1362 +YCYCCC 1273.027895 5 0.0023 1016 | 4/23
34 h-m-p 0.0060 0.0409 6.5290 CYC 1272.992361 2 0.0016 1045 | 4/23
35 h-m-p 0.0038 0.1020 2.7316 YC 1272.980391 1 0.0025 1072 | 4/23
36 h-m-p 0.0037 0.2765 1.8648 CC 1272.965398 1 0.0045 1100 | 4/23
37 h-m-p 0.0018 0.0733 4.7364 YC 1272.921593 1 0.0041 1127 | 4/23
38 h-m-p 0.0043 0.0822 4.5936 YC 1272.823796 1 0.0069 1154 | 4/23
39 h-m-p 0.0030 0.0640 10.4908 +YCC 1272.442684 2 0.0101 1184 | 4/23
40 h-m-p 0.0031 0.0200 33.8161 CCC 1272.138278 2 0.0026 1214 | 4/23
41 h-m-p 0.0180 0.0900 1.6689 YC 1272.131836 1 0.0028 1241 | 4/23
42 h-m-p 0.0036 1.4315 1.2940 +++CCC 1271.774375 2 0.2231 1274 | 4/23
43 h-m-p 0.2580 1.2902 0.2785 CCCC 1271.654451 3 0.3460 1306 | 4/23
44 h-m-p 1.5421 7.7106 0.0347 YYC 1271.524775 2 1.1697 1353 | 4/23
45 h-m-p 1.6000 8.0000 0.0162 YCC 1271.488909 2 1.0183 1401 | 4/23
46 h-m-p 0.9760 8.0000 0.0169 CC 1271.476050 1 1.1833 1448 | 4/23
47 h-m-p 1.6000 8.0000 0.0019 CC 1271.472675 1 2.3312 1495 | 4/23
48 h-m-p 1.6000 8.0000 0.0025 CC 1271.471170 1 1.8864 1542 | 4/23
49 h-m-p 1.6000 8.0000 0.0008 C 1271.471057 0 1.5211 1587 | 4/23
50 h-m-p 1.6000 8.0000 0.0001 Y 1271.471055 0 1.2567 1632 | 4/23
51 h-m-p 1.6000 8.0000 0.0000 C 1271.471055 0 1.3666 1677 | 4/23
52 h-m-p 1.6000 8.0000 0.0000 C 1271.471055 0 1.3283 1722 | 4/23
53 h-m-p 1.6000 8.0000 0.0000 Y 1271.471055 0 0.2161 1767 | 4/23
54 h-m-p 0.2678 8.0000 0.0000 --Y 1271.471055 0 0.0042 1814
Out..
lnL = -1271.471055
1815 lfun, 5445 eigenQcodon, 72600 P(t)
Time used: 0:32
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, ((4, (6, (7, (8, 9), 11), (10, (12, 13)))), 5)); MP score: 179
initial w for M2:NSpselection reset.
0.014861 0.014433 0.009210 0.069008 0.000000 0.058249 0.131175 0.091507 0.019426 0.065859 0.160036 0.001398 0.001528 0.236323 0.053468 0.217020 0.042965 0.129836 0.083682 0.072225 2.514421 1.302842 0.509198 0.419451 2.107983
ntime & nrate & np: 20 3 25
Bounds (np=25):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.209545
np = 25
lnL0 = -1499.840465
Iterating by ming2
Initial: fx= 1499.840465
x= 0.01486 0.01443 0.00921 0.06901 0.00000 0.05825 0.13117 0.09151 0.01943 0.06586 0.16004 0.00140 0.00153 0.23632 0.05347 0.21702 0.04297 0.12984 0.08368 0.07223 2.51442 1.30284 0.50920 0.41945 2.10798
1 h-m-p 0.0000 0.0000 918.8220 ++ 1496.077648 m 0.0000 30 | 1/25
2 h-m-p 0.0000 0.0000 277.9791 ++ 1495.995533 m 0.0000 58 | 2/25
3 h-m-p 0.0000 0.0002 663.2320 ++YYYYYYCCCC 1479.395586 10 0.0002 101 | 2/25
4 h-m-p 0.0000 0.0001 3497.0019 +CYYCCC 1440.151187 5 0.0001 139 | 2/25
5 h-m-p 0.0000 0.0000 5127.1558 +YYYYC 1435.287769 4 0.0000 172 | 2/25
6 h-m-p 0.0000 0.0001 317.4341 +YYYCCC 1433.581918 5 0.0001 208 | 2/25
7 h-m-p 0.0000 0.0000 1119.9154 +YYYCCC 1430.991659 5 0.0000 244 | 2/25
8 h-m-p 0.0003 0.0013 76.1103 YCCCC 1429.321059 4 0.0006 279 | 2/25
9 h-m-p 0.0001 0.0006 97.0641 ++ 1427.918221 m 0.0006 307 | 2/25
10 h-m-p 0.0012 0.0058 42.3165 YCCCC 1424.776203 4 0.0025 342 | 2/25
11 h-m-p 0.0011 0.0053 61.9618 +CCC 1416.428567 2 0.0043 375 | 2/25
12 h-m-p 0.0001 0.0003 180.7721 ++ 1412.751305 m 0.0003 403 | 3/25
13 h-m-p 0.0004 0.0020 97.6410 ++ 1398.410641 m 0.0020 431 | 3/25
14 h-m-p 0.0003 0.0014 465.0503 +YYCCCC 1377.630000 5 0.0009 468 | 3/25
15 h-m-p 0.0005 0.0023 463.5304 YCCCCC 1356.805271 5 0.0011 505 | 3/25
16 h-m-p 0.0006 0.0028 148.0805 YCCCC 1350.945783 4 0.0011 540 | 3/25
17 h-m-p 0.0004 0.0019 194.8651 +YCYCCC 1344.585803 5 0.0011 577 | 3/25
18 h-m-p 0.0004 0.0019 86.3260 CCCCC 1343.411194 4 0.0007 613 | 3/25
19 h-m-p 0.0007 0.0034 69.8345 CCCCC 1342.224410 4 0.0011 649 | 3/25
20 h-m-p 0.0045 0.0227 9.9395 CCCC 1341.580664 3 0.0054 683 | 3/25
21 h-m-p 0.0021 0.0905 25.9493 ++YYYC 1331.377265 3 0.0310 716 | 3/25
22 h-m-p 0.0167 0.0833 19.0744 YYCCC 1328.525302 4 0.0204 750 | 3/25
23 h-m-p 0.0095 0.0842 41.1389 +CCCC 1315.628052 3 0.0392 785 | 3/25
24 h-m-p 0.0269 0.1345 9.5302 +YYYCCC 1302.672449 5 0.0990 821 | 3/25
25 h-m-p 0.3431 1.7156 1.7743 YCYCCC 1297.884813 5 0.9068 857 | 3/25
26 h-m-p 0.4186 2.0930 1.4720 YCCCC 1294.616998 4 0.9223 892 | 3/25
27 h-m-p 0.1908 0.9538 2.5212 CCCC 1292.962951 3 0.3101 926 | 3/25
28 h-m-p 0.3502 1.7508 0.4771 CYCCC 1292.147833 4 0.6605 961 | 3/25
29 h-m-p 0.3958 1.9791 0.7896 YCCCCC 1291.212668 5 0.8338 1020 | 3/25
30 h-m-p 0.4617 2.3087 0.8583 CCC 1290.467027 2 0.6449 1074 | 3/25
31 h-m-p 0.5286 3.1393 1.0471 CCCC 1289.446544 3 0.5490 1130 | 3/25
32 h-m-p 0.3297 1.6487 0.6029 YCYCCC 1288.920587 5 0.8012 1166 | 3/25
33 h-m-p 0.3593 3.2602 1.3441 YCCC 1288.204902 3 0.5778 1221 | 3/25
34 h-m-p 0.6245 4.4235 1.2436 CCCCC 1287.347037 4 0.9214 1257 | 3/25
35 h-m-p 0.9695 6.2792 1.1819 CCCC 1285.935308 3 1.6399 1291 | 3/25
36 h-m-p 1.6000 8.0000 1.1665 CC 1285.029583 1 1.5987 1321 | 3/25
37 h-m-p 1.1684 8.0000 1.5961 CCCC 1284.320803 3 1.8513 1355 | 3/25
38 h-m-p 1.2551 8.0000 2.3543 +CYC 1282.106793 2 5.2608 1387 | 3/25
39 h-m-p 1.6000 8.0000 6.3658 CCCC 1280.263961 3 2.1071 1421 | 3/25
40 h-m-p 1.5563 8.0000 8.6187 CCCC 1279.214028 3 2.0649 1455 | 3/25
41 h-m-p 1.4081 7.0405 11.4158 CYC 1278.511129 2 1.5794 1486 | 3/25
42 h-m-p 1.6000 8.0000 7.5917 CCC 1278.231157 2 2.1041 1518 | 3/25
43 h-m-p 1.6000 8.0000 5.2292 CCC 1278.099089 2 2.1828 1550 | 3/25
44 h-m-p 1.6000 8.0000 2.3869 CYC 1278.056568 2 1.7242 1581 | 3/25
45 h-m-p 1.6000 8.0000 0.1613 CC 1278.043926 1 1.8813 1611 | 3/25
46 h-m-p 1.6000 8.0000 0.0977 CC 1278.039930 1 1.9209 1663 | 3/25
47 h-m-p 1.6000 8.0000 0.0278 +YC 1278.035106 1 4.0210 1715 | 3/25
48 h-m-p 0.3030 8.0000 0.3689 ++YC 1278.027944 1 3.4052 1768 | 3/25
49 h-m-p 1.6000 8.0000 0.0483 YC 1278.019078 1 3.6942 1819 | 3/25
50 h-m-p 0.1880 8.0000 0.9497 ++C 1278.010066 0 2.9031 1871 | 3/25
51 h-m-p 1.6000 8.0000 0.3305 +YC 1277.998399 1 4.4531 1923 | 3/25
52 h-m-p 1.6000 8.0000 0.7948 ++ 1277.951475 m 8.0000 1973 | 3/25
53 h-m-p 1.6000 8.0000 0.5345 ++ 1277.712477 m 8.0000 2023 | 3/25
54 h-m-p 0.7910 8.0000 5.4063 +CYCCC 1277.164549 4 3.7583 2081 | 3/25
55 h-m-p 0.9631 7.4791 21.0977 +CYC 1275.683774 2 4.0462 2113 | 3/25
56 h-m-p 0.2494 1.2469 53.1856 ++ 1274.281693 m 1.2469 2141 | 3/25
57 h-m-p 0.0000 0.0000 68.1909
h-m-p: 0.00000000e+00 0.00000000e+00 6.81908646e+01 1274.281693
.. | 3/25
58 h-m-p 0.0000 0.0003 518.3795 +CCCC 1271.684880 3 0.0000 2201 | 3/25
59 h-m-p 0.0001 0.0003 41.9666 CYCCC 1271.584339 4 0.0001 2236 | 3/25
60 h-m-p 0.0002 0.0028 19.7482 YCCC 1271.502488 3 0.0005 2269 | 3/25
61 h-m-p 0.0001 0.0007 23.9321 YCC 1271.489301 2 0.0001 2300 | 3/25
62 h-m-p 0.0004 0.0130 5.3449 YC 1271.478327 1 0.0009 2329 | 3/25
63 h-m-p 0.0007 0.0425 7.0197 YC 1271.474722 1 0.0003 2358 | 3/25
64 h-m-p 0.0013 0.0800 1.7599 YC 1271.473582 1 0.0009 2387 | 3/25
65 h-m-p 0.0033 0.3094 0.4818 C 1271.473467 0 0.0011 2415 | 3/25
66 h-m-p 0.0020 0.8564 0.2645 C 1271.473402 0 0.0023 2465 | 3/25
67 h-m-p 0.0020 1.0237 0.4769 YC 1271.473230 1 0.0043 2516 | 3/25
68 h-m-p 0.0013 0.3428 1.5344 YC 1271.472929 1 0.0024 2567 | 3/25
69 h-m-p 0.0025 1.2374 2.8017 YC 1271.472004 1 0.0042 2596 | 3/25
70 h-m-p 0.0061 0.8560 1.9247 YC 1271.471407 1 0.0041 2625 | 3/25
71 h-m-p 0.0094 0.7076 0.8380 C 1271.471284 0 0.0021 2653 | 3/25
72 h-m-p 0.0155 7.7584 0.3978 YC 1271.471233 1 0.0022 2704 | 3/25
73 h-m-p 0.0106 3.2482 0.0812 Y 1271.471228 0 0.0017 2754 | 3/25
74 h-m-p 0.0160 8.0000 0.0291 Y 1271.471227 0 0.0023 2804 | 3/25
75 h-m-p 0.0160 8.0000 0.0117 C 1271.471209 0 0.0181 2854 | 3/25
76 h-m-p 0.0136 2.2978 0.0156 +C 1271.470423 0 0.0584 2905 | 3/25
77 h-m-p 0.0048 0.9280 0.1903 Y 1271.470385 0 0.0019 2955 | 3/25
78 h-m-p 1.2879 8.0000 0.0003 CC 1271.469726 1 1.6090 3007 | 3/25
79 h-m-p 1.6000 8.0000 0.0002 Y 1271.469716 0 0.9372 3057 | 3/25
80 h-m-p 1.6000 8.0000 0.0000 Y 1271.469716 0 0.8851 3107 | 3/25
81 h-m-p 1.6000 8.0000 0.0000 ---Y 1271.469716 0 0.0063 3160
Out..
lnL = -1271.469716
3161 lfun, 12644 eigenQcodon, 189660 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1322.850325 S = -1306.595638 -9.298860
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 114 patterns 1:28
did 20 / 114 patterns 1:28
did 30 / 114 patterns 1:28
did 40 / 114 patterns 1:28
did 50 / 114 patterns 1:28
did 60 / 114 patterns 1:28
did 70 / 114 patterns 1:28
did 80 / 114 patterns 1:28
did 90 / 114 patterns 1:28
did 100 / 114 patterns 1:28
did 110 / 114 patterns 1:28
did 114 / 114 patterns 1:28
Time used: 1:28
Model 3: discrete
TREE # 1
(1, 2, 3, ((4, (6, (7, (8, 9), 11), (10, (12, 13)))), 5)); MP score: 179
0.014779 0.014551 0.009612 0.069850 0.000000 0.058472 0.131151 0.091524 0.019451 0.065196 0.159921 0.000220 0.001311 0.236180 0.053258 0.217223 0.043420 0.131030 0.084965 0.072671 2.514421 0.446685 0.067456 0.000050 0.000129 0.000177
ntime & nrate & np: 20 4 26
Bounds (np=26):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 14.754234
np = 26
lnL0 = -1276.545945
Iterating by ming2
Initial: fx= 1276.545945
x= 0.01478 0.01455 0.00961 0.06985 0.00000 0.05847 0.13115 0.09152 0.01945 0.06520 0.15992 0.00022 0.00131 0.23618 0.05326 0.21722 0.04342 0.13103 0.08496 0.07267 2.51442 0.44668 0.06746 0.00005 0.00013 0.00018
1 h-m-p 0.0000 0.0000 492.5133 ++ 1276.505006 m 0.0000 31 | 1/26
2 h-m-p 0.0000 0.0000 1786.1508 ++ 1276.445898 m 0.0000 60 | 2/26
3 h-m-p 0.0000 0.0000 12043.2131 ++ 1276.421391 m 0.0000 89 | 3/26
4 h-m-p 0.0000 0.0000 1118.3937 ++ 1276.393770 m 0.0000 118 | 4/26
5 h-m-p 0.0000 0.0000 505.7855 ++ 1276.227400 m 0.0000 147 | 5/26
6 h-m-p 0.0000 0.0005 109.6654 ++CCYCC 1274.407661 4 0.0004 186 | 5/26
7 h-m-p 0.0002 0.0023 171.6300 CYCCC 1273.502497 4 0.0002 222 | 5/26
8 h-m-p 0.0002 0.0012 60.5358 YCCCC 1272.673112 4 0.0006 258 | 5/26
9 h-m-p 0.0014 0.0069 8.4047 YCC 1272.638038 2 0.0010 290 | 5/26
10 h-m-p 0.0015 0.0440 5.4395 CC 1272.604839 1 0.0022 321 | 5/26
11 h-m-p 0.0031 0.0774 3.8474 YC 1272.584335 1 0.0023 351 | 5/26
12 h-m-p 0.0029 0.0621 3.0053 CC 1272.565817 1 0.0025 382 | 5/26
13 h-m-p 0.0025 0.1026 3.0240 YC 1272.512457 1 0.0053 412 | 5/26
14 h-m-p 0.0022 0.0695 7.3623 YCC 1272.375147 2 0.0049 444 | 5/26
15 h-m-p 0.0024 0.0217 15.0639 YCC 1272.276303 2 0.0018 476 | 5/26
16 h-m-p 0.0034 0.0441 7.9135 YCC 1272.227018 2 0.0023 508 | 5/26
17 h-m-p 0.0043 0.0662 4.3024 C 1272.219504 0 0.0011 537 | 5/26
18 h-m-p 0.0046 0.1642 1.0140 YC 1272.216246 1 0.0030 567 | 5/26
19 h-m-p 0.0049 0.4379 0.6246 +YC 1272.191959 1 0.0154 598 | 5/26
20 h-m-p 0.0026 0.0737 3.6592 ++YYCCC 1271.616946 4 0.0341 656 | 5/26
21 h-m-p 0.0186 0.0929 3.0154 -YC 1271.605703 1 0.0021 687 | 5/26
22 h-m-p 0.0100 0.5958 0.6441 +CC 1271.563714 1 0.0536 719 | 5/26
23 h-m-p 0.0034 0.0325 10.0684 CCC 1271.516032 2 0.0040 773 | 5/26
24 h-m-p 0.4110 8.0000 0.0968 CYC 1271.475957 2 0.4514 805 | 5/26
25 h-m-p 0.3234 8.0000 0.1351 YC 1271.472643 1 0.2373 856 | 5/26
26 h-m-p 1.6000 8.0000 0.0089 YC 1271.469868 1 1.0255 907 | 5/26
27 h-m-p 1.6000 8.0000 0.0017 C 1271.469723 0 1.3574 957 | 5/26
28 h-m-p 1.6000 8.0000 0.0004 C 1271.469716 0 1.4557 1007 | 5/26
29 h-m-p 1.6000 8.0000 0.0001 C 1271.469716 0 1.2940 1057 | 5/26
30 h-m-p 1.6000 8.0000 0.0000 Y 1271.469716 0 1.0740 1107 | 5/26
31 h-m-p 1.6000 8.0000 0.0000 C 1271.469716 0 1.4932 1157 | 5/26
32 h-m-p 1.6000 8.0000 0.0000 -C 1271.469716 0 0.1000 1208 | 5/26
33 h-m-p 0.1087 8.0000 0.0000 -------------Y 1271.469716 0 0.0000 1271
Out..
lnL = -1271.469716
1272 lfun, 5088 eigenQcodon, 76320 P(t)
Time used: 1:51
Model 7: beta
TREE # 1
(1, 2, 3, ((4, (6, (7, (8, 9), 11), (10, (12, 13)))), 5)); MP score: 179
0.016118 0.014455 0.009258 0.070119 0.000000 0.057538 0.130436 0.091882 0.019300 0.064774 0.158838 0.001537 0.000642 0.234646 0.053665 0.216215 0.043241 0.129666 0.083509 0.072553 2.514420 1.051152 1.246982
ntime & nrate & np: 20 1 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 6.235666
np = 23
lnL0 = -1435.197151
Iterating by ming2
Initial: fx= 1435.197151
x= 0.01612 0.01445 0.00926 0.07012 0.00000 0.05754 0.13044 0.09188 0.01930 0.06477 0.15884 0.00154 0.00064 0.23465 0.05367 0.21621 0.04324 0.12967 0.08351 0.07255 2.51442 1.05115 1.24698
1 h-m-p 0.0000 0.0000 607.1240 ++ 1433.754142 m 0.0000 28 | 1/23
2 h-m-p 0.0000 0.0000 234.1264 ++ 1433.416383 m 0.0000 54 | 2/23
3 h-m-p 0.0000 0.0003 218.5280 ++YYYCYCCCC 1430.419882 8 0.0002 94 | 2/23
4 h-m-p 0.0000 0.0002 432.7934 +YYCYCCC 1424.286287 6 0.0002 130 | 2/23
5 h-m-p 0.0001 0.0009 742.7785 ++ 1366.007282 m 0.0009 156 | 2/23
6 h-m-p 0.0000 0.0000 66074.0714
h-m-p: 6.85665482e-23 3.42832741e-22 6.60740714e+04 1366.007282
.. | 2/23
7 h-m-p 0.0000 0.0004 347.2495 +++ 1358.228136 m 0.0004 206 | 2/23
8 h-m-p 0.0000 0.0001 4535.9689 YYYYC 1355.558174 4 0.0000 236 | 2/23
9 h-m-p 0.0001 0.0007 229.1244 ++ 1333.695681 m 0.0007 262 | 2/23
10 h-m-p 0.0000 0.0000 634.1738
h-m-p: 3.35133898e-18 1.67566949e-17 6.34173832e+02 1333.695681
.. | 2/23
11 h-m-p 0.0000 0.0014 18904.0972 CCYYYCYCCC 1329.450042 9 0.0000 325 | 2/23
12 h-m-p 0.0001 0.0006 191.2625 ++ 1312.588856 m 0.0006 351 | 2/23
13 h-m-p 0.0000 0.0000 15306.3874
h-m-p: 2.62158349e-20 1.31079175e-19 1.53063874e+04 1312.588856
.. | 2/23
14 h-m-p 0.0000 0.0008 13485.9549 CYCYYYCC 1308.740071 7 0.0000 410 | 2/23
15 h-m-p 0.0000 0.0008 195.3961 +++ 1275.778408 m 0.0008 437 | 3/23
16 h-m-p 0.0000 0.0000 4085.3386 +YYCCC 1273.420836 4 0.0000 470 | 3/23
17 h-m-p 0.0002 0.0008 66.9838 CYCCC 1272.932887 4 0.0003 503 | 3/23
18 h-m-p 0.0002 0.0008 67.8827 +YCCC 1272.396733 3 0.0004 535 | 3/23
19 h-m-p 0.0007 0.0034 32.3228 YYCC 1272.175174 3 0.0006 565 | 3/23
20 h-m-p 0.0015 0.0118 13.6766 CCC 1272.059754 2 0.0016 595 | 3/23
21 h-m-p 0.0015 0.0090 15.0576 CYC 1271.976915 2 0.0014 624 | 3/23
22 h-m-p 0.0010 0.0275 21.8225 YC 1271.839603 1 0.0020 651 | 3/23
23 h-m-p 0.0016 0.0222 27.5555 CC 1271.682101 1 0.0020 679 | 3/23
24 h-m-p 0.0035 0.0191 15.6750 YC 1271.617549 1 0.0017 706 | 3/23
25 h-m-p 0.0021 0.0595 12.0629 CCC 1271.549305 2 0.0028 736 | 3/23
26 h-m-p 0.0033 0.0342 10.3341 YC 1271.520213 1 0.0017 763 | 3/23
27 h-m-p 0.0105 0.2346 1.6600 YC 1271.518174 1 0.0018 790 | 3/23
28 h-m-p 0.0049 0.4837 0.5952 CC 1271.517903 1 0.0016 818 | 3/23
29 h-m-p 0.0033 0.8021 0.2875 C 1271.517733 0 0.0030 864 | 3/23
30 h-m-p 0.0027 1.3429 0.4165 +YC 1271.517084 1 0.0073 912 | 3/23
31 h-m-p 0.0041 2.0599 1.2798 +YC 1271.505189 1 0.0405 960 | 3/23
32 h-m-p 0.0121 0.1168 4.2795 YC 1271.502968 1 0.0022 987 | 3/23
33 h-m-p 0.0886 4.2118 0.1085 CC 1271.499985 1 0.0754 1015 | 3/23
34 h-m-p 0.0020 0.8950 4.0477 +CCC 1271.482260 2 0.0121 1066 | 3/23
35 h-m-p 1.6000 8.0000 0.0107 CC 1271.480415 1 1.3261 1094 | 3/23
36 h-m-p 1.6000 8.0000 0.0011 +Y 1271.479353 0 6.8050 1141 | 3/23
37 h-m-p 1.6000 8.0000 0.0012 ++ 1271.473256 m 8.0000 1187 | 3/23
38 h-m-p 1.6000 8.0000 0.0042 YC 1271.470099 1 1.2356 1234 | 3/23
39 h-m-p 1.6000 8.0000 0.0020 YC 1271.469962 1 1.2091 1281 | 3/23
40 h-m-p 1.6000 8.0000 0.0005 Y 1271.469954 0 1.2031 1327 | 3/23
41 h-m-p 1.6000 8.0000 0.0001 Y 1271.469954 0 1.1326 1373 | 3/23
42 h-m-p 1.3731 8.0000 0.0000 ++ 1271.469954 m 8.0000 1419 | 3/23
43 h-m-p 0.2108 8.0000 0.0019 ++C 1271.469952 0 2.9095 1467 | 3/23
44 h-m-p 1.6000 8.0000 0.0030 ++ 1271.469937 m 8.0000 1513 | 3/23
45 h-m-p 0.0328 8.0000 0.7384 +
QuantileBeta(0.15, 0.00500, 2.36463) = 1.091226e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.52659) = 6.773317e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
+ 1271.469369 m 8.0000 1561
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.787673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88467) = 2.884990e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88491) = 2.787582e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.88443) = 2.787764e-161 2000 rounds
| 3/23
46 h-m-p 1.6000 8.0000 0.1521
QuantileBeta(0.15, 0.00500, 8.12798) = 2.698912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.85791) = 2.463569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06927) = 2.719808e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
C 1271.469197 1 1.2156 1608
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.719718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06952) = 2.814662e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06977) = 2.719630e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.06928) = 2.719806e-161 2000 rounds
| 3/23
47 h-m-p 0.7645 8.0000 0.2418
QuantileBeta(0.15, 0.00500, 8.25438) = 2.654993e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.80896) = 2.478061e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 10.00393) = 2.166871e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
C 1271.469184 0 2.6106 1655
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.510705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70076) = 2.598353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70102) = 2.510627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.70051) = 2.510783e-161 2000 rounds
| 3/23
48 h-m-p 1.2941 8.0000 0.4878
QuantileBeta(0.15, 0.00500, 9.33200) = 2.331509e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.22572) = 1.920286e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
+ 1271.469128 m 8.0000 1701
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.701945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60297) = 1.761360e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60329) = 1.701900e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.60265) = 1.701990e-161 2000 rounds
| 3/23
49 h-m-p 1.2314 8.0000 3.1690
QuantileBeta(0.15, 0.00500, 16.50517) = 1.287217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 28.21179) = 7.435723e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 37.95532) = 4.432413e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
Y 1271.469082 0 3.5167 1748
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 8.863288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74746) = 9.172703e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.74747) = 8.863284e-162 2000 rounds
| 3/23
50 h-m-p 1.6000 8.0000 2.8237
QuantileBeta(0.15, 0.00500, 28.26542) = 7.421363e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.81931) = 4.017961e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
C 1271.469061 0 1.8540 1774
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.234525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98263) = 7.487080e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.98264) = 7.234521e-162 2000 rounds
| 3/23
51 h-m-p 1.4177 8.0000 3.6928
QuantileBeta(0.15, 0.00500, 34.21780) = 4.923663e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 49.92332) = 2.010078e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
+ 1271.469040 m 8.0000 1800
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.238374e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52474) = 7.492132e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 58.52477) = 7.238371e-163 2000 rounds
| 3/23
52 h-m-p 1.3522 6.7609 5.9866 C 1271.469031 0 1.6434 1826 | 3/23
53 h-m-p 0.7391 3.6955 8.2904 ++ 1271.469025 m 3.6955 1852 | 4/23
54 h-m-p 1.6000 8.0000 0.0000 Y 1271.469025 0 0.9189 1878 | 4/23
55 h-m-p 1.6000 8.0000 0.0000 Y 1271.469025 0 0.7216 1923 | 4/23
56 h-m-p 1.2484 8.0000 0.0000 Y 1271.469025 0 0.2320 1968
Out..
lnL = -1271.469025
1969 lfun, 21659 eigenQcodon, 393800 P(t)
Time used: 4:01
Model 8: beta&w>1
TREE # 1
(1, 2, 3, ((4, (6, (7, (8, 9), 11), (10, (12, 13)))), 5)); MP score: 179
initial w for M8:NSbetaw>1 reset.
0.018670 0.014278 0.012640 0.066610 0.000000 0.057578 0.130826 0.092052 0.020665 0.065233 0.157811 0.004930 0.002101 0.229552 0.054046 0.210143 0.046150 0.125503 0.085846 0.070980 2.514418 0.900000 0.607855 1.105757 2.513519
ntime & nrate & np: 20 2 25
Bounds (np=25):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.457918
np = 25
lnL0 = -1430.453169
Iterating by ming2
Initial: fx= 1430.453169
x= 0.01867 0.01428 0.01264 0.06661 0.00000 0.05758 0.13083 0.09205 0.02066 0.06523 0.15781 0.00493 0.00210 0.22955 0.05405 0.21014 0.04615 0.12550 0.08585 0.07098 2.51442 0.90000 0.60785 1.10576 2.51352
1 h-m-p 0.0000 0.0000 806.8890 ++ 1423.701172 m 0.0000 30 | 1/25
2 h-m-p 0.0000 0.0000 488.4078 ++ 1419.070246 m 0.0000 58 | 2/25
3 h-m-p 0.0000 0.0001 938.5001 ++ 1393.562401 m 0.0001 86 | 3/25
4 h-m-p 0.0000 0.0001 633.3795 +YYYYYC 1390.658993 5 0.0001 120 | 3/25
5 h-m-p 0.0000 0.0002 991.8763 +YYCYYCCC 1375.662116 7 0.0002 159 | 3/25
6 h-m-p 0.0000 0.0000 861.2860 ++ 1371.085802 m 0.0000 187 | 3/25
7 h-m-p -0.0000 -0.0000 3288.5532
h-m-p: -3.54075425e-22 -1.77037713e-21 3.28855325e+03 1371.085802
.. | 3/25
8 h-m-p 0.0000 0.0005 7946.6850 YYCYCYCC 1354.537369 7 0.0000 250 | 3/25
9 h-m-p 0.0001 0.0005 224.3679 +CYCYYCC 1337.514502 6 0.0005 289 | 3/25
10 h-m-p 0.0000 0.0000 6140.9423 +YCYYYYYC 1304.491982 7 0.0000 326 | 3/25
11 h-m-p 0.0000 0.0001 1377.1809 ++ 1291.107065 m 0.0001 354 | 4/25
12 h-m-p 0.0003 0.0015 88.2466 +YYYYCYCCC 1286.523383 8 0.0012 394 | 3/25
13 h-m-p 0.0003 0.0014 426.5168 YYCCC 1283.721340 4 0.0001 428 | 3/25
14 h-m-p 0.0013 0.0064 24.6416 CCC 1283.114495 2 0.0021 460 | 3/25
15 h-m-p 0.0006 0.0031 31.3400 +YCCC 1282.660879 3 0.0017 494 | 3/25
16 h-m-p 0.0013 0.0116 40.5380 YCC 1282.013853 2 0.0024 525 | 3/25
17 h-m-p 0.0041 0.0334 23.9520 YCCC 1280.931519 3 0.0083 558 | 3/25
18 h-m-p 0.0031 0.0155 62.4597
QuantileBeta(0.15, 0.00500, 2.32490) = 1.114414e-160 2000 rounds
CYCCC 1279.062676 4 0.0057 593 | 3/25
19 h-m-p 0.0020 0.0102 75.8507
QuantileBeta(0.15, 0.00500, 2.51962) = 1.009225e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22369) = 1.178143e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.24211) = 1.166012e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.38087) = 1.082023e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27054) = 1.147770e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.27271) = 1.146402e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.32679) = 1.113293e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27482) = 1.145072e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.30080) = 1.128961e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
C 1277.146833 5 0.0047 629
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.184937e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144966e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27499) = 1.144967e-160 2000 rounds
| 3/25
20 h-m-p 0.0003 0.0017 186.4953
QuantileBeta(0.15, 0.00500, 2.33351) = 1.109308e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50908) = 1.014414e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
+ 1275.321564 m 0.0017 657
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 1.020692e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862612e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56760) = 9.862620e-161 2000 rounds
| 4/25
21 h-m-p 0.0015 0.0075 61.8944
QuantileBeta(0.15, 0.00500, 2.65131) = 9.485817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90247) = 8.509420e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61741) = 9.634903e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.62217) = 9.613714e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.63674) = 9.549340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62293) = 9.610338e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.62984) = 9.579743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
C 1275.125902 3 0.0010 690
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.945628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610134e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62297) = 9.610141e-161 2000 rounds
| 4/25
22 h-m-p 0.0065 0.0325 5.1422
QuantileBeta(0.15, 0.00500, 2.62098) = 9.618999e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62247) = 9.612354e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62251) = 9.612197e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.62274) = 9.611169e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
C 1275.102471 1 0.0015 720
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.947723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62252) = 9.612166e-161 2000 rounds
| 4/25
23 h-m-p 0.0023 0.1021 3.3344
QuantileBeta(0.15, 0.00500, 2.62348) = 9.607885e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62637) = 9.595065e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.63793) = 9.544122e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62520) = 9.600236e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
C 1275.027922 1 0.0065 750
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.935245e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600102e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62523) = 9.600109e-161 2000 rounds
| 4/25
24 h-m-p 0.0015 0.0429 14.8423
QuantileBeta(0.15, 0.00500, 2.62378) = 9.606566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61941) = 9.625990e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.60195) = 9.704469e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.58215) = 9.795023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60974) = 9.669292e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.60777) = 9.678166e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.60771) = 9.678454e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.60483) = 9.691444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
C 1273.989260 3 0.0175 784
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 1.001646e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60768) = 9.678588e-161 2000 rounds
| 4/25
25 h-m-p 0.0016 0.0081 36.4032
QuantileBeta(0.15, 0.00500, 2.60870) = 9.673980e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61177) = 9.660185e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60903) = 9.672506e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.61040) = 9.666341e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60919) = 9.671765e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.60980) = 9.669053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60921) = 9.671669e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.60950) = 9.670361e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
C 1273.647980 3 0.0024 818
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 1.000929e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671646e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60922) = 9.671653e-161 2000 rounds
| 4/25
26 h-m-p 0.0153 0.0766 5.2968
QuantileBeta(0.15, 0.00500, 2.59141) = 9.752467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60476) = 9.691732e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60663) = 9.683302e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
C 1273.621655 1 0.0022 847
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 1.002122e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683181e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60666) = 9.683188e-161 2000 rounds
| 4/25
27 h-m-p 0.0031 0.1520 3.7679
QuantileBeta(0.15, 0.00500, 2.60443) = 9.693258e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.59774) = 9.723593e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.57098) = 9.846838e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60090) = 9.709247e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
C 1273.547187 1 0.0080 877
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 1.004824e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709285e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60089) = 9.709292e-161 2000 rounds
| 4/25
28 h-m-p 0.0018 0.0741 16.3346
QuantileBeta(0.15, 0.00500, 2.58680) = 9.773584e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.54455) = 9.971625e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.37554) = 1.085026e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.54984) = 9.946396e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.56832) = 9.859239e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55241) = 9.934186e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.56036) = 9.896572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
C 1273.302730 2 0.0064 910
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 1.028053e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933736e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55250) = 9.933743e-161 2000 rounds
| 4/25
29 h-m-p 0.0033 0.0260 31.4736
QuantileBeta(0.15, 0.00500, 2.51319) = 1.012382e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39526) = 1.073989e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.53213) = 1.003135e-160 2000 rounds
C 1273.172558 1 0.0017 939
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.038143e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53215) = 1.003124e-160 2000 rounds
| 4/25
30 h-m-p 0.2051 1.6755 0.2620
QuantileBeta(0.15, 0.00500, 2.53140) = 1.003490e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52913) = 1.004590e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53034) = 1.004004e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.53033) = 1.004005e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.52973) = 1.004297e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.53002) = 1.004157e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
C 1272.757221 3 0.4995 972
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.039066e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53044) = 1.003953e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53018) = 1.004079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53031) = 1.004016e-160 2000 rounds
| 4/25
31 h-m-p 0.2840 1.4199 0.3921
QuantileBeta(0.15, 0.00500, 2.44021) = 1.049650e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16993) = 1.215015e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45923) = 1.039682e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.46260) = 1.037930e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.49646) = 1.020694e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46371) = 1.037359e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.48008) = 1.028959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
C 1272.604845 3 0.2096 1026
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.073515e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46395) = 1.037236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46369) = 1.037369e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46382) = 1.037303e-160 2000 rounds
| 4/25
32 h-m-p 0.3743 3.7780 0.2195
QuantileBeta(0.15, 0.00500, 2.44300) = 1.048178e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38055) = 1.082201e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42505) = 1.057740e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.42561) = 1.057437e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.43430) = 1.052787e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057260e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.43012) = 1.055019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
C 1272.378803 3 0.6810 1080
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.094166e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42607) = 1.057189e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42582) = 1.057326e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057258e-160 2000 rounds
| 4/25
33 h-m-p 0.4383 3.9761 0.3411
QuantileBeta(0.15, 0.00500, 2.40791) = 1.067029e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35381) = 1.097444e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39717) = 1.072934e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.37549) = 1.085052e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39628) = 1.073428e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.38589) = 1.079209e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39610) = 1.073528e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.39099) = 1.076361e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
C 1272.048929 3 0.7257 1135
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.111010e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39621) = 1.073463e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39596) = 1.073604e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39609) = 1.073533e-160 2000 rounds
| 4/25
34 h-m-p 0.8083 4.0415 0.2733
QuantileBeta(0.15, 0.00500, 2.43185) = 1.054096e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53914) = 9.997558e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41696) = 1.062105e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.41760) = 1.061756e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.42473) = 1.057912e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
C 1271.811743 2 0.4871 1187
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.098800e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41777) = 1.061667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41751) = 1.061805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41764) = 1.061736e-160 2000 rounds
| 4/25
35 h-m-p 1.6000 8.0000 0.0484
QuantileBeta(0.15, 0.00500, 2.39928) = 1.071767e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.34422) = 1.103020e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067009e-160 2000 rounds
C 1271.689943 1 0.8447 1237
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.104257e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40808) = 1.066938e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40782) = 1.067077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40795) = 1.067008e-160 2000 rounds
| 4/25
36 h-m-p 0.4442 6.8997 0.0920
QuantileBeta(0.15, 0.00500, 2.40981) = 1.065991e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41539) = 1.062953e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41136) = 1.065148e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
C 1271.608777 1 0.8164 1287
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.102325e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41150) = 1.065072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41124) = 1.065211e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41137) = 1.065141e-160 2000 rounds
| 4/25
37 h-m-p 1.6000 8.0000 0.0256
QuantileBeta(0.15, 0.00500, 2.41526) = 1.063023e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41234) = 1.064611e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41287) = 1.064326e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.41406) = 1.063674e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
C 1271.600130 1 0.6119 1338
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.101486e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41299) = 1.064261e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41273) = 1.064400e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41286) = 1.064330e-160 2000 rounds
| 4/25
38 h-m-p 1.1584 8.0000 0.0135
QuantileBeta(0.15, 0.00500, 2.42228) = 1.059229e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45054) = 1.044213e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42378) = 1.058422e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.43716) = 1.051270e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
C 1271.593210 1 1.3545 1389
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.095318e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42400) = 1.058302e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42375) = 1.058439e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42387) = 1.058370e-160 2000 rounds
| 4/25
39 h-m-p 1.6000 8.0000 0.0061
QuantileBeta(0.15, 0.00500, 2.43137) = 1.054352e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45386) = 1.042477e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43958) = 1.049985e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
C 1271.578984 1 3.3632 1439
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.086613e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43976) = 1.049892e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43950) = 1.050027e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43963) = 1.049959e-160 2000 rounds
| 4/25
40 h-m-p 1.4010 8.0000 0.0147
QuantileBeta(0.15, 0.00500, 2.44935) = 1.044837e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47850) = 1.029763e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.49512) = 1.021362e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46549) = 1.036438e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
C 1271.515466 1 3.7412 1490
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.072571e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46571) = 1.036325e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46545) = 1.036457e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46558) = 1.036391e-160 2000 rounds
| 4/25
41 h-m-p 1.1170 8.0000 0.0493
QuantileBeta(0.15, 0.00500, 2.49033) = 1.023773e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56456) = 9.876844e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48394) = 1.027000e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.48468) = 1.026628e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.48750) = 1.025199e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
C 1271.478838 2 0.8642 1542
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.062440e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48486) = 1.026536e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48460) = 1.026667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48473) = 1.026602e-160 2000 rounds
| 4/25
42 h-m-p 1.6000 8.0000 0.0118
QuantileBeta(0.15, 0.00500, 2.48719) = 1.025355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49459) = 1.021633e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48622) = 1.025847e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
C 1271.471571 1 0.9732 1592
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.061655e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48636) = 1.025778e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48610) = 1.025908e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48623) = 1.025843e-160 2000 rounds
| 4/25
43 h-m-p 1.6000 8.0000 0.0027
QuantileBeta(0.15, 0.00500, 2.48974) = 1.024069e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50028) = 1.018784e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024835e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
C 1271.471136 1 0.9079 1642
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.060612e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48835) = 1.024771e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48809) = 1.024901e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48822) = 1.024836e-160 2000 rounds
| 4/25
44 h-m-p 1.6000 8.0000 0.0011
QuantileBeta(0.15, 0.00500, 2.48920) = 1.024339e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49215) = 1.022853e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
C 1271.471088 0 1.3333 1691
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.060184e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48917) = 1.024357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48891) = 1.024487e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48904) = 1.024422e-160 2000 rounds
| 4/25
45 h-m-p 1.6000 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 2.48882) = 1.024532e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48817) = 1.024861e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
C 1271.471082 0 1.3408 1740
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.060279e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48899) = 1.024449e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48873) = 1.024579e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
| 4/25
46 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
Y 1271.471082 0 1.0286 1789
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.060279e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48899) = 1.024449e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48873) = 1.024579e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48886) = 1.024514e-160 2000 rounds
| 4/25
47 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.48889) = 1.024496e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024443e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.48903) = 1.024425e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
C 1271.471082 0 6.4602 1839
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.060205e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48913) = 1.024377e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48887) = 1.024507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48900) = 1.024442e-160 2000 rounds
| 4/25
48 h-m-p 1.1679 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.48914) = 1.024370e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48957) = 1.024155e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
+ 1271.471082 m 8.0000 1888
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.059697e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49010) = 1.023886e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48985) = 1.024016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48997) = 1.023951e-160 2000 rounds
| 4/25
49 h-m-p 0.0841 8.0000 0.0116
QuantileBeta(0.15, 0.00500, 2.49095) = 1.023460e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49388) = 1.021988e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.50558) = 1.016146e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.55240) = 9.934214e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
C 1271.471078 0 2.1444 1939
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.046882e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51497) = 1.011505e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51471) = 1.011633e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51484) = 1.011569e-160 2000 rounds
| 4/25
50 h-m-p 1.6000 8.0000 0.0122
QuantileBeta(0.15, 0.00500, 2.53437) = 1.002054e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.59294) = 9.745473e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
+ 1271.471046 m 8.0000 1988
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.994206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61259) = 9.656488e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61233) = 9.657675e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61246) = 9.657081e-161 2000 rounds
| 4/25
51 h-m-p 0.0967 8.0000 1.0103
QuantileBeta(0.15, 0.00500, 2.71008) = 9.237964e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.00292) = 8.172616e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.17432) = 5.588006e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.85988) = 2.462989e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 10.68819) = 2.021496e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
C 1271.470644 0 5.3876 2040
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.821531e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.05107) = 2.726355e-161 2000 rounds
| 4/25
52 h-m-p 1.6000 8.0000 0.4088
QuantileBeta(0.15, 0.00500, 8.70443) = 2.509584e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.66453) = 2.026196e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
Y 1271.470563 0 1.1920 2068
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.650943e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53807) = 2.561441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53757) = 2.561602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.53782) = 2.561521e-161 2000 rounds
| 4/25
53 h-m-p 1.0867 8.0000 0.4484
QuantileBeta(0.15, 0.00500, 9.02465) = 2.415453e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48512) = 2.062563e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
+ 1271.470510 m 8.0000 2117
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.834242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12200) = 1.772322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12137) = 1.772417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.12168) = 1.772369e-161 2000 rounds
| 4/25
54 h-m-p 1.0950 8.0000 3.2757
QuantileBeta(0.15, 0.00500, 15.70555) = 1.354874e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 26.45715) = 7.938251e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
+ 1271.470433 m 8.0000 2166
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.541585e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30507) = 4.391412e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.30506) = 4.391414e-162 2000 rounds
| 4/25
55 h-m-p 1.2687 6.3435 3.2672
QuantileBeta(0.15, 0.00500, 42.44667) = 3.957875e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 54.87150) = 1.827161e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
C 1271.470413 0 1.6679 2194
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.969890e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74996) = 3.838621e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.74994) = 3.838622e-162 2000 rounds
| 4/25
56 h-m-p 0.5407 2.7036 5.6626
QuantileBeta(0.15, 0.00500, 46.80924) = 3.585057e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 55.98716) = 7.569381e-163 2000 rounds
+
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
+ 1271.470375 m 2.7036 2222
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 7.425371e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04650) = 2.632767e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 59.04647) = 2.632768e-163 2000 rounds
| 5/25
57 h-m-p 0.4161 2.0803 19.2057 ++ 1271.470365 m 2.0803 2250 | 6/25
58 h-m-p 1.6000 8.0000 0.0001 Y 1271.470364 0 1.0811 2278 | 6/25
59 h-m-p 1.6000 8.0000 0.0000 Y 1271.470364 0 1.1210 2325 | 6/25
60 h-m-p 1.6000 8.0000 0.0000 Y 1271.470364 0 1.1463 2372 | 6/25
61 h-m-p 1.6000 8.0000 0.0000 --Y 1271.470364 0 0.0250 2421
Out..
lnL = -1271.470364
2422 lfun, 29064 eigenQcodon, 532840 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1332.477942 S = -1306.595786 -19.193224
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 114 patterns 7:23
did 20 / 114 patterns 7:23
did 30 / 114 patterns 7:23
did 40 / 114 patterns 7:23
did 50 / 114 patterns 7:24
did 60 / 114 patterns 7:24
did 70 / 114 patterns 7:24
did 80 / 114 patterns 7:24
did 90 / 114 patterns 7:24
did 100 / 114 patterns 7:24
did 110 / 114 patterns 7:25
did 114 / 114 patterns 7:25
Time used: 7:25
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=13, Len=138
D_melanogaster_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
D_sechellia_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
D_simulans_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
D_yakuba_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
D_erecta_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
D_takahashii_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
D_biarmipes_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
D_suzukii_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
D_suzukii_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
D_eugracilis_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
D_ficusphila_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
D_rhopaloa_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
D_elegans_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL
**************************************************
D_melanogaster_CG34135-PC FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
D_sechellia_CG34135-PC FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
D_simulans_CG34135-PC FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
D_yakuba_CG34135-PC FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
D_erecta_CG34135-PC FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
D_takahashii_CG34135-PC FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
D_biarmipes_CG34135-PC FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
D_suzukii_CG34135-PC FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
D_suzukii_CG34135-PC FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
D_eugracilis_CG34135-PC FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
D_ficusphila_CG34135-PC FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
D_rhopaloa_CG34135-PC FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
D_elegans_CG34135-PC FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT
**************************************************
D_melanogaster_CG34135-PC SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
D_sechellia_CG34135-PC SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
D_simulans_CG34135-PC SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
D_yakuba_CG34135-PC SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
D_erecta_CG34135-PC SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
D_takahashii_CG34135-PC SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
D_biarmipes_CG34135-PC SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
D_suzukii_CG34135-PC SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
D_suzukii_CG34135-PC SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
D_eugracilis_CG34135-PC SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
D_ficusphila_CG34135-PC SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
D_rhopaloa_CG34135-PC SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
D_elegans_CG34135-PC SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
**************************************
>D_melanogaster_CG34135-PC ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG TAGTGCCGCCCTTGTGGGCGCCTTTGGCGTCTGCCAGCGCCAAATCAGCG CCATTTTAATCACAGGAGTGATGTATTTACTGGCGGCGCTCTTTGCCCTC TTCACGCTCATGATCATTCACTTCAAGCGGCAGCAGGGACGTCCCATGCT GGACAGCGACTACGATGGCACGGTGGATGGAATAGTGGCGCGACCAGGAG GCGTGGCCATAATGGCCAAGCCGCTGCTGGGAGCACGCATCTTCCTCACC TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTCTGCGCCATCAC CTCGGTACTGTGGATCCTGCTCTCCAAAATCATGCGGTACAACCCCTTCT CGGCGCTCATGATT >D_sechellia_CG34135-PC ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG TAGTGCCGCCCTTGTGGGCGCCTTTGGCGTCTGCCAGCGCCAAATCAGCG CCATTTTAATCACAGGAGTGATGTATTTACTGGCGGCGCTCTTTGCCCTC TTCACGCTCATGATCATTCACTTCAAGCGGCAGCAGGGACGTCCCATGCT GGACAGCGACTACGATGGCACGGTGGACGGAATAGTGGCGCGACCAGGAG GCGTGGCCATAATGGCCAAGCCGCTGCTGGGAGCGCGCATCTTCCTCACC TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTCTGCGCCATCAC CTCGGTACTGTGGATCCTTCTCTCCAAGATCATGCGGTACAACCCCTTCT CGGCGCTCATGATT >D_simulans_CG34135-PC ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG TAGTGCCGCCCTTGTGGGCGCCTTTGGCGTCTGCCAGCGCCAAATCAGCG CCATTTTAATCACAGGAGTGATGTATTTACTGGCGGCGCTGTTTGCCCTC TTCACGCTCATGATCATTCACTTCAAGCGGCAGCAGGGACGTCCCATGCT GGACAGCGACTACGATGGCACGGTGGACGGAATAGTGGCGCGACCAGGAG GCGTGGCCATAATGGCCAAGCCGCTGCTGGGAGCGCGCATCTTCCTCACC TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTCTGCGCCATCAC CTCGGTACTGTGGATCCTGCTCTCCAAGATCATGCGGTACAACCCCTTCT CGGCGCTCATGATT >D_yakuba_CG34135-PC ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTTTGGG CAGTGCTGCCCTCGTGGGCGCCTTTGGAGTCTGCCAGCGCCAAATCAGCG CCATTCTGATCACAGGAGTGATGTATTTACTAGCAGCTCTATTTGCCCTC TTCACGCTCATGATCATTCACTTCAAGCGGCAGCAGGGACGTCCCATGCT GGACAGCGACTACGATGGAACGGTGGACGGAATAGTGGCGCGACCAGGTG GCGTGGCCATCATGGCCAAGCCGCTGCTGGGAGCGCGCATCTTTCTCACC TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTGTGCGCCATCAC CTCGGTACTGTGGATCCTGCTCTCCAAGATCATGCGGTACAACCCCTTCT CGGCGCTCATGATT >D_erecta_CG34135-PC ATGCAAAACCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG CAGTGCTGCCCTCGTAGGTGCCTTTGGCGTTTGCCAGCGCCAAATCAGTG CCATTCTGATCACAGGAGTGATGTATTTACTAGCAGCTCTCTTTGCCCTG TTCACGCTCATGATCATCCACTTCAAGCGGCAGCAGGGACGTCCCATGCT GGACAGCGACTACGATGGAACGGTGGACGGAATAGTGGCGCGACCAGGAG GCGTGGCCATAATGGCCAAGCCACTGCTGGGAGCGCGCATCTTCCTCACC TCGTGGAGCCTCGACTTGGGATGGGGCGGTGTGGTGCTCTGCGCCATCAC CTCTGTACTGTGGATCCTGCTCTCCAAGATCATGCGGTACAACCCCTTCT CGGCGCTCATGATT >D_takahashii_CG34135-PC ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATTATCCTGGG CAGTGCTGCCCTCGTGGGAGCCTTTGGCGTCTGCCAGCGGCAAATCAGCG CCATTCTGATCACAGGTGTGATGTACTTACTGGCAGCTCTGTTTGCCCTC TTTACGCTGATGATCATCCACTTCAAGCGGCAGCAGGGACGTCCCATGCT GGACAGCGACTACGATGGAACCGTGGACGGGATAGTGGCGCGACCAGGTG GCGTGGCCATCATGGCCAAGCCCCTGCTTGGAGCACGCATCTTCCTCACC TCGTGGAGCCTCGACTTGGGCTGGGGCGGGGTGGTGCTGTGCGCCATCAC CTCGGTGCTGTGGATCCTGCTGTCCAAGATCATGCGCTACAACCCCTTCT CGGCGCTCATGATT >D_biarmipes_CG34135-PC ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATTATCCTGGG CAGTGCTGCTCTCGTGGGAGCCTTTGGCGTGTGCCAGCGCCAAATCAGCG CCATTCTGATCACAGGGGTGATGTATTTACTGGCGGCTCTCTTTGCCCTG TTCACGCTGATGATCATCCACTTCAAGCGGCAGCAGGGACGTCCCATGCT GGACAGCGACTACGATGGCACCGTGGACGGGATAGTTGCGCGACCAGGAG GCGTTGCCATCATGGCCAAGCCGCTGCTGGGCGCGCGCATCTTCCTCACC TCGTGGAGCCTGGACTTGGGCTGGGGCGGGGTGGTGCTTTGCGCCATCAC CTCGGTGCTGTGGATCTTGCTTTCCAAGATCATGCGCTACAACCCCTTCT CGGCGCTCATGATT >D_suzukii_CG34135-PC ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTTATTATCCTGGG CAGTGCTGCTCTGGTGGGAGCTTTTGGCGTCTGCCAGCGCCAAATCAGCG CCATTCTCATCACAGGGGTTATGTATTTACTGGCGGCACTCTTTGCCCTC TTCACTCTGATGATCATCCACTTCAAGCGACAGCAGGGACGCCCTATGCT GGACAGCGACTACGATGGCACCGTGGACGGGATAGTGGCGCGACCAGGAG GCGTAGCCATCATGGCCAAGCCGCTTCTGGGGGCACGCATCTTCCTCACC TCGTGGAGCCTGGACTTGGGCTGGGGCGGGGTGGTGCTGTGTGCCATTAC CTCGGTGCTGTGGATCCTGCTGTCCAAGATCATGCGCTATAACCCCTTCT CGGCGCTCATGATT >D_suzukii_CG34135-PC ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTTATTATCCTGGG CAGTGCTGCTCTGGTGGGAGCTTTTGGCGTCTGCCAGCGCCAAATCAGCG CCATTCTCATCACAGGGGTTATGTATTTACTGGCGGCACTCTTTGCCCTC TTCACTCTGATGATCATCCACTTCAAGCGACAGCAGGGACGCCCTATGCT GGACAGCGACTACGATGGCACCGTGGACGGGATAGTGGCGCGACCAGGAG GCGTAGCCATCATGGCCAAGCCGCTTCTGGGGGCACGCATCTTCCTCACC TCGTGGAGCCTGGACTTGGGCTGGGGCGGGGTGGTGCTGTGTGCCATTAC CTCGGTGCTGTGGATCCTGCTGTCCAAGATCATGCGCTATAACCCCTTCT CGGCGCTCATGATT >D_eugracilis_CG34135-PC ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATTATCTTGGG CAGTGCTGCTCTCGTGGGAGCCTTTGGCGTTTGCCAGCGCCAAATTAGTG CCATTCTGATCACAGGGGTGATGTATCTCCTGGCGGCTCTCTTCGCCCTC TTTACACTGATGATCATCCACTTTAAACGGCAGCAGGGACGTCCAATGCT GGACAGCGACTACGATGGAACTGTGGATGGGATAGTGGCGCGACCGGGAG GCGTGGCTATCATGGCTAAGCCGCTTCTGGGAGCACGCATCTTCCTGACC TCGTGGAGTCTAGACCTGGGCTGGGGCGGGGTGGTGCTTTGCGCCATAAC CTCGGTACTGTGGATTCTGCTCTCCAAGATCATGCGATACAACCCATTCT CAGCGCTCATGATT >D_ficusphila_CG34135-PC ATGCAAAATCTCTCCATATCCTGCTCACTGGTCTGCCTAATCATCCTGGG CAGCGCTGCTCTCGTGGGAGCATTTGGCGTTTGCCAGCGACAAATTAGCG CCATACTCATTACTGGAGTGATGTATTTGCTGGCGGCTCTTTTCGCCCTG TTCACGCTGATGATCATCCATTTCAAGCGGCAGCAGGGGCGTCCCATGCT GGACAGCGACTACGATGGCACCGTGGACGGGATTGTGGCGCGTCCGGGTG GAGTGGCCATCATGGCCAAGCCGCTGCTGGGCGCCCGCATCTTCCTGACC TCGTGGAGCCTGGACTTGGGATGGGGCGGCGTGGTGCTGTGCGCCATCAC CTCGGTGCTGTGGATCCTGCTCTCCAAGATCATGCGCTACAACCCGTTCT CGGCGCTCATGATT >D_rhopaloa_CG34135-PC ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATTATTTTGGG CAGTGCTGCCCTCGTGGGAGCCTTCGGCGTCTGCCAGCGCCAAATCAGCG CCATACTCATCACAGGGGTGATGTATCTACTGGCGGCTCTCTTTGCCCTA TTCACTCTGATGATCATCCATTTCAAGCGGCAGCAGGGACGTCCAATGCT GGACAGCGACTATGATGGAACCGTGGATGGGATTGTGGCGCGACCAGGAG GTGTGGCCATCATGGCTAAGCCGCTACTGGGGGCACGCATCTTCCTGACC TCGTGGAGCCTTGATCTGGGTTGGGGCGGGGTGGTACTGTGCGCCATCAC CTCAGTTCTGTGGATCCTGCTCTCCAAGATCATGCGGTATAACCCGTTCT CGGCGCTCATGATT >D_elegans_CG34135-PC ATGCAAAATCTCTCCATATCCTGCTCATTGGTCTGCCTCATCATTCTGGG CAGTGCTGCTCTTGTGGGAGCCTTTGGCGTTTGCCAGCGCCAAATCAGCG CCATACTGATCACAGGGGTGATGTATCTACTGGCGGCTCTTTTCGCCCTC TTCACGCTGATGATCATCCACTTCAAGCGGCAGCAGGGACGTCCAATGCT GGACAGTGACTACGATGGAACCGTGGATGGAATTGTGGCGCGACCAGGAG GAGTGGCCATCATGGCCAAGCCGCTACTGGGGGCACGCATCTTCCTGACC TCTTGGAGCCTTGATCTGGGATGGGGCGGAGTGGTGCTGTGCGCCATCAC TTCCGTTCTGTGGATCCTGCTCTCCAAGATCATGCGGTACAACCCCTTCT CGGCGCTCATGATT
>D_melanogaster_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI >D_sechellia_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI >D_simulans_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI >D_yakuba_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI >D_erecta_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI >D_takahashii_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI >D_biarmipes_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI >D_suzukii_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI >D_suzukii_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI >D_eugracilis_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI >D_ficusphila_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI >D_rhopaloa_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI >D_elegans_CG34135-PC MQNLSISCSLVCLIILGSAALVGAFGVCQRQISAILITGVMYLLAALFAL FTLMIIHFKRQQGRPMLDSDYDGTVDGIVARPGGVAIMAKPLLGARIFLT SWSLDLGWGGVVLCAITSVLWILLSKIMRYNPFSALMI
#NEXUS
[ID: 9398523135]
begin taxa;
dimensions ntax=13;
taxlabels
D_melanogaster_CG34135-PC
D_sechellia_CG34135-PC
D_simulans_CG34135-PC
D_yakuba_CG34135-PC
D_erecta_CG34135-PC
D_takahashii_CG34135-PC
D_biarmipes_CG34135-PC
D_suzukii_CG34135-PC
D_suzukii_CG34135-PC
D_eugracilis_CG34135-PC
D_ficusphila_CG34135-PC
D_rhopaloa_CG34135-PC
D_elegans_CG34135-PC
;
end;
begin trees;
translate
1 D_melanogaster_CG34135-PC,
2 D_sechellia_CG34135-PC,
3 D_simulans_CG34135-PC,
4 D_yakuba_CG34135-PC,
5 D_erecta_CG34135-PC,
6 D_takahashii_CG34135-PC,
7 D_biarmipes_CG34135-PC,
8 D_suzukii_CG34135-PC,
9 D_suzukii_CG34135-PC,
10 D_eugracilis_CG34135-PC,
11 D_ficusphila_CG34135-PC,
12 D_rhopaloa_CG34135-PC,
13 D_elegans_CG34135-PC
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02131181,2:0.009827919,3:0.009692994,((4:0.03860446,(6:0.08063157,(7:0.0559897,(8:0.004042918,9:0.004012631)1.000:0.1337517,11:0.2812078)0.733:0.02722575,(10:0.1777101,(12:0.1032333,13:0.09299523)0.975:0.07023378)0.990:0.0770045)1.000:0.1216689)0.769:0.02105097,5:0.05503625)1.000:0.06614063);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02131181,2:0.009827919,3:0.009692994,((4:0.03860446,(6:0.08063157,(7:0.0559897,(8:0.004042918,9:0.004012631):0.1337517,11:0.2812078):0.02722575,(10:0.1777101,(12:0.1032333,13:0.09299523):0.07023378):0.0770045):0.1216689):0.02105097,5:0.05503625):0.06614063);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1397.97 -1416.91
2 -1397.73 -1415.30
--------------------------------------
TOTAL -1397.84 -1416.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/128/CG34135-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.576089 0.040436 1.181268 1.948034 1.559422 1152.11 1276.67 1.000
r(A<->C){all} 0.098913 0.001038 0.039216 0.162479 0.096602 737.94 823.77 1.000
r(A<->G){all} 0.221962 0.002158 0.133351 0.314957 0.219489 574.55 667.95 1.000
r(A<->T){all} 0.171376 0.002830 0.068286 0.269458 0.169705 554.55 569.91 1.000
r(C<->G){all} 0.051327 0.000308 0.020564 0.087596 0.049935 876.27 1066.24 1.000
r(C<->T){all} 0.360973 0.002830 0.260173 0.464100 0.360128 679.42 752.86 1.000
r(G<->T){all} 0.095450 0.000855 0.038454 0.152650 0.092364 910.66 971.12 1.000
pi(A){all} 0.173138 0.000282 0.141803 0.206391 0.172728 1294.15 1305.32 1.001
pi(C){all} 0.314535 0.000428 0.273723 0.354166 0.314167 1154.10 1223.84 1.000
pi(G){all} 0.278350 0.000424 0.240417 0.321302 0.277967 1193.27 1334.14 1.000
pi(T){all} 0.233977 0.000363 0.197657 0.272579 0.233701 1007.43 1022.75 1.000
alpha{1,2} 0.074869 0.000116 0.054041 0.095729 0.074391 1404.65 1452.82 1.000
alpha{3} 2.588000 0.626118 1.257271 4.189710 2.460149 1184.46 1280.65 1.000
pinvar{all} 0.384506 0.002871 0.281405 0.488287 0.385063 1309.37 1376.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/128/CG34135-PC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 13 ls = 138
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 3 2 3 | Ser TCT 0 0 0 0 1 0 | Tyr TAT 1 1 1 1 1 0 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 3 4 3 | TCC 3 3 3 3 3 3 | TAC 2 2 2 2 2 3 | TGC 4 4 4 4 4 4
Leu TTA 2 2 2 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 3 2 2 | TCG 3 3 3 3 2 3 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 2 1 0 0 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 10 10 9 9 10 7 | CCC 2 2 2 2 2 3 | CAC 1 1 1 1 1 1 | CGC 2 2 2 2 2 2
CTA 0 0 0 2 1 0 | CCA 1 1 1 1 2 1 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 7 6 8 7 8 11 | CCG 1 1 1 1 0 0 | CAG 3 3 3 3 3 3 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 3 3 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 1 | Ser AGT 1 1 1 1 2 1
ATC 8 8 8 9 9 10 | ACC 2 2 2 2 2 3 | AAC 2 2 2 2 2 1 | AGC 3 3 3 3 2 3
ATA 3 3 3 2 3 2 | ACA 1 1 1 1 1 1 | Lys AAA 1 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 7 7 7 7 7 7 | ACG 2 2 2 2 2 1 | AAG 2 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 1 0 | Ala GCT 0 0 0 2 2 2 | Asp GAT 2 1 1 1 1 1 | Gly GGT 2 2 2 2 2 2
GTC 2 2 2 2 1 2 | GCC 8 8 8 7 7 7 | GAC 3 4 4 4 4 4 | GGC 5 5 5 4 4 5
GTA 1 1 1 1 2 0 | GCA 1 0 0 1 1 2 | Glu GAA 0 0 0 0 0 0 | GGA 6 6 6 7 7 4
GTG 7 7 7 7 6 8 | GCG 4 5 5 3 3 2 | GAG 0 0 0 0 0 0 | GGG 0 0 0 0 0 2
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 3 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 2 2 1 1 3 | Cys TGT 0 1 1 0 0 0
TTC 4 4 4 3 5 5 | TCC 3 3 3 3 3 3 | TAC 2 1 1 2 2 0 | TGC 4 3 3 4 4 4
Leu TTA 1 1 1 0 0 0 | TCA 1 1 1 2 1 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 2 2 2 2 2 | TCG 3 3 3 2 3 2 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 1 1 | Pro CCT 0 1 1 0 0 0 | His CAT 0 0 0 0 1 1 | Arg CGT 1 0 0 1 2 1
CTC 6 6 6 8 5 7 | CCC 2 1 1 0 1 0 | CAC 1 1 1 1 0 0 | CGC 3 4 4 2 2 2
CTA 0 0 0 1 1 3 | CCA 1 1 1 2 0 2 | Gln CAA 2 2 2 2 2 2 | CGA 1 2 2 2 1 1
CTG 10 11 11 9 13 9 | CCG 1 1 1 2 3 2 | CAG 3 3 3 3 3 3 | CGG 1 0 0 1 1 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 4 4 5 4 4 | Thr ACT 0 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 3 0 1
ATC 10 9 9 7 9 9 | ACC 3 3 3 2 3 3 | AAC 1 1 1 1 1 1 | AGC 3 3 3 1 4 3
ATA 2 2 2 3 2 2 | ACA 1 1 1 2 0 1 | Lys AAA 0 0 0 1 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 7 7 7 7 7 7 | ACG 1 0 0 0 1 0 | AAG 3 3 3 2 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 1 1 1 1 1 | Ala GCT 3 3 3 5 3 3 | Asp GAT 1 1 1 2 1 3 | Gly GGT 0 0 0 0 1 2
GTC 1 2 2 1 1 2 | GCC 6 5 5 4 6 6 | GAC 4 4 4 3 4 2 | GGC 7 6 6 5 6 3
GTA 0 1 1 1 0 1 | GCA 0 2 2 1 1 1 | Glu GAA 0 0 0 0 0 0 | GGA 3 3 3 5 4 4
GTG 7 6 6 7 8 6 | GCG 4 3 3 3 3 3 | GAG 0 0 0 0 0 0 | GGG 3 4 4 3 2 4
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------
Phe TTT 1 | Ser TCT 1 | Tyr TAT 1 | Cys TGT 0
TTC 5 | TCC 4 | TAC 2 | TGC 4
Leu TTA 0 | TCA 1 | *** TAA 0 | *** TGA 0
TTG 1 | TCG 1 | TAG 0 | Trp TGG 3
------------------------------------------------------
Leu CTT 3 | Pro CCT 0 | His CAT 0 | Arg CGT 1
CTC 5 | CCC 1 | CAC 1 | CGC 2
CTA 2 | CCA 2 | Gln CAA 2 | CGA 1
CTG 11 | CCG 1 | CAG 3 | CGG 2
------------------------------------------------------
Ile ATT 3 | Thr ACT 1 | Asn AAT 1 | Ser AGT 2
ATC 10 | ACC 2 | AAC 1 | AGC 2
ATA 2 | ACA 1 | Lys AAA 0 | Arg AGA 0
Met ATG 7 | ACG 1 | AAG 3 | AGG 0
------------------------------------------------------
Val GTT 2 | Ala GCT 3 | Asp GAT 3 | Gly GGT 0
GTC 1 | GCC 6 | GAC 2 | GGC 3
GTA 0 | GCA 1 | Glu GAA 0 | GGA 8
GTG 7 | GCG 3 | GAG 0 | GGG 2
------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG34135-PC
position 1: T:0.19565 C:0.24638 A:0.26087 G:0.29710
position 2: T:0.43478 C:0.21014 A:0.13768 G:0.21739
position 3: T:0.10145 C:0.44203 A:0.14493 G:0.31159
Average T:0.24396 C:0.29952 A:0.18116 G:0.27536
#2: D_sechellia_CG34135-PC
position 1: T:0.19565 C:0.24638 A:0.26087 G:0.29710
position 2: T:0.43478 C:0.21014 A:0.13768 G:0.21739
position 3: T:0.10145 C:0.44928 A:0.13043 G:0.31884
Average T:0.24396 C:0.30193 A:0.17633 G:0.27778
#3: D_simulans_CG34135-PC
position 1: T:0.19565 C:0.24638 A:0.26087 G:0.29710
position 2: T:0.43478 C:0.21014 A:0.13768 G:0.21739
position 3: T:0.09420 C:0.44203 A:0.13043 G:0.33333
Average T:0.24155 C:0.29952 A:0.17633 G:0.28261
#4: D_yakuba_CG34135-PC
position 1: T:0.19565 C:0.24638 A:0.26087 G:0.29710
position 2: T:0.43478 C:0.21014 A:0.13768 G:0.21739
position 3: T:0.10870 C:0.42754 A:0.14493 G:0.31884
Average T:0.24638 C:0.29469 A:0.18116 G:0.27778
#5: D_erecta_CG34135-PC
position 1: T:0.18841 C:0.25362 A:0.26087 G:0.29710
position 2: T:0.43478 C:0.21014 A:0.13768 G:0.21739
position 3: T:0.11594 C:0.42754 A:0.15942 G:0.29710
Average T:0.24638 C:0.29710 A:0.18599 G:0.27053
#6: D_takahashii_CG34135-PC
position 1: T:0.18841 C:0.25362 A:0.26087 G:0.29710
position 2: T:0.43478 C:0.21014 A:0.13768 G:0.21739
position 3: T:0.10870 C:0.44203 A:0.10870 G:0.34058
Average T:0.24396 C:0.30193 A:0.16908 G:0.28502
#7: D_biarmipes_CG34135-PC
position 1: T:0.19565 C:0.24638 A:0.26087 G:0.29710
position 2: T:0.43478 C:0.21014 A:0.13768 G:0.21739
position 3: T:0.12319 C:0.43478 A:0.08696 G:0.35507
Average T:0.25121 C:0.29710 A:0.16184 G:0.28986
#8: D_suzukii_CG34135-PC
position 1: T:0.18841 C:0.25362 A:0.26087 G:0.29710
position 2: T:0.43478 C:0.21014 A:0.13768 G:0.21739
position 3: T:0.14493 C:0.40580 A:0.11594 G:0.33333
Average T:0.25604 C:0.28986 A:0.17150 G:0.28261
#9: D_suzukii_CG34135-PC
position 1: T:0.18841 C:0.25362 A:0.26087 G:0.29710
position 2: T:0.43478 C:0.21014 A:0.13768 G:0.21739
position 3: T:0.14493 C:0.40580 A:0.11594 G:0.33333
Average T:0.25604 C:0.28986 A:0.17150 G:0.28261
#10: D_eugracilis_CG34135-PC
position 1: T:0.18116 C:0.26087 A:0.26087 G:0.29710
position 2: T:0.43478 C:0.21014 A:0.13768 G:0.21739
position 3: T:0.18116 C:0.34058 A:0.15942 G:0.31884
Average T:0.26570 C:0.27053 A:0.18599 G:0.27778
#11: D_ficusphila_CG34135-PC
position 1: T:0.18116 C:0.26087 A:0.26087 G:0.29710
position 2: T:0.43478 C:0.21014 A:0.13768 G:0.21739
position 3: T:0.13043 C:0.40580 A:0.08696 G:0.37681
Average T:0.24879 C:0.29227 A:0.16184 G:0.29710
#12: D_rhopaloa_CG34135-PC
position 1: T:0.18116 C:0.26087 A:0.26087 G:0.29710
position 2: T:0.43478 C:0.21014 A:0.13768 G:0.21739
position 3: T:0.16667 C:0.36232 A:0.13768 G:0.33333
Average T:0.26087 C:0.27778 A:0.17874 G:0.28261
#13: D_elegans_CG34135-PC
position 1: T:0.17391 C:0.26812 A:0.26087 G:0.29710
position 2: T:0.43478 C:0.21014 A:0.13768 G:0.21739
position 3: T:0.15942 C:0.36957 A:0.14493 G:0.32609
Average T:0.25604 C:0.28261 A:0.18116 G:0.28019
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 26 | Ser S TCT 2 | Tyr Y TAT 16 | Cys C TGT 2
TTC 52 | TCC 40 | TAC 23 | TGC 50
Leu L TTA 12 | TCA 15 | *** * TAA 0 | *** * TGA 0
TTG 27 | TCG 34 | TAG 0 | Trp W TGG 39
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 2 | His H CAT 2 | Arg R CGT 12
CTC 98 | CCC 19 | CAC 11 | CGC 31
CTA 10 | CCA 16 | Gln Q CAA 26 | CGA 16
CTG 121 | CCG 15 | CAG 39 | CGG 19
------------------------------------------------------------------------------
Ile I ATT 49 | Thr T ACT 6 | Asn N AAT 8 | Ser S AGT 16
ATC 115 | ACC 32 | AAC 18 | AGC 36
ATA 31 | ACA 13 | Lys K AAA 2 | Arg R AGA 0
Met M ATG 91 | ACG 14 | AAG 37 | AGG 0
------------------------------------------------------------------------------
Val V GTT 10 | Ala A GCT 29 | Asp D GAT 19 | Gly G GGT 15
GTC 21 | GCC 83 | GAC 46 | GGC 64
GTA 10 | GCA 13 | Glu E GAA 0 | GGA 66
GTG 89 | GCG 44 | GAG 0 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18841 C:0.25362 A:0.26087 G:0.29710
position 2: T:0.43478 C:0.21014 A:0.13768 G:0.21739
position 3: T:0.12932 C:0.41193 A:0.12821 G:0.33055
Average T:0.25084 C:0.29190 A:0.17559 G:0.28168
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG34135-PC
D_sechellia_CG34135-PC -1.0000 (0.0000 0.0386)
D_simulans_CG34135-PC -1.0000 (0.0000 0.0384)-1.0000 (0.0000 0.0190)
D_yakuba_CG34135-PC -1.0000 (0.0000 0.2027)-1.0000 (0.0000 0.1790)-1.0000 (0.0000 0.1666)
D_erecta_CG34135-PC -1.0000 (0.0000 0.2149)-1.0000 (0.0000 0.1908)-1.0000 (0.0000 0.1901)-1.0000 (0.0000 0.1546)
D_takahashii_CG34135-PC -1.0000 (0.0000 0.3959)-1.0000 (0.0000 0.3967)-1.0000 (0.0000 0.3642)-1.0000 (0.0000 0.2780)-1.0000 (0.0000 0.3335)
D_biarmipes_CG34135-PC -1.0000 (0.0000 0.3984) 0.0092 (0.0033 0.3528)-1.0000 (0.0000 0.3664)-1.0000 (0.0000 0.3657)-1.0000 (0.0000 0.3355)-1.0000 (0.0000 0.2264)
D_suzukii_CG34135-PC 0.0068 (0.0033 0.4804) 0.0068 (0.0033 0.4815) 0.0068 (0.0033 0.4793)-1.0000 (0.0000 0.5330)-1.0000 (0.0000 0.5713)-1.0000 (0.0000 0.3189)-1.0000 (0.0000 0.2525)
D_suzukii_CG34135-PC 0.0068 (0.0033 0.4804) 0.0068 (0.0033 0.4815) 0.0068 (0.0033 0.4793)-1.0000 (0.0000 0.5330)-1.0000 (0.0000 0.5713)-1.0000 (0.0000 0.3189)-1.0000 (0.0000 0.2525)-1.0000 (0.0000 0.0000)
D_eugracilis_CG34135-PC 0.0051 (0.0033 0.6355) 0.0048 (0.0033 0.6820) 0.0048 (0.0033 0.6785) 0.0055 (0.0033 0.5903) 0.0057 (0.0033 0.5695) 0.0072 (0.0033 0.4576) 0.0077 (0.0033 0.4270) 0.0062 (0.0033 0.5303) 0.0062 (0.0033 0.5303)
D_ficusphila_CG34135-PC 0.0052 (0.0033 0.6319) 0.0053 (0.0033 0.6122) 0.0056 (0.0033 0.5886)-1.0000 (0.0000 0.5672)-1.0000 (0.0000 0.5865)-1.0000 (0.0000 0.4725)-1.0000 (0.0000 0.3930)-1.0000 (0.0000 0.5465)-1.0000 (0.0000 0.5465) 0.0051 (0.0033 0.6469)
D_rhopaloa_CG34135-PC 0.0059 (0.0033 0.5513) 0.0055 (0.0033 0.5925) 0.0056 (0.0033 0.5896)-1.0000 (0.0000 0.5297)-1.0000 (0.0000 0.5675)-1.0000 (0.0000 0.4733)-1.0000 (0.0000 0.4591)-1.0000 (0.0000 0.4571)-1.0000 (0.0000 0.4571)-1.0000 (0.0000 0.4730)-1.0000 (0.0000 0.5820)
D_elegans_CG34135-PC -1.0000 (0.0000 0.4412)-1.0000 (0.0000 0.4764)-1.0000 (0.0000 0.4571)-1.0000 (0.0000 0.4393)-1.0000 (0.0000 0.4389)-1.0000 (0.0000 0.4541)-1.0000 (0.0000 0.4238)-1.0000 (0.0000 0.5077)-1.0000 (0.0000 0.5077)-1.0000 (0.0000 0.4709)-1.0000 (0.0000 0.4687)-1.0000 (0.0000 0.2740)
Model 0: one-ratio
TREE # 1: (1, 2, 3, ((4, (6, (7, (8, 9), 11), (10, (12, 13)))), 5)); MP score: 179
lnL(ntime: 20 np: 22): -1271.539490 +0.000000
14..1 14..2 14..3 14..15 15..16 16..4 16..17 17..6 17..18 18..7 18..19 19..8 19..9 18..11 17..20 20..10 20..21 21..12 21..13 15..5
0.024199 0.008079 0.007991 0.080842 0.013196 0.048251 0.158443 0.100890 0.033670 0.070009 0.159807 0.000004 0.000004 0.323407 0.082069 0.206074 0.084954 0.120756 0.105801 0.066820 2.514544 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.69526
(1: 0.024199, 2: 0.008079, 3: 0.007991, ((4: 0.048251, (6: 0.100890, (7: 0.070009, (8: 0.000004, 9: 0.000004): 0.159807, 11: 0.323407): 0.033670, (10: 0.206074, (12: 0.120756, 13: 0.105801): 0.084954): 0.082069): 0.158443): 0.013196, 5: 0.066820): 0.080842);
(D_melanogaster_CG34135-PC: 0.024199, D_sechellia_CG34135-PC: 0.008079, D_simulans_CG34135-PC: 0.007991, ((D_yakuba_CG34135-PC: 0.048251, (D_takahashii_CG34135-PC: 0.100890, (D_biarmipes_CG34135-PC: 0.070009, (D_suzukii_CG34135-PC: 0.000004, D_suzukii_CG34135-PC: 0.000004): 0.159807, D_ficusphila_CG34135-PC: 0.323407): 0.033670, (D_eugracilis_CG34135-PC: 0.206074, (D_rhopaloa_CG34135-PC: 0.120756, D_elegans_CG34135-PC: 0.105801): 0.084954): 0.082069): 0.158443): 0.013196, D_erecta_CG34135-PC: 0.066820): 0.080842);
Detailed output identifying parameters
kappa (ts/tv) = 2.51454
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
14..1 0.024 310.3 103.7 0.0001 0.0000 0.0322 0.0 3.3
14..2 0.008 310.3 103.7 0.0001 0.0000 0.0107 0.0 1.1
14..3 0.008 310.3 103.7 0.0001 0.0000 0.0106 0.0 1.1
14..15 0.081 310.3 103.7 0.0001 0.0000 0.1075 0.0 11.2
15..16 0.013 310.3 103.7 0.0001 0.0000 0.0175 0.0 1.8
16..4 0.048 310.3 103.7 0.0001 0.0000 0.0642 0.0 6.7
16..17 0.158 310.3 103.7 0.0001 0.0000 0.2107 0.0 21.9
17..6 0.101 310.3 103.7 0.0001 0.0000 0.1342 0.0 13.9
17..18 0.034 310.3 103.7 0.0001 0.0000 0.0448 0.0 4.6
18..7 0.070 310.3 103.7 0.0001 0.0000 0.0931 0.0 9.7
18..19 0.160 310.3 103.7 0.0001 0.0000 0.2125 0.0 22.0
19..8 0.000 310.3 103.7 0.0001 0.0000 0.0000 0.0 0.0
19..9 0.000 310.3 103.7 0.0001 0.0000 0.0000 0.0 0.0
18..11 0.323 310.3 103.7 0.0001 0.0000 0.4301 0.0 44.6
17..20 0.082 310.3 103.7 0.0001 0.0000 0.1091 0.0 11.3
20..10 0.206 310.3 103.7 0.0001 0.0000 0.2741 0.0 28.4
20..21 0.085 310.3 103.7 0.0001 0.0000 0.1130 0.0 11.7
21..12 0.121 310.3 103.7 0.0001 0.0000 0.1606 0.0 16.7
21..13 0.106 310.3 103.7 0.0001 0.0000 0.1407 0.0 14.6
15..5 0.067 310.3 103.7 0.0001 0.0000 0.0889 0.0 9.2
tree length for dN: 0.0002
tree length for dS: 2.2545
Time used: 0:11
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, ((4, (6, (7, (8, 9), 11), (10, (12, 13)))), 5)); MP score: 179
lnL(ntime: 20 np: 23): -1271.471055 +0.000000
14..1 14..2 14..3 14..15 15..16 16..4 16..17 17..6 17..18 18..7 18..19 19..8 19..9 18..11 17..20 20..10 20..21 21..12 21..13 15..5
0.024201 0.008080 0.007991 0.080853 0.013195 0.048257 0.158479 0.100904 0.033672 0.070019 0.159835 0.000004 0.000004 0.323539 0.082080 0.206114 0.084972 0.120771 0.105812 0.066828 2.514421 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.69561
(1: 0.024201, 2: 0.008080, 3: 0.007991, ((4: 0.048257, (6: 0.100904, (7: 0.070019, (8: 0.000004, 9: 0.000004): 0.159835, 11: 0.323539): 0.033672, (10: 0.206114, (12: 0.120771, 13: 0.105812): 0.084972): 0.082080): 0.158479): 0.013195, 5: 0.066828): 0.080853);
(D_melanogaster_CG34135-PC: 0.024201, D_sechellia_CG34135-PC: 0.008080, D_simulans_CG34135-PC: 0.007991, ((D_yakuba_CG34135-PC: 0.048257, (D_takahashii_CG34135-PC: 0.100904, (D_biarmipes_CG34135-PC: 0.070019, (D_suzukii_CG34135-PC: 0.000004, D_suzukii_CG34135-PC: 0.000004): 0.159835, D_ficusphila_CG34135-PC: 0.323539): 0.033672, (D_eugracilis_CG34135-PC: 0.206114, (D_rhopaloa_CG34135-PC: 0.120771, D_elegans_CG34135-PC: 0.105812): 0.084972): 0.082080): 0.158479): 0.013195, D_erecta_CG34135-PC: 0.066828): 0.080853);
Detailed output identifying parameters
kappa (ts/tv) = 2.51442
dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
14..1 0.024 310.3 103.7 0.0000 0.0000 0.0322 0.0 3.3
14..2 0.008 310.3 103.7 0.0000 0.0000 0.0107 0.0 1.1
14..3 0.008 310.3 103.7 0.0000 0.0000 0.0106 0.0 1.1
14..15 0.081 310.3 103.7 0.0000 0.0000 0.1076 0.0 11.2
15..16 0.013 310.3 103.7 0.0000 0.0000 0.0176 0.0 1.8
16..4 0.048 310.3 103.7 0.0000 0.0000 0.0642 0.0 6.7
16..17 0.158 310.3 103.7 0.0000 0.0000 0.2108 0.0 21.9
17..6 0.101 310.3 103.7 0.0000 0.0000 0.1342 0.0 13.9
17..18 0.034 310.3 103.7 0.0000 0.0000 0.0448 0.0 4.6
18..7 0.070 310.3 103.7 0.0000 0.0000 0.0931 0.0 9.7
18..19 0.160 310.3 103.7 0.0000 0.0000 0.2126 0.0 22.1
19..8 0.000 310.3 103.7 0.0000 0.0000 0.0000 0.0 0.0
19..9 0.000 310.3 103.7 0.0000 0.0000 0.0000 0.0 0.0
18..11 0.324 310.3 103.7 0.0000 0.0000 0.4304 0.0 44.6
17..20 0.082 310.3 103.7 0.0000 0.0000 0.1092 0.0 11.3
20..10 0.206 310.3 103.7 0.0000 0.0000 0.2742 0.0 28.4
20..21 0.085 310.3 103.7 0.0000 0.0000 0.1130 0.0 11.7
21..12 0.121 310.3 103.7 0.0000 0.0000 0.1607 0.0 16.7
21..13 0.106 310.3 103.7 0.0000 0.0000 0.1408 0.0 14.6
15..5 0.067 310.3 103.7 0.0000 0.0000 0.0889 0.0 9.2
Time used: 0:32
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, ((4, (6, (7, (8, 9), 11), (10, (12, 13)))), 5)); MP score: 179
lnL(ntime: 20 np: 25): -1271.469716 +0.000000
14..1 14..2 14..3 14..15 15..16 16..4 16..17 17..6 17..18 18..7 18..19 19..8 19..9 18..11 17..20 20..10 20..21 21..12 21..13 15..5
0.024200 0.008079 0.007991 0.080850 0.013194 0.048256 0.158474 0.100901 0.033671 0.070017 0.159830 0.000004 0.000004 0.323530 0.082077 0.206108 0.084969 0.120768 0.105809 0.066826 2.514421 1.000000 0.000000 0.000001 269.971355
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.69556
(1: 0.024200, 2: 0.008079, 3: 0.007991, ((4: 0.048256, (6: 0.100901, (7: 0.070017, (8: 0.000004, 9: 0.000004): 0.159830, 11: 0.323530): 0.033671, (10: 0.206108, (12: 0.120768, 13: 0.105809): 0.084969): 0.082077): 0.158474): 0.013194, 5: 0.066826): 0.080850);
(D_melanogaster_CG34135-PC: 0.024200, D_sechellia_CG34135-PC: 0.008079, D_simulans_CG34135-PC: 0.007991, ((D_yakuba_CG34135-PC: 0.048256, (D_takahashii_CG34135-PC: 0.100901, (D_biarmipes_CG34135-PC: 0.070017, (D_suzukii_CG34135-PC: 0.000004, D_suzukii_CG34135-PC: 0.000004): 0.159830, D_ficusphila_CG34135-PC: 0.323530): 0.033671, (D_eugracilis_CG34135-PC: 0.206108, (D_rhopaloa_CG34135-PC: 0.120768, D_elegans_CG34135-PC: 0.105809): 0.084969): 0.082077): 0.158474): 0.013194, D_erecta_CG34135-PC: 0.066826): 0.080850);
Detailed output identifying parameters
kappa (ts/tv) = 2.51442
dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 269.97135
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
14..1 0.024 310.3 103.7 0.0000 0.0000 0.0322 0.0 3.3
14..2 0.008 310.3 103.7 0.0000 0.0000 0.0107 0.0 1.1
14..3 0.008 310.3 103.7 0.0000 0.0000 0.0106 0.0 1.1
14..15 0.081 310.3 103.7 0.0000 0.0000 0.1076 0.0 11.2
15..16 0.013 310.3 103.7 0.0000 0.0000 0.0176 0.0 1.8
16..4 0.048 310.3 103.7 0.0000 0.0000 0.0642 0.0 6.7
16..17 0.158 310.3 103.7 0.0000 0.0000 0.2108 0.0 21.9
17..6 0.101 310.3 103.7 0.0000 0.0000 0.1342 0.0 13.9
17..18 0.034 310.3 103.7 0.0000 0.0000 0.0448 0.0 4.6
18..7 0.070 310.3 103.7 0.0000 0.0000 0.0931 0.0 9.7
18..19 0.160 310.3 103.7 0.0000 0.0000 0.2126 0.0 22.1
19..8 0.000 310.3 103.7 0.0000 0.0000 0.0000 0.0 0.0
19..9 0.000 310.3 103.7 0.0000 0.0000 0.0000 0.0 0.0
18..11 0.324 310.3 103.7 0.0000 0.0000 0.4304 0.0 44.6
17..20 0.082 310.3 103.7 0.0000 0.0000 0.1092 0.0 11.3
20..10 0.206 310.3 103.7 0.0000 0.0000 0.2742 0.0 28.4
20..21 0.085 310.3 103.7 0.0000 0.0000 0.1130 0.0 11.7
21..12 0.121 310.3 103.7 0.0000 0.0000 0.1607 0.0 16.7
21..13 0.106 310.3 103.7 0.0000 0.0000 0.1408 0.0 14.6
15..5 0.067 310.3 103.7 0.0000 0.0000 0.0889 0.0 9.2
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG34135-PC)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.105 0.100 0.100 0.099 0.099 0.099 0.099 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 1:28
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, ((4, (6, (7, (8, 9), 11), (10, (12, 13)))), 5)); MP score: 179
lnL(ntime: 20 np: 26): -1271.469716 +0.000000
14..1 14..2 14..3 14..15 15..16 16..4 16..17 17..6 17..18 18..7 18..19 19..8 19..9 18..11 17..20 20..10 20..21 21..12 21..13 15..5
0.024201 0.008079 0.007991 0.080850 0.013194 0.048256 0.158475 0.100901 0.033671 0.070017 0.159830 0.000004 0.000004 0.323530 0.082077 0.206108 0.084969 0.120768 0.105809 0.066826 2.514420 0.467312 0.258933 0.000001 0.000001 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.69556
(1: 0.024201, 2: 0.008079, 3: 0.007991, ((4: 0.048256, (6: 0.100901, (7: 0.070017, (8: 0.000004, 9: 0.000004): 0.159830, 11: 0.323530): 0.033671, (10: 0.206108, (12: 0.120768, 13: 0.105809): 0.084969): 0.082077): 0.158475): 0.013194, 5: 0.066826): 0.080850);
(D_melanogaster_CG34135-PC: 0.024201, D_sechellia_CG34135-PC: 0.008079, D_simulans_CG34135-PC: 0.007991, ((D_yakuba_CG34135-PC: 0.048256, (D_takahashii_CG34135-PC: 0.100901, (D_biarmipes_CG34135-PC: 0.070017, (D_suzukii_CG34135-PC: 0.000004, D_suzukii_CG34135-PC: 0.000004): 0.159830, D_ficusphila_CG34135-PC: 0.323530): 0.033671, (D_eugracilis_CG34135-PC: 0.206108, (D_rhopaloa_CG34135-PC: 0.120768, D_elegans_CG34135-PC: 0.105809): 0.084969): 0.082077): 0.158475): 0.013194, D_erecta_CG34135-PC: 0.066826): 0.080850);
Detailed output identifying parameters
kappa (ts/tv) = 2.51442
dN/dS (w) for site classes (K=3)
p: 0.46731 0.25893 0.27376
w: 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
14..1 0.024 310.3 103.7 0.0000 0.0000 0.0322 0.0 3.3
14..2 0.008 310.3 103.7 0.0000 0.0000 0.0107 0.0 1.1
14..3 0.008 310.3 103.7 0.0000 0.0000 0.0106 0.0 1.1
14..15 0.081 310.3 103.7 0.0000 0.0000 0.1076 0.0 11.2
15..16 0.013 310.3 103.7 0.0000 0.0000 0.0176 0.0 1.8
16..4 0.048 310.3 103.7 0.0000 0.0000 0.0642 0.0 6.7
16..17 0.158 310.3 103.7 0.0000 0.0000 0.2108 0.0 21.9
17..6 0.101 310.3 103.7 0.0000 0.0000 0.1342 0.0 13.9
17..18 0.034 310.3 103.7 0.0000 0.0000 0.0448 0.0 4.6
18..7 0.070 310.3 103.7 0.0000 0.0000 0.0931 0.0 9.7
18..19 0.160 310.3 103.7 0.0000 0.0000 0.2126 0.0 22.1
19..8 0.000 310.3 103.7 0.0000 0.0000 0.0000 0.0 0.0
19..9 0.000 310.3 103.7 0.0000 0.0000 0.0000 0.0 0.0
18..11 0.324 310.3 103.7 0.0000 0.0000 0.4304 0.0 44.6
17..20 0.082 310.3 103.7 0.0000 0.0000 0.1092 0.0 11.3
20..10 0.206 310.3 103.7 0.0000 0.0000 0.2742 0.0 28.4
20..21 0.085 310.3 103.7 0.0000 0.0000 0.1130 0.0 11.7
21..12 0.121 310.3 103.7 0.0000 0.0000 0.1607 0.0 16.7
21..13 0.106 310.3 103.7 0.0000 0.0000 0.1408 0.0 14.6
15..5 0.067 310.3 103.7 0.0000 0.0000 0.0889 0.0 9.2
Naive Empirical Bayes (NEB) analysis
Time used: 1:51
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, ((4, (6, (7, (8, 9), 11), (10, (12, 13)))), 5)); MP score: 179
lnL(ntime: 20 np: 23): -1271.469025 +0.000000
14..1 14..2 14..3 14..15 15..16 16..4 16..17 17..6 17..18 18..7 18..19 19..8 19..9 18..11 17..20 20..10 20..21 21..12 21..13 15..5
0.024200 0.008079 0.007991 0.080850 0.013194 0.048256 0.158475 0.100901 0.033671 0.070017 0.159830 0.000004 0.000004 0.323531 0.082077 0.206109 0.084969 0.120768 0.105809 0.066826 2.514418 0.005000 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.69556
(1: 0.024200, 2: 0.008079, 3: 0.007991, ((4: 0.048256, (6: 0.100901, (7: 0.070017, (8: 0.000004, 9: 0.000004): 0.159830, 11: 0.323531): 0.033671, (10: 0.206109, (12: 0.120768, 13: 0.105809): 0.084969): 0.082077): 0.158475): 0.013194, 5: 0.066826): 0.080850);
(D_melanogaster_CG34135-PC: 0.024200, D_sechellia_CG34135-PC: 0.008079, D_simulans_CG34135-PC: 0.007991, ((D_yakuba_CG34135-PC: 0.048256, (D_takahashii_CG34135-PC: 0.100901, (D_biarmipes_CG34135-PC: 0.070017, (D_suzukii_CG34135-PC: 0.000004, D_suzukii_CG34135-PC: 0.000004): 0.159830, D_ficusphila_CG34135-PC: 0.323531): 0.033671, (D_eugracilis_CG34135-PC: 0.206109, (D_rhopaloa_CG34135-PC: 0.120768, D_elegans_CG34135-PC: 0.105809): 0.084969): 0.082077): 0.158475): 0.013194, D_erecta_CG34135-PC: 0.066826): 0.080850);
Detailed output identifying parameters
kappa (ts/tv) = 2.51442
Parameters in M7 (beta):
p = 0.00500 q = 99.00000
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
14..1 0.024 310.3 103.7 0.0000 0.0000 0.0322 0.0 3.3
14..2 0.008 310.3 103.7 0.0000 0.0000 0.0107 0.0 1.1
14..3 0.008 310.3 103.7 0.0000 0.0000 0.0106 0.0 1.1
14..15 0.081 310.3 103.7 0.0000 0.0000 0.1076 0.0 11.2
15..16 0.013 310.3 103.7 0.0000 0.0000 0.0176 0.0 1.8
16..4 0.048 310.3 103.7 0.0000 0.0000 0.0642 0.0 6.7
16..17 0.158 310.3 103.7 0.0000 0.0000 0.2108 0.0 21.9
17..6 0.101 310.3 103.7 0.0000 0.0000 0.1342 0.0 13.9
17..18 0.034 310.3 103.7 0.0000 0.0000 0.0448 0.0 4.6
18..7 0.070 310.3 103.7 0.0000 0.0000 0.0931 0.0 9.7
18..19 0.160 310.3 103.7 0.0000 0.0000 0.2126 0.0 22.1
19..8 0.000 310.3 103.7 0.0000 0.0000 0.0000 0.0 0.0
19..9 0.000 310.3 103.7 0.0000 0.0000 0.0000 0.0 0.0
18..11 0.324 310.3 103.7 0.0000 0.0000 0.4304 0.0 44.6
17..20 0.082 310.3 103.7 0.0000 0.0000 0.1092 0.0 11.3
20..10 0.206 310.3 103.7 0.0000 0.0000 0.2742 0.0 28.4
20..21 0.085 310.3 103.7 0.0000 0.0000 0.1130 0.0 11.7
21..12 0.121 310.3 103.7 0.0000 0.0000 0.1607 0.0 16.7
21..13 0.106 310.3 103.7 0.0000 0.0000 0.1408 0.0 14.6
15..5 0.067 310.3 103.7 0.0000 0.0000 0.0889 0.0 9.2
Time used: 4:01
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, ((4, (6, (7, (8, 9), 11), (10, (12, 13)))), 5)); MP score: 179
lnL(ntime: 20 np: 25): -1271.470364 +0.000000
14..1 14..2 14..3 14..15 15..16 16..4 16..17 17..6 17..18 18..7 18..19 19..8 19..9 18..11 17..20 20..10 20..21 21..12 21..13 15..5
0.024201 0.008080 0.007991 0.080853 0.013195 0.048257 0.158479 0.100904 0.033672 0.070019 0.159835 0.000004 0.000004 0.323540 0.082080 0.206115 0.084972 0.120771 0.105812 0.066828 2.514419 0.999990 0.005000 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.69561
(1: 0.024201, 2: 0.008080, 3: 0.007991, ((4: 0.048257, (6: 0.100904, (7: 0.070019, (8: 0.000004, 9: 0.000004): 0.159835, 11: 0.323540): 0.033672, (10: 0.206115, (12: 0.120771, 13: 0.105812): 0.084972): 0.082080): 0.158479): 0.013195, 5: 0.066828): 0.080853);
(D_melanogaster_CG34135-PC: 0.024201, D_sechellia_CG34135-PC: 0.008080, D_simulans_CG34135-PC: 0.007991, ((D_yakuba_CG34135-PC: 0.048257, (D_takahashii_CG34135-PC: 0.100904, (D_biarmipes_CG34135-PC: 0.070019, (D_suzukii_CG34135-PC: 0.000004, D_suzukii_CG34135-PC: 0.000004): 0.159835, D_ficusphila_CG34135-PC: 0.323540): 0.033672, (D_eugracilis_CG34135-PC: 0.206115, (D_rhopaloa_CG34135-PC: 0.120771, D_elegans_CG34135-PC: 0.105812): 0.084972): 0.082080): 0.158479): 0.013195, D_erecta_CG34135-PC: 0.066828): 0.080853);
Detailed output identifying parameters
kappa (ts/tv) = 2.51442
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 99.00000
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
14..1 0.024 310.3 103.7 0.0000 0.0000 0.0322 0.0 3.3
14..2 0.008 310.3 103.7 0.0000 0.0000 0.0107 0.0 1.1
14..3 0.008 310.3 103.7 0.0000 0.0000 0.0106 0.0 1.1
14..15 0.081 310.3 103.7 0.0000 0.0000 0.1076 0.0 11.2
15..16 0.013 310.3 103.7 0.0000 0.0000 0.0176 0.0 1.8
16..4 0.048 310.3 103.7 0.0000 0.0000 0.0642 0.0 6.7
16..17 0.158 310.3 103.7 0.0000 0.0000 0.2108 0.0 21.9
17..6 0.101 310.3 103.7 0.0000 0.0000 0.1342 0.0 13.9
17..18 0.034 310.3 103.7 0.0000 0.0000 0.0448 0.0 4.6
18..7 0.070 310.3 103.7 0.0000 0.0000 0.0931 0.0 9.7
18..19 0.160 310.3 103.7 0.0000 0.0000 0.2126 0.0 22.1
19..8 0.000 310.3 103.7 0.0000 0.0000 0.0000 0.0 0.0
19..9 0.000 310.3 103.7 0.0000 0.0000 0.0000 0.0 0.0
18..11 0.324 310.3 103.7 0.0000 0.0000 0.4304 0.0 44.6
17..20 0.082 310.3 103.7 0.0000 0.0000 0.1092 0.0 11.3
20..10 0.206 310.3 103.7 0.0000 0.0000 0.2742 0.0 28.4
20..21 0.085 310.3 103.7 0.0000 0.0000 0.1130 0.0 11.7
21..12 0.121 310.3 103.7 0.0000 0.0000 0.1607 0.0 16.7
21..13 0.106 310.3 103.7 0.0000 0.0000 0.1408 0.0 14.6
15..5 0.067 310.3 103.7 0.0000 0.0000 0.0889 0.0 9.2
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG34135-PC)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.001 0.006 0.043 0.205 0.745
ws: 0.108 0.100 0.099 0.099 0.099 0.099 0.099 0.099 0.099 0.099
Time used: 7:25
Model 1: NearlyNeutral -1271.471055 Model 2: PositiveSelection -1271.469716 Model 0: one-ratio -1271.53949 Model 3: discrete -1271.469716 Model 7: beta -1271.469025 Model 8: beta&w>1 -1271.470364 Model 0 vs 1 0.13686999999981708 Model 2 vs 1 0.0026779999998325366 Model 8 vs 7 0.0026779999998325366
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
