--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Mon Oct 31 18:03:11 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/121/CG32944-PF/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/121/CG32944-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/121/CG32944-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/121/CG32944-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -3764.73         -3775.13
2      -3764.79         -3773.80
--------------------------------------
TOTAL    -3764.76         -3774.67
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/121/CG32944-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/121/CG32944-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/121/CG32944-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.214255    0.000482    0.176851    0.262199    0.213053   1225.03   1233.67    1.000
r(A<->C){all}   0.083675    0.000413    0.046027    0.122995    0.082424    981.91   1003.60    1.000
r(A<->G){all}   0.202837    0.000950    0.146911    0.269087    0.200555    919.10    931.52    1.001
r(A<->T){all}   0.108726    0.000629    0.060007    0.155478    0.107192   1018.93   1075.56    1.000
r(C<->G){all}   0.075583    0.000304    0.041591    0.108945    0.074493    973.12   1054.07    1.000
r(C<->T){all}   0.429298    0.001657    0.351372    0.505544    0.427630    644.63    802.68    1.000
r(G<->T){all}   0.099882    0.000461    0.060829    0.142493    0.098269    941.46    983.23    1.001
pi(A){all}      0.248168    0.000100    0.228344    0.266884    0.248318   1114.63   1183.03    1.001
pi(C){all}      0.254678    0.000102    0.234540    0.273679    0.254544   1068.62   1225.89    1.000
pi(G){all}      0.260051    0.000104    0.241687    0.281712    0.259840   1268.60   1277.83    1.001
pi(T){all}      0.237104    0.000097    0.217917    0.256140    0.237316   1143.75   1221.16    1.000
alpha{1,2}      0.075515    0.003554    0.000142    0.182548    0.062090   1078.07   1169.43    1.000
alpha{3}        1.978939    0.645986    0.647101    3.523380    1.850519   1371.03   1436.01    1.000
pinvar{all}     0.246558    0.011730    0.033032    0.443831    0.250548   1183.42   1221.68    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-3598.365633
Model 2: PositiveSelection	-3598.045487
Model 0: one-ratio	-3615.926473
Model 3: discrete	-3597.901053
Model 7: beta	-3598.80086
Model 8: beta&w>1	-3597.919455


Model 0 vs 1	35.1216800000002

Model 2 vs 1	0.6402920000000449

Model 8 vs 7	1.7628099999992628
>C1
MEFVDDLCLARILGLLELPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
LEIPLLGDDFRFLLASACQQLHELRISFLGREHFQALIMHCFPNLWLLQV
DVLPPFFLCPRQRLQLIQIIPKFHPEDHSLAMGHMLCVKCQSLIPINFDH
FQILRAIGKGSFGKVCIVQKRDTGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQANRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQRLLSTYPGARIST
RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPAACVVHDGDCATASSAVAQLKGESIEF
IDRTPSPQIKESAGSRLDMPQSPFQK
>C2
MEFVDDLCLERILGLLDLPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
LEIPLLGDDFSFLLASACQQLLELRISYLGREHFQALIMHCFPNLWLLQV
DVLPPFFLCPRQRLQLIQIIPKFDPEDHSLAMGHMLCVDCQSQIPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEMKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPAAAIAHDGDCANASSAAAQLKGDSIEF
IDRTPSPQIKESAGSTLDMPPSPFQK
>C3
MEFVDDLCLERILGLLELPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
LEIPLLGDDFRFLLASACQQLLELRISYLGREHFQALIMHCFPNLWLLQV
DVLPPFFLCPRQRLQLIQIIPKFDPEDHSLAMGHMLCVDCQSQIPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPAAAIAHDGDCANASSAAAQLKGDSIEF
IDRTPSPQIKESAGSTLDMPPSPFQK
>C4
MEFVDDLCLSRILGLLELPDQIAMMQSYKRCRPLLGSIWRHRLTRISLNL
LEIPLLGNDFRFLLASACQQLLELRVSYLGREHFQALIVHCFPNLWLLRV
DVLPPFFLCPRQRLQLIQIIPKFLPEKHSITMGHMLCVECQSQMPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDTGHAHLTDFNIATRLQ
KNSLACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
RQELHQTPMLRNIDFQMVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKEHDW
QRELELAMANSIVNSLTPIQEKPVASTVHDDDCVTAPSAAAQLKGGIIEF
IDRTPSPQIKESASSTLNIPTRPFHK
>C5
MDKVDDLCLSRILGLLELPDQISMMQSYERCRSLLGSIWRHRLTRISLNL
LETPLLGDDFRFILASACQKLLELRISYLSREHFQTLILHCFPNLWLLRV
DVLPPFFLCPRQRLQLIQIIPKFLPEDLTVTKGHMLCVDCQSQMPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTALAEIKNILNTPVHYPRYWSSNFVDLLQKLLCTYPGARIST
RQELHQTPLLRNIDFQMVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPVAPLVHDGDYATASSAAVQLKGDSIEF
IDRTPSPQIKESAGSTLIKPTKPFQK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=576 

C1              MEFVDDLCLARILGLLELPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
C2              MEFVDDLCLERILGLLDLPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
C3              MEFVDDLCLERILGLLELPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
C4              MEFVDDLCLSRILGLLELPDQIAMMQSYKRCRPLLGSIWRHRLTRISLNL
C5              MDKVDDLCLSRILGLLELPDQISMMQSYERCRSLLGSIWRHRLTRISLNL
                *: ****** ******:*****:*****:***.*****************

C1              LEIPLLGDDFRFLLASACQQLHELRISFLGREHFQALIMHCFPNLWLLQV
C2              LEIPLLGDDFSFLLASACQQLLELRISYLGREHFQALIMHCFPNLWLLQV
C3              LEIPLLGDDFRFLLASACQQLLELRISYLGREHFQALIMHCFPNLWLLQV
C4              LEIPLLGNDFRFLLASACQQLLELRVSYLGREHFQALIVHCFPNLWLLRV
C5              LETPLLGDDFRFILASACQKLLELRISYLSREHFQTLILHCFPNLWLLRV
                ** ****:** *:******:* ***:*:*.*****:**:*********:*

C1              DVLPPFFLCPRQRLQLIQIIPKFHPEDHSLAMGHMLCVKCQSLIPINFDH
C2              DVLPPFFLCPRQRLQLIQIIPKFDPEDHSLAMGHMLCVDCQSQIPINFDH
C3              DVLPPFFLCPRQRLQLIQIIPKFDPEDHSLAMGHMLCVDCQSQIPINFDH
C4              DVLPPFFLCPRQRLQLIQIIPKFLPEKHSITMGHMLCVECQSQMPINFDH
C5              DVLPPFFLCPRQRLQLIQIIPKFLPEDLTVTKGHMLCVDCQSQMPINFDH
                *********************** **. ::: ******.*** :******

C1              FQILRAIGKGSFGKVCIVQKRDTGILYAMKYVSRSACEMRGALGGVIKEV
C2              FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
C3              FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
C4              FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
C5              FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
                **********************:***************************

C1              ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
C2              ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
C3              ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
C4              ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
C5              ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
                **************************************************

C1              VALLVCELGSALEYLQANRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
C2              VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
C3              VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
C4              VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDTGHAHLTDFNIATRLQ
C5              VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
                *****************:****************:***************

C1              KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
C2              KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
C3              KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
C4              KNSLACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
C5              KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
                **:***********************************************

C1              RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQRLLSTYPGARIST
C2              RPFVVHSNTPLAEMKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
C3              RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
C4              RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
C5              RPFVVHSNTALAEIKNILNTPVHYPRYWSSNFVDLLQKLLCTYPGARIST
                *********.***:***********************:**.*********

C1              RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
C2              RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
C3              RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
C4              RQELHQTPMLRNIDFQMVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
C5              RQELHQTPLLRNIDFQMVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
                ********:******* *********************************

C1              PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
C2              PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
C3              PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
C4              PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKEHDW
C5              PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
                ***********************************************:**

C1              QRELELAMANSIVNSLAPIQEKPAACVVHDGDCATASSAVAQLKGESIEF
C2              QRELELAMANSIVNSLAPIQEKPAAAIAHDGDCANASSAAAQLKGDSIEF
C3              QRELELAMANSIVNSLAPIQEKPAAAIAHDGDCANASSAAAQLKGDSIEF
C4              QRELELAMANSIVNSLTPIQEKPVASTVHDDDCVTAPSAAAQLKGGIIEF
C5              QRELELAMANSIVNSLAPIQEKPVAPLVHDGDYATASSAAVQLKGDSIEF
                ****************:******.*  .**.* ..*.**..****  ***

C1              IDRTPSPQIKESAGSRLDMPQSPFQK
C2              IDRTPSPQIKESAGSTLDMPPSPFQK
C3              IDRTPSPQIKESAGSTLDMPPSPFQK
C4              IDRTPSPQIKESASSTLNIPTRPFHK
C5              IDRTPSPQIKESAGSTLIKPTKPFQK
                *************.* *  *  **:*




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  576 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  576 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11520]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [11520]--->[11520]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/121/CG32944-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.355 Mb, Max= 30.848 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MEFVDDLCLARILGLLELPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
LEIPLLGDDFRFLLASACQQLHELRISFLGREHFQALIMHCFPNLWLLQV
DVLPPFFLCPRQRLQLIQIIPKFHPEDHSLAMGHMLCVKCQSLIPINFDH
FQILRAIGKGSFGKVCIVQKRDTGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQANRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQRLLSTYPGARIST
RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPAACVVHDGDCATASSAVAQLKGESIEF
IDRTPSPQIKESAGSRLDMPQSPFQK
>C2
MEFVDDLCLERILGLLDLPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
LEIPLLGDDFSFLLASACQQLLELRISYLGREHFQALIMHCFPNLWLLQV
DVLPPFFLCPRQRLQLIQIIPKFDPEDHSLAMGHMLCVDCQSQIPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEMKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPAAAIAHDGDCANASSAAAQLKGDSIEF
IDRTPSPQIKESAGSTLDMPPSPFQK
>C3
MEFVDDLCLERILGLLELPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
LEIPLLGDDFRFLLASACQQLLELRISYLGREHFQALIMHCFPNLWLLQV
DVLPPFFLCPRQRLQLIQIIPKFDPEDHSLAMGHMLCVDCQSQIPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPAAAIAHDGDCANASSAAAQLKGDSIEF
IDRTPSPQIKESAGSTLDMPPSPFQK
>C4
MEFVDDLCLSRILGLLELPDQIAMMQSYKRCRPLLGSIWRHRLTRISLNL
LEIPLLGNDFRFLLASACQQLLELRVSYLGREHFQALIVHCFPNLWLLRV
DVLPPFFLCPRQRLQLIQIIPKFLPEKHSITMGHMLCVECQSQMPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDTGHAHLTDFNIATRLQ
KNSLACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
RQELHQTPMLRNIDFQMVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKEHDW
QRELELAMANSIVNSLTPIQEKPVASTVHDDDCVTAPSAAAQLKGGIIEF
IDRTPSPQIKESASSTLNIPTRPFHK
>C5
MDKVDDLCLSRILGLLELPDQISMMQSYERCRSLLGSIWRHRLTRISLNL
LETPLLGDDFRFILASACQKLLELRISYLSREHFQTLILHCFPNLWLLRV
DVLPPFFLCPRQRLQLIQIIPKFLPEDLTVTKGHMLCVDCQSQMPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTALAEIKNILNTPVHYPRYWSSNFVDLLQKLLCTYPGARIST
RQELHQTPLLRNIDFQMVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPVAPLVHDGDYATASSAAVQLKGDSIEF
IDRTPSPQIKESAGSTLIKPTKPFQK

FORMAT of file /tmp/tmp6054206148521258394aln Not Supported[FATAL:T-COFFEE]
>C1
MEFVDDLCLARILGLLELPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
LEIPLLGDDFRFLLASACQQLHELRISFLGREHFQALIMHCFPNLWLLQV
DVLPPFFLCPRQRLQLIQIIPKFHPEDHSLAMGHMLCVKCQSLIPINFDH
FQILRAIGKGSFGKVCIVQKRDTGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQANRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQRLLSTYPGARIST
RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPAACVVHDGDCATASSAVAQLKGESIEF
IDRTPSPQIKESAGSRLDMPQSPFQK
>C2
MEFVDDLCLERILGLLDLPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
LEIPLLGDDFSFLLASACQQLLELRISYLGREHFQALIMHCFPNLWLLQV
DVLPPFFLCPRQRLQLIQIIPKFDPEDHSLAMGHMLCVDCQSQIPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEMKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPAAAIAHDGDCANASSAAAQLKGDSIEF
IDRTPSPQIKESAGSTLDMPPSPFQK
>C3
MEFVDDLCLERILGLLELPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
LEIPLLGDDFRFLLASACQQLLELRISYLGREHFQALIMHCFPNLWLLQV
DVLPPFFLCPRQRLQLIQIIPKFDPEDHSLAMGHMLCVDCQSQIPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPAAAIAHDGDCANASSAAAQLKGDSIEF
IDRTPSPQIKESAGSTLDMPPSPFQK
>C4
MEFVDDLCLSRILGLLELPDQIAMMQSYKRCRPLLGSIWRHRLTRISLNL
LEIPLLGNDFRFLLASACQQLLELRVSYLGREHFQALIVHCFPNLWLLRV
DVLPPFFLCPRQRLQLIQIIPKFLPEKHSITMGHMLCVECQSQMPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDTGHAHLTDFNIATRLQ
KNSLACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
RQELHQTPMLRNIDFQMVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKEHDW
QRELELAMANSIVNSLTPIQEKPVASTVHDDDCVTAPSAAAQLKGGIIEF
IDRTPSPQIKESASSTLNIPTRPFHK
>C5
MDKVDDLCLSRILGLLELPDQISMMQSYERCRSLLGSIWRHRLTRISLNL
LETPLLGDDFRFILASACQKLLELRISYLSREHFQTLILHCFPNLWLLRV
DVLPPFFLCPRQRLQLIQIIPKFLPEDLTVTKGHMLCVDCQSQMPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTALAEIKNILNTPVHYPRYWSSNFVDLLQKLLCTYPGARIST
RQELHQTPLLRNIDFQMVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPVAPLVHDGDYATASSAAVQLKGDSIEF
IDRTPSPQIKESAGSTLIKPTKPFQK
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:576 S:100 BS:576
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 96.53 C1	 C2	 96.53
TOP	    1    0	 96.53 C2	 C1	 96.53
BOT	    0    2	 97.05 C1	 C3	 97.05
TOP	    2    0	 97.05 C3	 C1	 97.05
BOT	    0    3	 93.23 C1	 C4	 93.23
TOP	    3    0	 93.23 C4	 C1	 93.23
BOT	    0    4	 92.71 C1	 C5	 92.71
TOP	    4    0	 92.71 C5	 C1	 92.71
BOT	    1    2	 99.48 C2	 C3	 99.48
TOP	    2    1	 99.48 C3	 C2	 99.48
BOT	    1    3	 93.75 C2	 C4	 93.75
TOP	    3    1	 93.75 C4	 C2	 93.75
BOT	    1    4	 93.58 C2	 C5	 93.58
TOP	    4    1	 93.58 C5	 C2	 93.58
BOT	    2    3	 94.27 C3	 C4	 94.27
TOP	    3    2	 94.27 C4	 C3	 94.27
BOT	    2    4	 94.10 C3	 C5	 94.10
TOP	    4    2	 94.10 C5	 C3	 94.10
BOT	    3    4	 93.06 C4	 C5	 93.06
TOP	    4    3	 93.06 C5	 C4	 93.06
AVG	 0	 C1	  *	 94.88
AVG	 1	 C2	  *	 95.83
AVG	 2	 C3	  *	 96.22
AVG	 3	 C4	  *	 93.58
AVG	 4	 C5	  *	 93.36
TOT	 TOT	  *	 94.77
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGAGTTTGTAGACGATCTGTGCCTGGCGAGGATATTAGGACTCCTGGA
C2              ATGGAGTTTGTAGACGACCTGTGCCTGGAGAGGATATTAGGACTCCTGGA
C3              ATGGAGTTTGTAGACGACCTGTGCCTGGAGAGGATATTAGGACTCCTGGA
C4              ATGGAGTTTGTAGACGACCTGTGTCTGTCTAGGATATTAGGACTCCTGGA
C5              ATGGACAAAGTAGACGACCTGTGCCTGTCGAGGATATTAGGACTTCTGGA
                ***** :::******** ***** *** . ************** *****

C1              ACTGCCCGATCAGATTGCTATGATGCAGAGCTACGAGCGCTGTCGTCCTC
C2              TCTGCCCGATCAGATTGCTATGATGCAGAGCTACGAGCGCTGTCGTCCCC
C3              ACTGCCCGATCAGATTGCTATGATGCAGAGCTACGAGCGCTGTCGTCCCC
C4              ACTGCCCGATCAGATTGCTATGATGCAGAGCTACAAGCGCTGTCGTCCTC
C5              ACTGCCCGATCAGATTTCTATGATGCAGAGCTACGAGCGCTGTCGTTCCC
                :*************** *****************.*********** * *

C1              TGCTGGGAAGTATATGGCGTCACCGACTGACCAGGATCTCTCTAAACCTG
C2              TGCTGGGAAGTATATGGCGTCACCGGCTGACCAGGATCTCTCTAAACCTG
C3              TGCTGGGAAGTATATGGCGTCACCGGCTGACCAGGATCTCTCTAAACCTG
C4              TGCTGGGAAGTATATGGCGTCACCGGCTGACCAGGATCTCGCTAAACCTG
C5              TGCTGGGAAGTATATGGCGTCACAGGTTGACCAGGATCTCGTTAAACCTG
                ***********************.*. *************  ********

C1              CTCGAGATACCCCTTCTCGGCGATGACTTCAGGTTCCTCTTGGCTAGCGC
C2              CTCGAGATACCCCTTCTGGGAGATGACTTCAGCTTCCTCTTGGCTAGCGC
C3              CTCGAGATACCCCTTCTGGGAGATGACTTCAGGTTCCTCTTGGCTAGCGC
C4              CTTGAGATACCCCTTCTCGGAAATGACTTCAGGTTTCTTTTGGCAAGCGC
C5              CTCGAGACACCCCTTTTAGGAGATGACTTCAGGTTTATTTTGGCAAGTGC
                ** **** ******* * **..********** ** .* *****:** **

C1              CTGCCAGCAGCTGCATGAGCTGAGGATCAGCTTCTTAGGCAGGGAGCACT
C2              CTGCCAGCAGCTGCTTGAGCTGAGGATCAGCTATTTGGGCAGGGAGCACT
C3              CTGCCAGCAGCTGCTTGAGCTGAGGATCAGCTATTTAGGCAGGGAGCACT
C4              CTGCCAGCAGCTGCTTGAGCTGAGAGTCAGCTACCTAGGTAGGGAGCATT
C5              CTGCCAGAAGCTGCTTGAGCTGAGGATCAGCTACCTAAGTAGGGAGCATT
                *******.******:*********..******:  *..* ******** *

C1              TCCAGGCGCTCATCATGCATTGTTTTCCCAATTTGTGGCTTTTGCAAGTC
C2              TCCAGGCGCTCATCATGCATTGTTTTCCCAATTTGTGGCTTCTCCAAGTG
C3              TCCAGGCGCTCATCATGCACTGTTTTCCCAATTTGTGGCTTCTCCAAGTG
C4              TCCAGGCGCTCATCGTGCACTGTTTTCCGAATTTATGGCTTCTGCGAGTG
C5              TCCAGACGCTCATCTTGCACTGTTTTCCCAATTTGTGGCTCCTGCGAGTG
                *****.******** **** ******** *****.*****  * *.*** 

C1              GATGTTCTACCCCCGTTTTTCCTGTGCCCACGGCAAAGACTTCAGTTGAT
C2              GATGTTCTACCCCCGTTTTTCCTGTGTCCACGGCAAAGACTTCAGTTGAT
C3              GATGTTCTACCCCCGTTTTTCCTGTGCCCACGGCAAAGACTTCAGTTGAT
C4              GATGTTTTACCCCCGTTTTTCCTGTGCCCACGGCAAAGACTTCAGTTGAT
C5              GATGTTCTACCCCCGTTTTTCTTGTGCCCACGGCAAAGACTTCAGTTGAT
                ****** ************** **** ***********************

C1              TCAGATTATCCCGAAATTCCATCCCGAGGACCACTCGCTCGCAATGGGCC
C2              TCAGATTATCCCGAAATTCGATCCCGAGGATCACTCGCTCGCAATGGGCC
C3              TCAGATTATCCCGAAATTCGATCCCGAGGATCACTCGCTCGCAATGGGCC
C4              CCAGATTATTCCGAAATTTCTTCCCGAGAAGCACTCGATCACAATGGGGC
C5              CCAGATTATTCCGAAATTCCTTCCCGAGGATCTCACGGTCACAAAGGGGC
                 ******** ********  :*******.* *:*:** **.***:*** *

C1              ACATGCTGTGCGTAAAATGCCAAAGCCTAATTCCGATCAATTTTGACCAT
C2              ACATGCTTTGCGTAGACTGCCAGAGCCAAATTCCGATCAATTTTGACCAT
C3              ACATGCTGTGCGTAGACTGCCAGAGCCAAATTCCGATCAATTTTGACCAT
C4              ACATGCTGTGTGTAGAGTGCCAGAGCCAAATGCCAATAAATTTTGACCAT
C5              ACATGCTGTGCGTAGACTGCCAGAGCCAAATGCCGATTAATTTTGACCAT
                ******* ** ***.* *****.****:*** **.** ************

C1              TTCCAAATACTCCGCGCCATAGGCAAGGGCAGTTTCGGAAAGGTGTGCAT
C2              TTCCAAATACTCCGCGCCATTGGCAAGGGCAGTTTCGGAAAGGTGTGCAT
C3              TTCCAAATACTCCGCGCCATTGGCAAGGGCAGTTTCGGAAAGGTGTGCAT
C4              TTCCAAATACTTCGCGCCATAGGAAAGGGCAGTTTTGGAAAGGTGTGCAT
C5              TTCCAAATACTTCGCGCCATAGGGAAGGGCAGTTTTGGAAAGGTGTGCAT
                *********** ********:** *********** **************

C1              TGTCCAAAAGCGGGATACCGGCATCCTGTACGCGATGAAATATGTAAGTC
C2              TGTCCAAAAGCGGGATAGCGGCATCCTGTACGCGATGAAATATGTTAGTC
C3              TGTCCAAAAGCGGGATAGCGGCATCCTGTACGCAATGAAATATGTTAGTC
C4              TGTCCAAAAGCGGGATAGCGGCATCCTGTACGCGATGAAATATGTTAGTC
C5              TGTCCAAAAACGGGATAGCGGCATCCTGTACGCGATGAAATACGTTAGTC
                *********.******* ***************.******** **:****

C1              GGTCCGCCTGCGAAATGCGCGGAGCTCTTGGTGGCGTCATCAAGGAGGTG
C2              GCTCCGCTTGCGAAATGCGCGGAGCTCTTGGTGGCGTCATCAAGGAGGTG
C3              GCTCCGCTTGCGAAATGCGCGGAGCTCTTGGTGGCGTCATCAAGGAGGTG
C4              GCTCTGCCTGCGAAATGCGCGGAGCTCTCGGCGGCGTCATTAAAGAGGTG
C5              GCTCTGCCTGCGAAATGCGCGGAGCTCTCGGCGGCGTCATCAAAGAGGTG
                * ** ** ******************** ** ******** **.******

C1              GAACTGCTATCGTCGTTGGAGCACCCGTTTCTCGTCAATTTGTGGTTCTC
C2              GAACTGCTATCGTCGTTGGAGCACCCGTTTCTCGTCAATTTATGGTTCTC
C3              GAACTGCTATCGTCGTTGGAGCACCCGTTTCTCGTCAATTTATGGTTCTC
C4              GAACTGTTATCTTCATTGGAGCACCCGTTTCTCGTCAATTTATGGTTCTC
C5              GAATTGCTATCGTCATTGGAGCACCCGTTTCTCGTCAATTTATGGTTCTC
                *** ** **** **.**************************.********

C1              TTTTCAGGATGAGGAGGATTTGTTTATGGTCTGCGACCTGTTGACTGGAG
C2              TTTTCAGGATGAGGAGGATTTGTTTATGGTCTGCGACCTGTTGACTGGCG
C3              TTTTCAGGATGAGGAGGATTTGTTTATGGTCTGCGACCTGTTGACTGGCG
C4              GTTTCAGGATGAGGAGGACTTGTTTATGGTTTGCGACCTGTTGACTGGTG
C5              GTTTCAGGATGAGGAGGACTTGTTTATGGTCTGCGACCTGTTGACTGGCG
                 ***************** *********** ***************** *

C1              GGGACTTAAGATATCATTTACAGAACCGAGTGGAATTCTCCGAGCAAAGT
C2              GGGACTTAAGATATCATTTACAGAACCGAGTGGAATTCTCCGAGCAGAGT
C3              GGGACTTAAGATATCATTTACAGAACCGAGTGGAATTCTCCGAGCAGAGT
C4              GGGACTTAAGATATCATTTACAGAACAGAGTTGAATTCTCCGAGCAGAGT
C5              GGGACTTAAGATATCATTTACAGAACCGAGTGGAATTCTCCGAGCAGAGT
                **************************.**** **************.***

C1              GTGGCCTTATTAGTGTGCGAGCTCGGCAGTGCATTGGAGTACCTGCAGGC
C2              GTGGCCTTATTAGTGTGCGAGCTCGGCAGTGCATTGGAGTACCTGCAGGC
C3              GTGGCCTTATTAGTGTGCGAGCTCGGCAGTGCATTGGAGTACCTGCAGGC
C4              GTGGCCTTATTAGTGTGCGAGCTCGGCAGTGCATTGGAGTACTTGCAGGC
C5              GTGGCCTTATTAGTGTGCGAGCTCGGCAGTGCATTGGAGTACTTGCAGGC
                ****************************************** *******

C1              GAATCGAGTAGTTCACAGGGACATCAAGCCCGACAACATTTTATTGGACG
C2              GCATCGAGTGGTTCACAGGGACATCAAGCCTGACAACATTTTATTGGATG
C3              GCATCGAGTGGTTCACAGGGACATCAAGCCTGACAACATTTTATTGGATG
C4              GCACCGTGTAGTTCACAGAGACATCAAGCCCGACAATATTTTATTGGACG
C5              GCACCGAGTAGTTCACAGGGACATCAAGCCCGACAATATTTTATTGGACG
                *.* **:**.********.*********** ***** *********** *

C1              ATGCGGGACATGCTCATTTGACTGATTTTAATATTGCAACGCGTTTGCAA
C2              ATGCGGGACATGCTCATTTGACTGATTTTAACATTGCAACGCGTTTGCAA
C3              ATGCGGGACATGCTCATTTGACTGATTTTAATATTGCCACGCGTTTGCAA
C4              ATACGGGACATGCTCATTTGACTGATTTTAATATTGCAACGAGGTTGCAA
C5              ATGCTGGACATGCTCATTTGACTGATTTTAATATTGCAACGAGGTTGCAA
                **.* ************************** *****.***.* ******

C1              AAAAATGCCTTGGCCTGCAGTATGTCGGGGACCAAGCCCTACATGGCTCC
C2              AAAAATGCCTTGGCCTGCAGTATGTCGGGGACCAAGCCCTACATGGCACC
C3              AAAAATGCCTTGGCCTGCAGTATGTCGGGGACCAAGCCCTACATGGCACC
C4              AAAAATTCCTTGGCCTGCAGTATGTCAGGGACTAAGCCCTACATGGCGCC
C5              AAAAATGCCTTGGCCTGCAGTATGTCGGGGACCAAGCCCTACATGGCGCC
                ****** *******************.***** ************** **

C1              CGAGGTGTTTCTGTGTGCCCTGGACGAAGTGGCTGGCTATAGCTATCCGG
C2              CGAGGTGTTCCTGTGTGCCCTGGACGAAGTGGCTGGCTATAGCTATCCGG
C3              CGAGGTGTTCCTGTGTGCCCTGGACGAAGTGGCTGGCTATAGCTATCCGG
C4              GGAGGTGTTCCTGTGTGCTTTGGACGAAGTGGCTGGCTATAGCTATCCGG
C5              GGAGGTTTTCTTGTGTGCCCTGGACGAAGTGGCTGGCTATAGCTATCCCG
                 ***** **  *******  **************************** *

C1              TGGACTGGTGGTCACTTGGAGTCGTCGCCTACGAAATGCGGGGAAACATC
C2              TAGACTGGTGGTCACTTGGCGTCGTCGCCTACGAAATGCGGGGAAACATC
C3              TAGACTGGTGGTCACTTGGCGTCGTCGCCTACGAAATGCGGGGAAACATC
C4              TAGACTGGTGGTCCCTTGGCGTCGTTGCTTATGAAATGCGGGGAAACATT
C5              TAGACTGGTGGTCACTTGGCGTCGTTGCTTATGAAATGCGGGGAAACATT
                *.***********.*****.***** ** ** ***************** 

C1              CGACCCTTCGTTGTGCACTCGAACACCCCACTAGCGGAGATCAAGAATAT
C2              CGACCCTTCGTGGTGCACTCGAACACCCCTCTGGCGGAGATGAAGAATAT
C3              CGACCCTTCGTGGTGCACTCGAACACCCCTCTGGCGGAGATCAAGAATAT
C4              CGACCATTTGTAGTTCACTCGAACACCCCTCTGGCGGAGATCAAGAATAT
C5              CGACCCTTTGTGGTTCACTCGAACACCGCTCTGGCAGAGATTAAGAATAT
                *****.** ** ** ************ *:**.**.***** ********

C1              ATTGAACACCCCCGTGCACTATCCGCGCTACTGGAGCAGCAACTTCGTCG
C2              ATTGAACACGCCAGTGCACTATCCCCGCTACTGGAGCAGCAACTTTGTCG
C3              ATTGAACACGCCAGTGCACTATCCCCGCTACTGGAGCAGCAACTTTGTCG
C4              ATTGAACACCCCAGTGCACTATCCCCGCTACTGGAGCAGCAACTTTGTCG
C5              ATTGAACACCCCAGTGCACTATCCCCGCTACTGGAGCAGCAACTTTGTCG
                ********* **.*********** ******************** ****

C1              ATCTGCTGCAGAGGTTACTTTCCACCTATCCGGGTGCTAGGATCAGTACA
C2              ATCTGCTGCAGAAGTTACTCTCCACCTATCCGGGTGCCAGGATCAGTACA
C3              ATCTGCTGCAGAAGTTACTCTCCACCTATCCGGGTGCCAGGATCAGTACA
C4              ACCTGTTGCAGAAGTTACTTTCCACTTATCCGGGTGCCAGGATCAGCACA
C5              ATCTGCTGCAGAAGTTACTGTGCACTTATCCGGGTGCCAGGATCAGCACA
                * *** ******.****** * *** *********** ******** ***

C1              AGGCAGGAGCTGCATCAAACGCCCATGTTGCGCAACATTGACTTCCAGAG
C2              AGGCAGGAGCTGCATCAAACGCCGATGCTGCGCAACATTGACTTCCAGAG
C3              AGGCAGGAGCTGCATCAAACGCCGATGCTGCGCAACATTGACTTCCAGAG
C4              AGGCAGGAGCTGCATCAAACGCCGATGCTGCGCAACATTGACTTCCAGAT
C5              AGGCAGGAGCTGCATCAAACGCCGTTGCTGCGCAACATTGACTTCCAGAT
                *********************** :** ********************* 

C1              GGTGCTCGAGAAGAAGATCAAACCCATCTATAAACCTCCCGAAGACCACC
C2              GGTGCTCGAGAAGAAGATCAAACCCATCTATAAACCTCCCGAAGACCACC
C3              GGTGCTCGAGAAGAAGATCAAACCCATCTATAAACCTCCCGAAGACCACC
C4              GGTGCTCGAAAAGAAGATCAAACCCATCTATAAACCTCCCGAAGACCACC
C5              GGTGCTCGAGAAGAAGATCAAACCCATCTATAAGCCTCCTGAAGACCACC
                *********.***********************.***** **********

C1              TCAACTGTGATCCTTGCCTAGAACTGGAGGAAATGATTGTAGAATCGCGG
C2              TCAACTGTGATCCCTGCCTAGAGCTGGAGGAAATGATTGTGGAATCGCGG
C3              TCAACTGTGATCCCTGCCTAGAGCTGGAGGAAATGATTGTGGAATCGCGG
C4              TCAACTGTGATCCCTGTCTAGAGCTTGAGGAAATGATTGTGGAATCAAGG
C5              TCAACTGTGATCCCTGCCTAGAACTGGAGGAAATGATTGTGGAATCACGG
                ************* ** *****.** **************.*****..**

C1              CCCTTGCATAAAAAGAAGAAGCGCCTGGCCAAGCAGAGGTCAGCACAACG
C2              CCCTTGCATAAAAAGAAGAAGCGCCTGGCCAAGCAGAGGTCAGCACAACG
C3              CCCTTGCATAAAAAGAAGAAGCGCCTGGCCAAGCAGAGGTCAGCACAACG
C4              CCCTTGCATAAAAAGAAAAAGCGCCTGGCCAAGCAGAGGTCAGCACAACG
C5              CCCTTGCATAAAAAGAAAAAGCGCCTGGCCAAGCAGAGGTCAGCACAACG
                *****************.********************************

C1              CGACAGCGATCCAGAGACTGCACTGGTCAAAGAGTTCATCGTTTACAACC
C2              GGACAGCGATCCAGAGACTGCGCTGGTCAAAGAGTTCATCGTTTACAACC
C3              GGACAGCGATCCAGAGACTGCGCTGGTCAAAGAGTTCATCGTTTACAACC
C4              TGACAGCGATCCCGAGACTGCGCTGGTCAAAGAGTTCATTGTTTACAACC
C5              CGACAGCGATCCAGAGACTGCGCTGGTCAAAGAGTTCATCGTTTACAACC
                 ***********.********.***************** **********

C1              GCTACAAGGAGTTGAAGCGCAAAGCCATGGAACAAAAGGAAAACGACTGG
C2              GCTACAAGGAGTTGAAGCGCAAAGCCATGGAACAAAAGGAAAACGACTGG
C3              GCTACAAGGAGTTGAAGCGCAAAGCCATGGAACAAAAGGAAAACGACTGG
C4              GCTACAAGGAGCTAAAGCGCAAAGCCATGGAACAAAAGGAACACGACTGG
C5              GCTACAAGGAGCTGAAGCGCAAGGCCATGGAACAAAAGGAAAACGACTGG
                *********** *.********.******************.********

C1              CAGCGCGAACTGGAACTGGCCATGGCCAACTCCATCGTGAACAGCTTGGC
C2              CAGCGCGAACTGGAACTGGCCATGGCCAACTCCATCGTGAACAGCTTGGC
C3              CAGCGCGAACTGGAACTGGCCATGGCCAACTCCATCGTGAACAGCTTGGC
C4              CAGCGCGAACTGGAATTGGCCATGGCCAATTCCATCGTGAATAGCCTGAC
C5              CAGCGTGAACTGGAACTGGCCATGGCCAACTCTATCGTGAACAGCCTGGC
                ***** ********* ************* ** ******** *** **.*

C1              CCCCATCCAAGAGAAACCCGCCGCCTGCGTTGTGCACGACGGCGACTGTG
C2              CCCCATCCAAGAGAAGCCCGCCGCCGCCATTGCGCACGACGGCGACTGTG
C3              CCCCATCCAAGAGAAGCCCGCCGCCGCCATTGCGCACGACGGCGACTGTG
C4              GCCCATCCAAGAGAAACCTGTCGCTTCCACTGTGCACGACGACGACTGTG
C5              GCCCATCCAAGAGAAGCCCGTCGCTCCCTTGGTGCACGACGGCGACTATG
                 **************.** * ***   *   * ********.*****.**

C1              CGACCGCATCATCCGCAGTCGCCCAGTTAAAGGGCGAGAGTATTGAGTTC
C2              CGAACGCATCATCTGCAGCCGCCCAGTTAAAGGGTGACAGTATTGAGTTC
C3              CGAACGCATCATCCGCAGCCGCCCAGCTAAAGGGTGACAGTATTGAGTTC
C4              TGACCGCACCATCCGCAGCCGCCCAGTTAAAGGGGGGCATCATTGAGTTC
C5              CGACCGCCTCATCCGCAGCCGTCCAGTTAAAGGGGGACAGCATTGAGTTC
                 **.***. **** **** ** **** ******* *. *  *********

C1              ATTGATCGCACTCCTTCACCGCAGATTAAAGAATCGGCTGGCAGCAGACT
C2              ATTGATCGCACTCCTTCACCGCAGATTAAAGAATCGGCTGGCAGCACGCT
C3              ATTGATCGCACTCCTTCACCGCAGATTAAAGAATCGGCTGGCAGCACGCT
C4              ATTGATCGCACTCCTTCACCTCAGATTAAAGAATCTGCTAGCAGCACGCT
C5              ATTGATCGCACTCCTTCACCGCAGATTAAAGAATCGGCTGGCAGCACGCT
                ******************** ************** ***.****** .**

C1              TGACATGCCGCAGAGTCCGTTTCAAAAA
C2              TGACATGCCGCCGAGTCCGTTTCAAAAA
C3              TGACATGCCGCCGAGTCCGTTTCAAAAA
C4              TAACATTCCGACAAGACCGTTTCATAAA
C5              TATAAAGCCGACGAAACCGTTTCAAAAA
                *.:.*: ***...*.:********:***



>C1
ATGGAGTTTGTAGACGATCTGTGCCTGGCGAGGATATTAGGACTCCTGGA
ACTGCCCGATCAGATTGCTATGATGCAGAGCTACGAGCGCTGTCGTCCTC
TGCTGGGAAGTATATGGCGTCACCGACTGACCAGGATCTCTCTAAACCTG
CTCGAGATACCCCTTCTCGGCGATGACTTCAGGTTCCTCTTGGCTAGCGC
CTGCCAGCAGCTGCATGAGCTGAGGATCAGCTTCTTAGGCAGGGAGCACT
TCCAGGCGCTCATCATGCATTGTTTTCCCAATTTGTGGCTTTTGCAAGTC
GATGTTCTACCCCCGTTTTTCCTGTGCCCACGGCAAAGACTTCAGTTGAT
TCAGATTATCCCGAAATTCCATCCCGAGGACCACTCGCTCGCAATGGGCC
ACATGCTGTGCGTAAAATGCCAAAGCCTAATTCCGATCAATTTTGACCAT
TTCCAAATACTCCGCGCCATAGGCAAGGGCAGTTTCGGAAAGGTGTGCAT
TGTCCAAAAGCGGGATACCGGCATCCTGTACGCGATGAAATATGTAAGTC
GGTCCGCCTGCGAAATGCGCGGAGCTCTTGGTGGCGTCATCAAGGAGGTG
GAACTGCTATCGTCGTTGGAGCACCCGTTTCTCGTCAATTTGTGGTTCTC
TTTTCAGGATGAGGAGGATTTGTTTATGGTCTGCGACCTGTTGACTGGAG
GGGACTTAAGATATCATTTACAGAACCGAGTGGAATTCTCCGAGCAAAGT
GTGGCCTTATTAGTGTGCGAGCTCGGCAGTGCATTGGAGTACCTGCAGGC
GAATCGAGTAGTTCACAGGGACATCAAGCCCGACAACATTTTATTGGACG
ATGCGGGACATGCTCATTTGACTGATTTTAATATTGCAACGCGTTTGCAA
AAAAATGCCTTGGCCTGCAGTATGTCGGGGACCAAGCCCTACATGGCTCC
CGAGGTGTTTCTGTGTGCCCTGGACGAAGTGGCTGGCTATAGCTATCCGG
TGGACTGGTGGTCACTTGGAGTCGTCGCCTACGAAATGCGGGGAAACATC
CGACCCTTCGTTGTGCACTCGAACACCCCACTAGCGGAGATCAAGAATAT
ATTGAACACCCCCGTGCACTATCCGCGCTACTGGAGCAGCAACTTCGTCG
ATCTGCTGCAGAGGTTACTTTCCACCTATCCGGGTGCTAGGATCAGTACA
AGGCAGGAGCTGCATCAAACGCCCATGTTGCGCAACATTGACTTCCAGAG
GGTGCTCGAGAAGAAGATCAAACCCATCTATAAACCTCCCGAAGACCACC
TCAACTGTGATCCTTGCCTAGAACTGGAGGAAATGATTGTAGAATCGCGG
CCCTTGCATAAAAAGAAGAAGCGCCTGGCCAAGCAGAGGTCAGCACAACG
CGACAGCGATCCAGAGACTGCACTGGTCAAAGAGTTCATCGTTTACAACC
GCTACAAGGAGTTGAAGCGCAAAGCCATGGAACAAAAGGAAAACGACTGG
CAGCGCGAACTGGAACTGGCCATGGCCAACTCCATCGTGAACAGCTTGGC
CCCCATCCAAGAGAAACCCGCCGCCTGCGTTGTGCACGACGGCGACTGTG
CGACCGCATCATCCGCAGTCGCCCAGTTAAAGGGCGAGAGTATTGAGTTC
ATTGATCGCACTCCTTCACCGCAGATTAAAGAATCGGCTGGCAGCAGACT
TGACATGCCGCAGAGTCCGTTTCAAAAA
>C2
ATGGAGTTTGTAGACGACCTGTGCCTGGAGAGGATATTAGGACTCCTGGA
TCTGCCCGATCAGATTGCTATGATGCAGAGCTACGAGCGCTGTCGTCCCC
TGCTGGGAAGTATATGGCGTCACCGGCTGACCAGGATCTCTCTAAACCTG
CTCGAGATACCCCTTCTGGGAGATGACTTCAGCTTCCTCTTGGCTAGCGC
CTGCCAGCAGCTGCTTGAGCTGAGGATCAGCTATTTGGGCAGGGAGCACT
TCCAGGCGCTCATCATGCATTGTTTTCCCAATTTGTGGCTTCTCCAAGTG
GATGTTCTACCCCCGTTTTTCCTGTGTCCACGGCAAAGACTTCAGTTGAT
TCAGATTATCCCGAAATTCGATCCCGAGGATCACTCGCTCGCAATGGGCC
ACATGCTTTGCGTAGACTGCCAGAGCCAAATTCCGATCAATTTTGACCAT
TTCCAAATACTCCGCGCCATTGGCAAGGGCAGTTTCGGAAAGGTGTGCAT
TGTCCAAAAGCGGGATAGCGGCATCCTGTACGCGATGAAATATGTTAGTC
GCTCCGCTTGCGAAATGCGCGGAGCTCTTGGTGGCGTCATCAAGGAGGTG
GAACTGCTATCGTCGTTGGAGCACCCGTTTCTCGTCAATTTATGGTTCTC
TTTTCAGGATGAGGAGGATTTGTTTATGGTCTGCGACCTGTTGACTGGCG
GGGACTTAAGATATCATTTACAGAACCGAGTGGAATTCTCCGAGCAGAGT
GTGGCCTTATTAGTGTGCGAGCTCGGCAGTGCATTGGAGTACCTGCAGGC
GCATCGAGTGGTTCACAGGGACATCAAGCCTGACAACATTTTATTGGATG
ATGCGGGACATGCTCATTTGACTGATTTTAACATTGCAACGCGTTTGCAA
AAAAATGCCTTGGCCTGCAGTATGTCGGGGACCAAGCCCTACATGGCACC
CGAGGTGTTCCTGTGTGCCCTGGACGAAGTGGCTGGCTATAGCTATCCGG
TAGACTGGTGGTCACTTGGCGTCGTCGCCTACGAAATGCGGGGAAACATC
CGACCCTTCGTGGTGCACTCGAACACCCCTCTGGCGGAGATGAAGAATAT
ATTGAACACGCCAGTGCACTATCCCCGCTACTGGAGCAGCAACTTTGTCG
ATCTGCTGCAGAAGTTACTCTCCACCTATCCGGGTGCCAGGATCAGTACA
AGGCAGGAGCTGCATCAAACGCCGATGCTGCGCAACATTGACTTCCAGAG
GGTGCTCGAGAAGAAGATCAAACCCATCTATAAACCTCCCGAAGACCACC
TCAACTGTGATCCCTGCCTAGAGCTGGAGGAAATGATTGTGGAATCGCGG
CCCTTGCATAAAAAGAAGAAGCGCCTGGCCAAGCAGAGGTCAGCACAACG
GGACAGCGATCCAGAGACTGCGCTGGTCAAAGAGTTCATCGTTTACAACC
GCTACAAGGAGTTGAAGCGCAAAGCCATGGAACAAAAGGAAAACGACTGG
CAGCGCGAACTGGAACTGGCCATGGCCAACTCCATCGTGAACAGCTTGGC
CCCCATCCAAGAGAAGCCCGCCGCCGCCATTGCGCACGACGGCGACTGTG
CGAACGCATCATCTGCAGCCGCCCAGTTAAAGGGTGACAGTATTGAGTTC
ATTGATCGCACTCCTTCACCGCAGATTAAAGAATCGGCTGGCAGCACGCT
TGACATGCCGCCGAGTCCGTTTCAAAAA
>C3
ATGGAGTTTGTAGACGACCTGTGCCTGGAGAGGATATTAGGACTCCTGGA
ACTGCCCGATCAGATTGCTATGATGCAGAGCTACGAGCGCTGTCGTCCCC
TGCTGGGAAGTATATGGCGTCACCGGCTGACCAGGATCTCTCTAAACCTG
CTCGAGATACCCCTTCTGGGAGATGACTTCAGGTTCCTCTTGGCTAGCGC
CTGCCAGCAGCTGCTTGAGCTGAGGATCAGCTATTTAGGCAGGGAGCACT
TCCAGGCGCTCATCATGCACTGTTTTCCCAATTTGTGGCTTCTCCAAGTG
GATGTTCTACCCCCGTTTTTCCTGTGCCCACGGCAAAGACTTCAGTTGAT
TCAGATTATCCCGAAATTCGATCCCGAGGATCACTCGCTCGCAATGGGCC
ACATGCTGTGCGTAGACTGCCAGAGCCAAATTCCGATCAATTTTGACCAT
TTCCAAATACTCCGCGCCATTGGCAAGGGCAGTTTCGGAAAGGTGTGCAT
TGTCCAAAAGCGGGATAGCGGCATCCTGTACGCAATGAAATATGTTAGTC
GCTCCGCTTGCGAAATGCGCGGAGCTCTTGGTGGCGTCATCAAGGAGGTG
GAACTGCTATCGTCGTTGGAGCACCCGTTTCTCGTCAATTTATGGTTCTC
TTTTCAGGATGAGGAGGATTTGTTTATGGTCTGCGACCTGTTGACTGGCG
GGGACTTAAGATATCATTTACAGAACCGAGTGGAATTCTCCGAGCAGAGT
GTGGCCTTATTAGTGTGCGAGCTCGGCAGTGCATTGGAGTACCTGCAGGC
GCATCGAGTGGTTCACAGGGACATCAAGCCTGACAACATTTTATTGGATG
ATGCGGGACATGCTCATTTGACTGATTTTAATATTGCCACGCGTTTGCAA
AAAAATGCCTTGGCCTGCAGTATGTCGGGGACCAAGCCCTACATGGCACC
CGAGGTGTTCCTGTGTGCCCTGGACGAAGTGGCTGGCTATAGCTATCCGG
TAGACTGGTGGTCACTTGGCGTCGTCGCCTACGAAATGCGGGGAAACATC
CGACCCTTCGTGGTGCACTCGAACACCCCTCTGGCGGAGATCAAGAATAT
ATTGAACACGCCAGTGCACTATCCCCGCTACTGGAGCAGCAACTTTGTCG
ATCTGCTGCAGAAGTTACTCTCCACCTATCCGGGTGCCAGGATCAGTACA
AGGCAGGAGCTGCATCAAACGCCGATGCTGCGCAACATTGACTTCCAGAG
GGTGCTCGAGAAGAAGATCAAACCCATCTATAAACCTCCCGAAGACCACC
TCAACTGTGATCCCTGCCTAGAGCTGGAGGAAATGATTGTGGAATCGCGG
CCCTTGCATAAAAAGAAGAAGCGCCTGGCCAAGCAGAGGTCAGCACAACG
GGACAGCGATCCAGAGACTGCGCTGGTCAAAGAGTTCATCGTTTACAACC
GCTACAAGGAGTTGAAGCGCAAAGCCATGGAACAAAAGGAAAACGACTGG
CAGCGCGAACTGGAACTGGCCATGGCCAACTCCATCGTGAACAGCTTGGC
CCCCATCCAAGAGAAGCCCGCCGCCGCCATTGCGCACGACGGCGACTGTG
CGAACGCATCATCCGCAGCCGCCCAGCTAAAGGGTGACAGTATTGAGTTC
ATTGATCGCACTCCTTCACCGCAGATTAAAGAATCGGCTGGCAGCACGCT
TGACATGCCGCCGAGTCCGTTTCAAAAA
>C4
ATGGAGTTTGTAGACGACCTGTGTCTGTCTAGGATATTAGGACTCCTGGA
ACTGCCCGATCAGATTGCTATGATGCAGAGCTACAAGCGCTGTCGTCCTC
TGCTGGGAAGTATATGGCGTCACCGGCTGACCAGGATCTCGCTAAACCTG
CTTGAGATACCCCTTCTCGGAAATGACTTCAGGTTTCTTTTGGCAAGCGC
CTGCCAGCAGCTGCTTGAGCTGAGAGTCAGCTACCTAGGTAGGGAGCATT
TCCAGGCGCTCATCGTGCACTGTTTTCCGAATTTATGGCTTCTGCGAGTG
GATGTTTTACCCCCGTTTTTCCTGTGCCCACGGCAAAGACTTCAGTTGAT
CCAGATTATTCCGAAATTTCTTCCCGAGAAGCACTCGATCACAATGGGGC
ACATGCTGTGTGTAGAGTGCCAGAGCCAAATGCCAATAAATTTTGACCAT
TTCCAAATACTTCGCGCCATAGGAAAGGGCAGTTTTGGAAAGGTGTGCAT
TGTCCAAAAGCGGGATAGCGGCATCCTGTACGCGATGAAATATGTTAGTC
GCTCTGCCTGCGAAATGCGCGGAGCTCTCGGCGGCGTCATTAAAGAGGTG
GAACTGTTATCTTCATTGGAGCACCCGTTTCTCGTCAATTTATGGTTCTC
GTTTCAGGATGAGGAGGACTTGTTTATGGTTTGCGACCTGTTGACTGGTG
GGGACTTAAGATATCATTTACAGAACAGAGTTGAATTCTCCGAGCAGAGT
GTGGCCTTATTAGTGTGCGAGCTCGGCAGTGCATTGGAGTACTTGCAGGC
GCACCGTGTAGTTCACAGAGACATCAAGCCCGACAATATTTTATTGGACG
ATACGGGACATGCTCATTTGACTGATTTTAATATTGCAACGAGGTTGCAA
AAAAATTCCTTGGCCTGCAGTATGTCAGGGACTAAGCCCTACATGGCGCC
GGAGGTGTTCCTGTGTGCTTTGGACGAAGTGGCTGGCTATAGCTATCCGG
TAGACTGGTGGTCCCTTGGCGTCGTTGCTTATGAAATGCGGGGAAACATT
CGACCATTTGTAGTTCACTCGAACACCCCTCTGGCGGAGATCAAGAATAT
ATTGAACACCCCAGTGCACTATCCCCGCTACTGGAGCAGCAACTTTGTCG
ACCTGTTGCAGAAGTTACTTTCCACTTATCCGGGTGCCAGGATCAGCACA
AGGCAGGAGCTGCATCAAACGCCGATGCTGCGCAACATTGACTTCCAGAT
GGTGCTCGAAAAGAAGATCAAACCCATCTATAAACCTCCCGAAGACCACC
TCAACTGTGATCCCTGTCTAGAGCTTGAGGAAATGATTGTGGAATCAAGG
CCCTTGCATAAAAAGAAAAAGCGCCTGGCCAAGCAGAGGTCAGCACAACG
TGACAGCGATCCCGAGACTGCGCTGGTCAAAGAGTTCATTGTTTACAACC
GCTACAAGGAGCTAAAGCGCAAAGCCATGGAACAAAAGGAACACGACTGG
CAGCGCGAACTGGAATTGGCCATGGCCAATTCCATCGTGAATAGCCTGAC
GCCCATCCAAGAGAAACCTGTCGCTTCCACTGTGCACGACGACGACTGTG
TGACCGCACCATCCGCAGCCGCCCAGTTAAAGGGGGGCATCATTGAGTTC
ATTGATCGCACTCCTTCACCTCAGATTAAAGAATCTGCTAGCAGCACGCT
TAACATTCCGACAAGACCGTTTCATAAA
>C5
ATGGACAAAGTAGACGACCTGTGCCTGTCGAGGATATTAGGACTTCTGGA
ACTGCCCGATCAGATTTCTATGATGCAGAGCTACGAGCGCTGTCGTTCCC
TGCTGGGAAGTATATGGCGTCACAGGTTGACCAGGATCTCGTTAAACCTG
CTCGAGACACCCCTTTTAGGAGATGACTTCAGGTTTATTTTGGCAAGTGC
CTGCCAGAAGCTGCTTGAGCTGAGGATCAGCTACCTAAGTAGGGAGCATT
TCCAGACGCTCATCTTGCACTGTTTTCCCAATTTGTGGCTCCTGCGAGTG
GATGTTCTACCCCCGTTTTTCTTGTGCCCACGGCAAAGACTTCAGTTGAT
CCAGATTATTCCGAAATTCCTTCCCGAGGATCTCACGGTCACAAAGGGGC
ACATGCTGTGCGTAGACTGCCAGAGCCAAATGCCGATTAATTTTGACCAT
TTCCAAATACTTCGCGCCATAGGGAAGGGCAGTTTTGGAAAGGTGTGCAT
TGTCCAAAAACGGGATAGCGGCATCCTGTACGCGATGAAATACGTTAGTC
GCTCTGCCTGCGAAATGCGCGGAGCTCTCGGCGGCGTCATCAAAGAGGTG
GAATTGCTATCGTCATTGGAGCACCCGTTTCTCGTCAATTTATGGTTCTC
GTTTCAGGATGAGGAGGACTTGTTTATGGTCTGCGACCTGTTGACTGGCG
GGGACTTAAGATATCATTTACAGAACCGAGTGGAATTCTCCGAGCAGAGT
GTGGCCTTATTAGTGTGCGAGCTCGGCAGTGCATTGGAGTACTTGCAGGC
GCACCGAGTAGTTCACAGGGACATCAAGCCCGACAATATTTTATTGGACG
ATGCTGGACATGCTCATTTGACTGATTTTAATATTGCAACGAGGTTGCAA
AAAAATGCCTTGGCCTGCAGTATGTCGGGGACCAAGCCCTACATGGCGCC
GGAGGTTTTCTTGTGTGCCCTGGACGAAGTGGCTGGCTATAGCTATCCCG
TAGACTGGTGGTCACTTGGCGTCGTTGCTTATGAAATGCGGGGAAACATT
CGACCCTTTGTGGTTCACTCGAACACCGCTCTGGCAGAGATTAAGAATAT
ATTGAACACCCCAGTGCACTATCCCCGCTACTGGAGCAGCAACTTTGTCG
ATCTGCTGCAGAAGTTACTGTGCACTTATCCGGGTGCCAGGATCAGCACA
AGGCAGGAGCTGCATCAAACGCCGTTGCTGCGCAACATTGACTTCCAGAT
GGTGCTCGAGAAGAAGATCAAACCCATCTATAAGCCTCCTGAAGACCACC
TCAACTGTGATCCCTGCCTAGAACTGGAGGAAATGATTGTGGAATCACGG
CCCTTGCATAAAAAGAAAAAGCGCCTGGCCAAGCAGAGGTCAGCACAACG
CGACAGCGATCCAGAGACTGCGCTGGTCAAAGAGTTCATCGTTTACAACC
GCTACAAGGAGCTGAAGCGCAAGGCCATGGAACAAAAGGAAAACGACTGG
CAGCGTGAACTGGAACTGGCCATGGCCAACTCTATCGTGAACAGCCTGGC
GCCCATCCAAGAGAAGCCCGTCGCTCCCTTGGTGCACGACGGCGACTATG
CGACCGCCTCATCCGCAGCCGTCCAGTTAAAGGGGGACAGCATTGAGTTC
ATTGATCGCACTCCTTCACCGCAGATTAAAGAATCGGCTGGCAGCACGCT
TATAAAGCCGACGAAACCGTTTCAAAAA
>C1
MEFVDDLCLARILGLLELPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
LEIPLLGDDFRFLLASACQQLHELRISFLGREHFQALIMHCFPNLWLLQV
DVLPPFFLCPRQRLQLIQIIPKFHPEDHSLAMGHMLCVKCQSLIPINFDH
FQILRAIGKGSFGKVCIVQKRDTGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQANRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQRLLSTYPGARIST
RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPAACVVHDGDCATASSAVAQLKGESIEF
IDRTPSPQIKESAGSRLDMPQSPFQK
>C2
MEFVDDLCLERILGLLDLPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
LEIPLLGDDFSFLLASACQQLLELRISYLGREHFQALIMHCFPNLWLLQV
DVLPPFFLCPRQRLQLIQIIPKFDPEDHSLAMGHMLCVDCQSQIPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEMKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPAAAIAHDGDCANASSAAAQLKGDSIEF
IDRTPSPQIKESAGSTLDMPPSPFQK
>C3
MEFVDDLCLERILGLLELPDQIAMMQSYERCRPLLGSIWRHRLTRISLNL
LEIPLLGDDFRFLLASACQQLLELRISYLGREHFQALIMHCFPNLWLLQV
DVLPPFFLCPRQRLQLIQIIPKFDPEDHSLAMGHMLCVDCQSQIPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPAAAIAHDGDCANASSAAAQLKGDSIEF
IDRTPSPQIKESAGSTLDMPPSPFQK
>C4
MEFVDDLCLSRILGLLELPDQIAMMQSYKRCRPLLGSIWRHRLTRISLNL
LEIPLLGNDFRFLLASACQQLLELRVSYLGREHFQALIVHCFPNLWLLRV
DVLPPFFLCPRQRLQLIQIIPKFLPEKHSITMGHMLCVECQSQMPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDTGHAHLTDFNIATRLQ
KNSLACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQKLLSTYPGARIST
RQELHQTPMLRNIDFQMVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKEHDW
QRELELAMANSIVNSLTPIQEKPVASTVHDDDCVTAPSAAAQLKGGIIEF
IDRTPSPQIKESASSTLNIPTRPFHK
>C5
MDKVDDLCLSRILGLLELPDQISMMQSYERCRSLLGSIWRHRLTRISLNL
LETPLLGDDFRFILASACQKLLELRISYLSREHFQTLILHCFPNLWLLRV
DVLPPFFLCPRQRLQLIQIIPKFLPEDLTVTKGHMLCVDCQSQMPINFDH
FQILRAIGKGSFGKVCIVQKRDSGILYAMKYVSRSACEMRGALGGVIKEV
ELLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQS
VALLVCELGSALEYLQAHRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQ
KNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNI
RPFVVHSNTALAEIKNILNTPVHYPRYWSSNFVDLLQKLLCTYPGARIST
RQELHQTPLLRNIDFQMVLEKKIKPIYKPPEDHLNCDPCLELEEMIVESR
PLHKKKKRLAKQRSAQRDSDPETALVKEFIVYNRYKELKRKAMEQKENDW
QRELELAMANSIVNSLAPIQEKPVAPLVHDGDYATASSAAVQLKGDSIEF
IDRTPSPQIKESAGSTLIKPTKPFQK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/121/CG32944-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 1728 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1477936645
      Setting output file names to "/opt/ADOPS/121/CG32944-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1274792513
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 8282422007
      Seed = 1515370802
      Swapseed = 1477936645
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 32 unique site patterns
      Division 2 has 28 unique site patterns
      Division 3 has 67 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -4598.495191 -- -25.624409
         Chain 2 -- -4578.324083 -- -25.624409
         Chain 3 -- -4588.074369 -- -25.624409
         Chain 4 -- -4578.635253 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -4388.124215 -- -25.624409
         Chain 2 -- -4610.151102 -- -25.624409
         Chain 3 -- -4611.199822 -- -25.624409
         Chain 4 -- -4598.495191 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-4598.495] (-4578.324) (-4588.074) (-4578.635) * [-4388.124] (-4610.151) (-4611.200) (-4598.495) 
        500 -- (-3819.860) (-3803.519) [-3802.679] (-3796.174) * (-3805.615) [-3794.831] (-3823.618) (-3816.472) -- 0:00:00
       1000 -- (-3813.057) (-3792.169) (-3800.828) [-3791.356] * (-3799.851) [-3792.481] (-3813.231) (-3790.690) -- 0:00:00
       1500 -- (-3809.048) [-3787.670] (-3792.267) (-3776.932) * (-3785.329) (-3788.809) (-3806.311) [-3778.050] -- 0:00:00
       2000 -- (-3781.178) (-3774.834) (-3773.950) [-3777.860] * [-3779.565] (-3774.210) (-3783.222) (-3776.924) -- 0:00:00
       2500 -- (-3780.983) (-3770.220) (-3770.846) [-3767.934] * (-3778.988) (-3777.427) (-3777.154) [-3778.156] -- 0:00:00
       3000 -- (-3782.774) (-3768.369) (-3770.001) [-3768.679] * (-3767.454) [-3778.777] (-3775.340) (-3771.250) -- 0:00:00
       3500 -- (-3772.959) [-3772.115] (-3768.565) (-3770.156) * (-3768.573) (-3767.997) (-3772.636) [-3771.620] -- 0:00:00
       4000 -- (-3767.641) (-3775.762) [-3763.931] (-3773.327) * (-3769.180) (-3770.824) [-3770.422] (-3766.099) -- 0:00:00
       4500 -- (-3770.067) (-3771.905) (-3767.390) [-3769.822] * [-3764.179] (-3769.776) (-3769.634) (-3774.845) -- 0:03:41
       5000 -- (-3765.351) (-3768.566) [-3768.931] (-3775.189) * (-3771.263) (-3772.225) [-3764.798] (-3772.209) -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- [-3766.640] (-3764.474) (-3768.043) (-3769.042) * (-3765.435) (-3768.320) (-3767.187) [-3768.050] -- 0:03:00
       6000 -- [-3771.451] (-3772.529) (-3765.216) (-3770.536) * (-3768.346) (-3766.713) [-3771.663] (-3769.708) -- 0:02:45
       6500 -- (-3775.909) [-3772.894] (-3767.511) (-3766.292) * [-3773.739] (-3768.058) (-3774.974) (-3767.074) -- 0:02:32
       7000 -- (-3768.117) (-3768.189) [-3771.845] (-3766.538) * (-3766.112) (-3766.249) (-3767.988) [-3764.087] -- 0:02:21
       7500 -- (-3765.086) [-3766.124] (-3772.029) (-3767.869) * (-3767.306) [-3765.373] (-3766.827) (-3769.544) -- 0:02:12
       8000 -- (-3764.364) (-3769.181) [-3768.939] (-3768.598) * (-3773.037) [-3766.809] (-3771.637) (-3766.072) -- 0:02:04
       8500 -- (-3766.777) [-3769.452] (-3766.506) (-3764.310) * (-3768.514) (-3765.330) [-3770.059] (-3770.280) -- 0:03:53
       9000 -- (-3772.179) (-3767.133) (-3765.487) [-3763.335] * (-3775.543) (-3774.178) (-3769.990) [-3768.995] -- 0:03:40
       9500 -- [-3768.982] (-3780.194) (-3771.483) (-3768.908) * (-3776.333) [-3768.887] (-3775.734) (-3769.616) -- 0:03:28
      10000 -- (-3768.353) (-3764.516) [-3767.514] (-3764.855) * [-3767.286] (-3767.864) (-3774.386) (-3766.164) -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      10500 -- [-3769.849] (-3765.288) (-3773.496) (-3772.746) * (-3768.266) [-3766.439] (-3770.152) (-3766.506) -- 0:03:08
      11000 -- (-3765.423) (-3769.097) [-3766.425] (-3773.127) * (-3774.264) [-3766.210] (-3769.742) (-3770.297) -- 0:02:59
      11500 -- (-3767.710) (-3766.694) (-3773.613) [-3767.704] * (-3767.452) (-3767.490) (-3775.729) [-3765.268] -- 0:02:51
      12000 -- (-3765.328) (-3765.392) (-3769.178) [-3767.640] * (-3770.443) [-3771.141] (-3766.444) (-3773.139) -- 0:02:44
      12500 -- (-3769.935) (-3766.198) (-3771.549) [-3769.472] * [-3766.273] (-3770.557) (-3768.522) (-3766.121) -- 0:03:57
      13000 -- (-3773.821) (-3785.170) [-3766.359] (-3766.383) * [-3768.680] (-3774.998) (-3766.390) (-3768.926) -- 0:03:47
      13500 -- (-3771.602) [-3763.705] (-3768.935) (-3768.246) * (-3771.736) (-3768.726) [-3766.314] (-3768.910) -- 0:03:39
      14000 -- (-3773.308) (-3771.429) (-3772.618) [-3763.097] * (-3773.598) (-3771.956) (-3765.373) [-3768.368] -- 0:03:31
      14500 -- (-3766.348) [-3768.724] (-3779.709) (-3768.919) * [-3764.372] (-3769.707) (-3771.813) (-3764.837) -- 0:03:23
      15000 -- (-3769.203) [-3772.583] (-3771.199) (-3768.652) * (-3764.179) (-3771.666) (-3768.847) [-3766.827] -- 0:03:17

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-3774.710) (-3769.382) [-3770.918] (-3771.383) * [-3765.473] (-3772.584) (-3772.807) (-3769.454) -- 0:03:10
      16000 -- (-3768.364) (-3765.640) [-3775.599] (-3771.664) * [-3764.278] (-3778.283) (-3770.730) (-3766.603) -- 0:03:04
      16500 -- (-3767.383) (-3763.998) [-3768.579] (-3780.573) * (-3767.606) (-3769.350) [-3767.352] (-3765.532) -- 0:02:58
      17000 -- [-3767.581] (-3771.001) (-3769.092) (-3770.545) * (-3776.466) (-3771.213) (-3766.047) [-3763.758] -- 0:03:51
      17500 -- (-3769.872) [-3767.861] (-3769.551) (-3767.863) * (-3770.606) (-3770.539) (-3774.592) [-3769.691] -- 0:03:44
      18000 -- (-3771.296) (-3764.313) (-3763.245) [-3764.043] * (-3776.564) [-3770.147] (-3767.265) (-3770.289) -- 0:03:38
      18500 -- (-3771.258) (-3763.154) [-3766.307] (-3769.075) * (-3772.313) (-3768.843) [-3764.942] (-3769.217) -- 0:03:32
      19000 -- [-3764.957] (-3762.935) (-3771.079) (-3766.857) * (-3774.016) (-3768.946) (-3769.156) [-3764.223] -- 0:03:26
      19500 -- (-3769.417) (-3767.275) [-3771.367] (-3768.924) * (-3766.950) (-3776.145) [-3773.850] (-3765.361) -- 0:03:21
      20000 -- (-3776.262) (-3766.876) (-3765.848) [-3765.339] * (-3766.890) (-3773.304) (-3773.124) [-3768.737] -- 0:03:16

      Average standard deviation of split frequencies: 0.000000

      20500 -- [-3775.252] (-3765.806) (-3767.275) (-3764.750) * [-3769.471] (-3771.196) (-3771.752) (-3769.029) -- 0:03:11
      21000 -- (-3770.303) [-3761.710] (-3765.468) (-3773.859) * (-3773.652) [-3769.504] (-3769.355) (-3769.523) -- 0:03:53
      21500 -- (-3766.185) (-3767.699) [-3766.992] (-3773.216) * (-3767.012) (-3770.006) [-3773.475] (-3767.189) -- 0:03:47
      22000 -- [-3767.710] (-3766.871) (-3769.032) (-3773.814) * (-3765.393) [-3764.476] (-3783.053) (-3772.868) -- 0:03:42
      22500 -- (-3771.746) [-3763.541] (-3768.580) (-3773.340) * (-3773.871) (-3769.798) (-3774.718) [-3769.301] -- 0:03:37
      23000 -- (-3766.151) [-3763.506] (-3764.463) (-3770.090) * (-3765.270) [-3767.613] (-3767.104) (-3768.573) -- 0:03:32
      23500 -- (-3771.120) (-3765.262) (-3762.848) [-3764.356] * (-3771.829) [-3770.313] (-3771.941) (-3769.191) -- 0:03:27
      24000 -- [-3768.212] (-3770.224) (-3770.623) (-3765.022) * (-3764.879) [-3770.741] (-3766.184) (-3778.794) -- 0:03:23
      24500 -- (-3771.768) (-3766.113) (-3780.100) [-3767.475] * (-3767.046) [-3763.769] (-3767.203) (-3768.111) -- 0:03:19
      25000 -- (-3772.108) (-3768.013) (-3774.878) [-3765.300] * (-3770.157) (-3771.011) (-3773.617) [-3768.195] -- 0:03:54

      Average standard deviation of split frequencies: 0.000000

      25500 -- (-3766.855) (-3767.263) (-3772.702) [-3766.298] * (-3767.029) [-3765.999] (-3768.858) (-3780.818) -- 0:03:49
      26000 -- (-3765.243) (-3768.460) (-3769.389) [-3766.354] * (-3765.555) (-3766.264) [-3770.453] (-3772.178) -- 0:03:44
      26500 -- (-3763.232) (-3764.193) (-3770.549) [-3764.873] * [-3764.851] (-3774.720) (-3767.720) (-3774.373) -- 0:03:40
      27000 -- (-3766.053) [-3765.137] (-3769.258) (-3772.813) * (-3772.728) (-3770.087) (-3770.777) [-3769.677] -- 0:03:36
      27500 -- (-3767.056) [-3767.842] (-3772.826) (-3771.773) * (-3766.430) [-3766.506] (-3771.651) (-3768.438) -- 0:03:32
      28000 -- (-3764.175) (-3769.237) (-3769.469) [-3768.430] * [-3768.118] (-3765.988) (-3766.797) (-3770.266) -- 0:03:28
      28500 -- [-3767.150] (-3767.570) (-3769.682) (-3769.594) * (-3764.801) [-3763.076] (-3766.155) (-3769.772) -- 0:03:24
      29000 -- [-3770.678] (-3771.239) (-3767.296) (-3770.052) * [-3764.129] (-3775.574) (-3766.585) (-3763.416) -- 0:03:20
      29500 -- (-3767.206) (-3767.730) [-3764.124] (-3773.549) * (-3766.566) (-3769.218) (-3768.866) [-3767.341] -- 0:03:50
      30000 -- (-3764.554) (-3764.494) [-3764.303] (-3772.684) * (-3771.661) (-3772.278) (-3768.760) [-3762.434] -- 0:03:46

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-3767.000) [-3761.199] (-3765.871) (-3773.163) * (-3768.821) (-3766.815) [-3769.502] (-3763.400) -- 0:03:42
      31000 -- (-3771.066) (-3767.153) [-3764.822] (-3766.242) * (-3773.340) [-3771.810] (-3768.276) (-3768.938) -- 0:03:38
      31500 -- [-3765.022] (-3767.148) (-3767.883) (-3769.177) * [-3765.021] (-3769.286) (-3770.736) (-3774.731) -- 0:03:35
      32000 -- (-3768.291) (-3770.650) [-3772.172] (-3767.659) * [-3764.422] (-3771.181) (-3766.888) (-3770.154) -- 0:03:31
      32500 -- (-3762.835) (-3762.204) [-3767.639] (-3773.884) * (-3765.194) (-3766.234) (-3764.526) [-3771.114] -- 0:03:28
      33000 -- (-3771.525) (-3764.762) (-3767.494) [-3764.038] * (-3770.469) (-3771.346) [-3765.627] (-3768.978) -- 0:03:25
      33500 -- [-3766.595] (-3768.251) (-3770.151) (-3767.325) * [-3765.992] (-3775.003) (-3776.043) (-3765.283) -- 0:03:50
      34000 -- (-3772.863) (-3768.848) [-3771.060] (-3771.527) * (-3766.678) [-3766.071] (-3779.462) (-3767.855) -- 0:03:47
      34500 -- (-3776.261) (-3773.649) (-3765.536) [-3769.416] * (-3762.362) (-3770.348) [-3769.744] (-3769.478) -- 0:03:43
      35000 -- (-3769.635) (-3769.121) [-3765.121] (-3766.298) * (-3768.008) (-3767.947) (-3764.285) [-3771.165] -- 0:03:40

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-3768.782) (-3767.345) [-3764.197] (-3767.361) * (-3772.439) [-3762.389] (-3766.558) (-3770.575) -- 0:03:37
      36000 -- (-3770.207) (-3773.681) [-3766.713] (-3764.691) * (-3785.076) (-3766.097) [-3763.544] (-3767.688) -- 0:03:34
      36500 -- [-3766.755] (-3775.205) (-3773.543) (-3764.798) * (-3780.705) (-3769.646) [-3769.703] (-3768.660) -- 0:03:31
      37000 -- [-3772.290] (-3770.870) (-3770.100) (-3766.617) * [-3782.075] (-3765.270) (-3768.942) (-3768.107) -- 0:03:28
      37500 -- (-3770.609) (-3772.508) (-3768.743) [-3763.448] * (-3777.793) (-3767.844) [-3767.970] (-3765.540) -- 0:03:25
      38000 -- (-3770.576) [-3764.532] (-3770.258) (-3764.361) * (-3771.649) [-3770.637] (-3765.376) (-3775.931) -- 0:03:47
      38500 -- (-3770.038) (-3769.486) (-3770.592) [-3765.084] * (-3769.076) (-3769.161) (-3769.220) [-3766.280] -- 0:03:44
      39000 -- (-3774.884) (-3767.667) (-3771.928) [-3765.313] * (-3771.333) (-3774.881) [-3764.223] (-3767.442) -- 0:03:41
      39500 -- (-3768.372) (-3773.352) (-3771.396) [-3765.838] * (-3769.189) (-3779.045) [-3764.438] (-3765.243) -- 0:03:38
      40000 -- (-3771.918) [-3762.518] (-3771.408) (-3764.148) * (-3765.073) (-3776.709) (-3767.788) [-3767.524] -- 0:03:36

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-3767.123) (-3768.948) (-3775.433) [-3770.984] * (-3767.311) (-3772.369) (-3766.945) [-3766.660] -- 0:03:33
      41000 -- (-3772.445) (-3772.084) [-3769.029] (-3771.877) * (-3770.845) (-3768.199) [-3769.667] (-3765.569) -- 0:03:30
      41500 -- (-3772.619) [-3769.312] (-3768.596) (-3767.865) * [-3763.635] (-3778.574) (-3769.677) (-3768.721) -- 0:03:27
      42000 -- [-3768.948] (-3773.163) (-3763.602) (-3765.429) * (-3763.776) (-3773.310) (-3772.680) [-3767.302] -- 0:03:48
      42500 -- (-3767.790) (-3769.371) [-3771.212] (-3766.985) * (-3776.153) (-3768.920) (-3771.061) [-3768.425] -- 0:03:45
      43000 -- (-3775.517) (-3771.473) (-3765.984) [-3765.818] * (-3769.322) (-3766.060) [-3773.933] (-3768.041) -- 0:03:42
      43500 -- (-3771.923) [-3770.368] (-3765.388) (-3773.727) * (-3770.887) (-3772.360) [-3771.926] (-3768.185) -- 0:03:39
      44000 -- (-3769.255) (-3771.956) [-3764.936] (-3775.461) * [-3766.292] (-3768.780) (-3769.792) (-3771.001) -- 0:03:37
      44500 -- [-3765.220] (-3768.001) (-3772.134) (-3772.733) * (-3770.130) (-3776.956) (-3772.534) [-3767.104] -- 0:03:34
      45000 -- (-3769.369) (-3770.248) (-3773.556) [-3769.118] * [-3765.617] (-3773.266) (-3767.288) (-3768.933) -- 0:03:32

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-3773.648) (-3769.079) [-3769.428] (-3763.652) * (-3767.310) [-3769.768] (-3769.527) (-3772.583) -- 0:03:29
      46000 -- (-3765.045) (-3766.680) (-3771.548) [-3764.137] * (-3770.294) [-3766.992] (-3770.857) (-3775.222) -- 0:03:48
      46500 -- (-3767.214) (-3765.189) [-3767.658] (-3771.883) * (-3771.757) (-3767.132) (-3765.497) [-3770.062] -- 0:03:45
      47000 -- (-3765.589) (-3765.292) [-3762.871] (-3768.629) * (-3771.842) (-3765.136) [-3768.855] (-3769.995) -- 0:03:43
      47500 -- (-3766.340) (-3765.940) (-3766.522) [-3768.802] * (-3773.904) [-3765.775] (-3769.027) (-3769.238) -- 0:03:40
      48000 -- (-3768.316) (-3771.630) (-3772.255) [-3766.303] * [-3765.475] (-3771.784) (-3765.595) (-3768.061) -- 0:03:38
      48500 -- [-3771.555] (-3776.770) (-3774.190) (-3770.670) * (-3766.923) (-3766.500) (-3767.750) [-3770.743] -- 0:03:35
      49000 -- (-3769.674) (-3768.861) (-3773.439) [-3765.032] * [-3765.053] (-3770.236) (-3767.224) (-3763.775) -- 0:03:33
      49500 -- [-3764.846] (-3771.849) (-3772.657) (-3765.192) * (-3771.005) (-3766.397) (-3768.077) [-3763.720] -- 0:03:31
      50000 -- (-3763.885) (-3776.069) (-3766.301) [-3772.905] * (-3773.696) (-3763.841) (-3774.039) [-3766.754] -- 0:03:48

      Average standard deviation of split frequencies: 0.000000

      50500 -- (-3773.409) [-3764.145] (-3775.583) (-3773.356) * [-3772.035] (-3767.014) (-3768.568) (-3768.430) -- 0:03:45
      51000 -- (-3769.794) (-3764.271) [-3765.965] (-3768.695) * (-3772.638) (-3767.977) [-3769.170] (-3770.808) -- 0:03:43
      51500 -- [-3765.864] (-3769.626) (-3768.003) (-3765.447) * (-3772.608) (-3767.209) (-3765.239) [-3767.590] -- 0:03:41
      52000 -- (-3771.108) [-3765.015] (-3773.387) (-3766.642) * (-3774.630) (-3765.846) (-3769.519) [-3774.755] -- 0:03:38
      52500 -- (-3767.907) (-3764.082) [-3766.349] (-3769.914) * (-3772.495) (-3767.219) [-3767.962] (-3763.197) -- 0:03:36
      53000 -- [-3767.991] (-3765.926) (-3768.712) (-3768.063) * (-3766.058) (-3772.300) [-3764.682] (-3768.445) -- 0:03:34
      53500 -- [-3771.700] (-3766.573) (-3765.383) (-3765.450) * (-3769.017) (-3768.518) (-3768.076) [-3769.801] -- 0:03:32
      54000 -- (-3767.749) (-3772.430) [-3769.263] (-3765.578) * [-3763.743] (-3771.661) (-3768.263) (-3765.719) -- 0:03:30
      54500 -- (-3770.486) (-3768.682) (-3772.822) [-3766.634] * (-3768.952) (-3772.989) (-3772.642) [-3763.695] -- 0:03:45
      55000 -- (-3769.794) (-3770.127) (-3767.365) [-3765.961] * [-3774.049] (-3782.804) (-3775.144) (-3764.890) -- 0:03:43

      Average standard deviation of split frequencies: 0.000000

      55500 -- [-3766.936] (-3766.671) (-3765.230) (-3766.968) * (-3773.105) (-3774.826) [-3762.980] (-3767.923) -- 0:03:41
      56000 -- (-3767.698) (-3774.437) [-3767.614] (-3771.782) * [-3769.990] (-3770.031) (-3771.133) (-3770.490) -- 0:03:39
      56500 -- [-3764.879] (-3765.142) (-3775.550) (-3767.906) * (-3768.549) (-3764.757) [-3763.907] (-3767.785) -- 0:03:37
      57000 -- (-3769.349) (-3767.341) (-3768.047) [-3767.697] * (-3765.547) (-3771.718) [-3764.130] (-3766.084) -- 0:03:35
      57500 -- [-3769.814] (-3768.578) (-3767.573) (-3769.095) * (-3768.235) (-3771.742) [-3763.431] (-3769.946) -- 0:03:33
      58000 -- (-3769.200) (-3763.551) [-3766.685] (-3768.032) * (-3768.435) (-3771.960) [-3763.723] (-3771.578) -- 0:03:31
      58500 -- (-3774.887) (-3768.702) (-3767.630) [-3764.249] * (-3770.274) (-3773.655) [-3763.358] (-3763.059) -- 0:03:45
      59000 -- (-3771.238) (-3766.269) (-3763.481) [-3768.147] * (-3772.259) (-3771.944) [-3765.866] (-3769.399) -- 0:03:43
      59500 -- [-3766.919] (-3766.703) (-3767.974) (-3772.364) * (-3774.013) [-3771.749] (-3773.079) (-3777.322) -- 0:03:41
      60000 -- (-3769.612) [-3766.810] (-3766.256) (-3763.506) * (-3768.428) [-3763.918] (-3771.035) (-3769.788) -- 0:03:39

      Average standard deviation of split frequencies: 0.000000

      60500 -- (-3772.409) (-3771.147) (-3774.480) [-3766.004] * [-3767.299] (-3769.421) (-3766.930) (-3770.339) -- 0:03:37
      61000 -- (-3766.598) (-3770.467) (-3769.676) [-3765.292] * [-3769.158] (-3768.790) (-3762.370) (-3765.487) -- 0:03:35
      61500 -- (-3769.361) (-3766.559) [-3767.183] (-3767.266) * (-3763.297) [-3768.859] (-3762.971) (-3773.715) -- 0:03:33
      62000 -- (-3769.228) (-3767.322) (-3769.224) [-3769.170] * [-3766.782] (-3768.928) (-3771.581) (-3768.047) -- 0:03:31
      62500 -- (-3778.684) (-3765.242) (-3767.695) [-3763.963] * [-3764.703] (-3770.069) (-3766.388) (-3766.419) -- 0:03:45
      63000 -- (-3779.205) (-3766.028) [-3762.430] (-3765.777) * [-3769.036] (-3767.189) (-3767.085) (-3765.489) -- 0:03:43
      63500 -- [-3768.927] (-3764.607) (-3764.857) (-3779.253) * [-3764.231] (-3767.166) (-3768.082) (-3766.205) -- 0:03:41
      64000 -- (-3772.309) [-3769.561] (-3763.828) (-3766.814) * (-3768.463) (-3772.662) [-3763.679] (-3767.073) -- 0:03:39
      64500 -- [-3766.078] (-3769.761) (-3765.183) (-3765.342) * (-3764.139) (-3765.862) (-3773.575) [-3770.646] -- 0:03:37
      65000 -- [-3765.449] (-3774.263) (-3765.320) (-3763.607) * (-3769.267) [-3768.479] (-3776.029) (-3767.262) -- 0:03:35

      Average standard deviation of split frequencies: 0.000000

      65500 -- (-3768.811) (-3770.974) (-3768.761) [-3766.024] * (-3765.962) (-3765.545) [-3771.371] (-3765.224) -- 0:03:34
      66000 -- (-3769.970) (-3768.887) (-3763.470) [-3768.395] * (-3767.406) (-3764.297) [-3770.967] (-3769.506) -- 0:03:32
      66500 -- (-3770.384) (-3777.738) (-3765.541) [-3769.289] * (-3764.145) (-3767.226) (-3772.095) [-3761.334] -- 0:03:30
      67000 -- (-3766.616) (-3768.865) [-3766.654] (-3767.933) * [-3763.423] (-3764.924) (-3767.588) (-3769.114) -- 0:03:42
      67500 -- (-3767.917) [-3768.877] (-3768.195) (-3773.107) * [-3763.296] (-3772.409) (-3776.606) (-3768.352) -- 0:03:41
      68000 -- [-3765.729] (-3770.559) (-3769.680) (-3767.326) * (-3776.515) [-3767.352] (-3768.849) (-3774.684) -- 0:03:39
      68500 -- (-3763.489) (-3772.936) (-3768.263) [-3771.403] * (-3769.533) [-3765.486] (-3768.166) (-3771.804) -- 0:03:37
      69000 -- (-3764.268) (-3765.726) [-3768.858] (-3772.102) * [-3765.696] (-3769.294) (-3763.676) (-3771.833) -- 0:03:35
      69500 -- [-3767.836] (-3770.783) (-3766.900) (-3769.154) * [-3765.469] (-3764.943) (-3767.095) (-3774.552) -- 0:03:34
      70000 -- (-3767.557) [-3762.832] (-3764.918) (-3764.510) * [-3769.649] (-3771.535) (-3766.525) (-3773.398) -- 0:03:32

      Average standard deviation of split frequencies: 0.000000

      70500 -- (-3766.478) (-3769.779) (-3766.348) [-3767.962] * (-3773.659) (-3772.862) (-3767.840) [-3769.506] -- 0:03:30
      71000 -- (-3766.738) [-3764.525] (-3768.926) (-3774.246) * (-3778.304) (-3768.809) [-3764.380] (-3770.938) -- 0:03:42
      71500 -- [-3771.518] (-3766.466) (-3767.281) (-3764.684) * (-3769.499) (-3765.256) (-3764.541) [-3772.389] -- 0:03:40
      72000 -- (-3768.691) [-3765.367] (-3769.083) (-3768.422) * (-3766.792) [-3767.248] (-3764.188) (-3769.577) -- 0:03:39
      72500 -- (-3767.132) [-3765.151] (-3773.743) (-3766.448) * (-3769.203) (-3766.646) [-3762.580] (-3772.727) -- 0:03:37
      73000 -- (-3770.052) (-3770.358) (-3780.098) [-3771.068] * [-3765.943] (-3768.514) (-3764.068) (-3772.399) -- 0:03:35
      73500 -- [-3769.255] (-3766.150) (-3779.131) (-3766.128) * (-3765.059) (-3776.265) [-3770.542] (-3768.210) -- 0:03:34
      74000 -- [-3766.450] (-3773.889) (-3768.651) (-3768.245) * (-3766.293) (-3782.424) [-3763.448] (-3770.118) -- 0:03:32
      74500 -- [-3764.958] (-3767.864) (-3772.366) (-3769.339) * (-3774.446) [-3769.209] (-3769.811) (-3768.786) -- 0:03:31
      75000 -- (-3766.086) [-3771.913] (-3763.732) (-3767.709) * (-3773.817) (-3772.159) (-3770.373) [-3769.690] -- 0:03:42

      Average standard deviation of split frequencies: 0.000000

      75500 -- [-3764.736] (-3762.140) (-3767.698) (-3772.559) * [-3771.719] (-3767.505) (-3769.636) (-3768.937) -- 0:03:40
      76000 -- (-3767.857) [-3767.687] (-3763.516) (-3771.408) * (-3765.373) (-3769.031) [-3768.386] (-3768.223) -- 0:03:38
      76500 -- (-3769.855) (-3780.086) [-3770.879] (-3773.996) * (-3769.625) [-3763.533] (-3767.521) (-3772.864) -- 0:03:37
      77000 -- [-3769.224] (-3775.856) (-3769.650) (-3772.845) * (-3771.276) [-3771.630] (-3764.296) (-3777.191) -- 0:03:35
      77500 -- (-3765.222) [-3775.906] (-3770.542) (-3767.973) * (-3765.985) (-3772.761) [-3765.037] (-3774.830) -- 0:03:34
      78000 -- (-3765.439) (-3767.467) (-3770.711) [-3768.499] * [-3767.883] (-3767.729) (-3764.919) (-3769.674) -- 0:03:32
      78500 -- (-3765.679) [-3766.861] (-3766.389) (-3767.476) * [-3765.258] (-3764.549) (-3765.409) (-3768.573) -- 0:03:31
      79000 -- [-3772.971] (-3769.602) (-3768.053) (-3772.906) * (-3768.413) (-3766.034) [-3767.288] (-3774.173) -- 0:03:41
      79500 -- [-3764.245] (-3771.276) (-3765.061) (-3768.543) * (-3768.772) (-3765.468) (-3769.443) [-3770.454] -- 0:03:39
      80000 -- [-3768.462] (-3769.551) (-3765.895) (-3774.797) * (-3774.081) (-3766.233) [-3765.956] (-3769.220) -- 0:03:38

      Average standard deviation of split frequencies: 0.000000

      80500 -- [-3768.432] (-3770.225) (-3772.459) (-3771.356) * (-3769.032) [-3767.071] (-3769.350) (-3768.366) -- 0:03:37
      81000 -- (-3772.947) (-3769.355) [-3765.467] (-3766.943) * (-3772.391) (-3761.662) (-3764.002) [-3764.593] -- 0:03:35
      81500 -- (-3770.229) (-3768.786) [-3767.386] (-3771.411) * (-3763.184) (-3770.533) (-3771.144) [-3764.970] -- 0:03:34
      82000 -- [-3769.836] (-3767.426) (-3764.165) (-3777.264) * (-3768.557) (-3769.432) [-3765.541] (-3766.482) -- 0:03:32
      82500 -- (-3767.672) [-3766.521] (-3767.707) (-3768.724) * (-3769.126) (-3771.923) (-3764.560) [-3768.699] -- 0:03:31
      83000 -- [-3768.249] (-3764.563) (-3768.543) (-3778.731) * (-3774.071) (-3771.050) [-3764.463] (-3766.559) -- 0:03:29
      83500 -- [-3764.294] (-3769.081) (-3767.935) (-3771.314) * (-3770.407) (-3769.360) (-3766.324) [-3770.409] -- 0:03:39
      84000 -- [-3767.291] (-3771.622) (-3765.463) (-3772.410) * (-3776.740) (-3767.688) [-3766.370] (-3767.702) -- 0:03:38
      84500 -- [-3768.719] (-3768.441) (-3776.255) (-3770.179) * [-3765.708] (-3774.180) (-3774.222) (-3768.833) -- 0:03:36
      85000 -- (-3765.923) [-3768.320] (-3783.076) (-3774.817) * (-3765.228) (-3771.258) (-3770.715) [-3767.291] -- 0:03:35

      Average standard deviation of split frequencies: 0.000000

      85500 -- (-3766.902) (-3774.463) [-3771.141] (-3765.881) * [-3764.210] (-3774.607) (-3767.395) (-3767.316) -- 0:03:33
      86000 -- (-3766.479) [-3774.716] (-3768.578) (-3772.572) * (-3763.058) (-3777.585) [-3767.457] (-3771.396) -- 0:03:32
      86500 -- (-3768.008) (-3767.357) [-3766.617] (-3766.368) * [-3763.599] (-3773.882) (-3765.844) (-3765.939) -- 0:03:31
      87000 -- (-3767.112) (-3764.572) (-3766.469) [-3762.833] * (-3767.339) (-3779.920) (-3774.336) [-3765.250] -- 0:03:29
      87500 -- (-3770.598) (-3765.106) [-3767.770] (-3771.916) * (-3763.993) (-3776.264) [-3767.997] (-3765.501) -- 0:03:39
      88000 -- (-3767.422) [-3765.186] (-3773.182) (-3768.866) * (-3766.809) (-3768.320) [-3766.088] (-3765.198) -- 0:03:37
      88500 -- (-3774.381) (-3770.481) [-3768.846] (-3766.506) * [-3769.081] (-3770.706) (-3771.349) (-3765.536) -- 0:03:36
      89000 -- (-3769.475) [-3765.161] (-3764.518) (-3773.675) * (-3765.812) [-3769.000] (-3771.272) (-3764.204) -- 0:03:34
      89500 -- (-3768.932) (-3772.810) (-3766.497) [-3765.626] * [-3765.222] (-3766.690) (-3769.300) (-3771.716) -- 0:03:33
      90000 -- (-3773.373) [-3765.885] (-3763.296) (-3773.842) * [-3769.362] (-3771.264) (-3779.221) (-3776.079) -- 0:03:32

      Average standard deviation of split frequencies: 0.000000

      90500 -- (-3763.801) [-3769.789] (-3764.275) (-3770.672) * (-3764.846) [-3767.132] (-3778.964) (-3768.930) -- 0:03:31
      91000 -- [-3765.520] (-3777.871) (-3767.212) (-3770.741) * (-3768.148) [-3770.929] (-3779.161) (-3769.635) -- 0:03:29
      91500 -- (-3770.367) (-3781.294) [-3765.231] (-3772.273) * (-3768.436) (-3767.403) (-3769.949) [-3766.276] -- 0:03:38
      92000 -- [-3764.135] (-3772.324) (-3765.355) (-3768.181) * [-3764.484] (-3771.283) (-3777.255) (-3766.653) -- 0:03:37
      92500 -- (-3768.210) [-3768.743] (-3768.142) (-3773.660) * (-3767.202) (-3767.376) (-3770.192) [-3768.071] -- 0:03:35
      93000 -- (-3777.682) [-3766.768] (-3771.345) (-3768.758) * (-3767.384) [-3765.452] (-3772.161) (-3767.735) -- 0:03:34
      93500 -- (-3770.431) (-3769.230) [-3771.119] (-3774.448) * (-3769.890) [-3766.962] (-3767.738) (-3769.389) -- 0:03:33
      94000 -- (-3771.104) (-3770.219) (-3769.235) [-3765.226] * [-3766.286] (-3768.562) (-3769.839) (-3770.366) -- 0:03:32
      94500 -- (-3766.744) [-3766.683] (-3778.801) (-3769.734) * (-3772.404) (-3766.532) (-3771.176) [-3764.198] -- 0:03:30
      95000 -- (-3766.905) (-3765.793) [-3767.964] (-3767.129) * (-3768.704) (-3770.415) (-3764.365) [-3765.022] -- 0:03:29

      Average standard deviation of split frequencies: 0.000000

      95500 -- (-3769.477) [-3766.802] (-3769.514) (-3763.994) * [-3769.744] (-3776.314) (-3767.504) (-3767.456) -- 0:03:28
      96000 -- (-3768.637) [-3767.724] (-3763.430) (-3765.884) * (-3766.055) [-3766.012] (-3771.290) (-3769.580) -- 0:03:36
      96500 -- (-3768.550) (-3766.566) [-3775.247] (-3764.778) * (-3769.085) (-3774.567) [-3766.715] (-3765.399) -- 0:03:35
      97000 -- (-3763.567) [-3768.975] (-3771.611) (-3768.475) * (-3768.270) (-3766.757) (-3765.254) [-3768.458] -- 0:03:34
      97500 -- (-3765.824) [-3765.454] (-3766.428) (-3769.749) * (-3769.175) (-3769.723) (-3769.259) [-3764.817] -- 0:03:32
      98000 -- [-3768.644] (-3772.421) (-3769.909) (-3770.812) * [-3772.602] (-3774.994) (-3768.824) (-3769.763) -- 0:03:31
      98500 -- (-3770.385) (-3768.930) (-3768.192) [-3765.283] * (-3768.832) [-3767.237] (-3768.190) (-3768.108) -- 0:03:30
      99000 -- [-3770.497] (-3765.242) (-3762.761) (-3772.527) * (-3775.695) (-3765.084) (-3761.309) [-3763.422] -- 0:03:29
      99500 -- (-3770.100) (-3772.320) (-3766.599) [-3768.075] * (-3765.908) (-3771.589) [-3762.672] (-3764.060) -- 0:03:28
      100000 -- (-3768.025) [-3769.425] (-3763.695) (-3772.705) * (-3765.285) (-3765.979) [-3764.870] (-3768.923) -- 0:03:36

      Average standard deviation of split frequencies: 0.000000

      100500 -- (-3769.458) (-3765.642) (-3772.525) [-3765.782] * (-3765.916) [-3763.444] (-3769.255) (-3768.895) -- 0:03:34
      101000 -- (-3768.866) (-3767.945) [-3766.890] (-3772.491) * (-3767.502) (-3764.864) (-3769.255) [-3768.155] -- 0:03:33
      101500 -- (-3766.665) [-3767.111] (-3770.136) (-3764.308) * (-3765.677) [-3765.081] (-3774.862) (-3770.388) -- 0:03:32
      102000 -- (-3771.471) (-3774.100) [-3767.055] (-3765.171) * (-3770.262) [-3767.369] (-3773.065) (-3771.387) -- 0:03:31
      102500 -- (-3783.144) (-3768.768) [-3764.632] (-3768.212) * (-3765.392) (-3774.733) (-3769.043) [-3771.325] -- 0:03:30
      103000 -- [-3766.208] (-3766.468) (-3770.055) (-3767.996) * [-3765.936] (-3770.939) (-3771.401) (-3770.392) -- 0:03:29
      103500 -- [-3764.383] (-3766.253) (-3767.329) (-3770.550) * (-3767.657) (-3766.311) (-3774.250) [-3764.331] -- 0:03:27
      104000 -- (-3767.470) (-3770.593) (-3765.371) [-3769.239] * [-3765.758] (-3767.541) (-3771.345) (-3773.645) -- 0:03:35
      104500 -- (-3769.651) [-3773.918] (-3765.965) (-3768.058) * (-3766.849) (-3766.606) [-3767.446] (-3773.867) -- 0:03:34
      105000 -- (-3773.360) (-3770.371) [-3764.026] (-3767.862) * (-3766.771) (-3772.327) (-3777.519) [-3769.291] -- 0:03:33

      Average standard deviation of split frequencies: 0.000000

      105500 -- (-3768.277) (-3775.601) (-3771.369) [-3767.555] * [-3771.766] (-3769.044) (-3776.331) (-3775.166) -- 0:03:31
      106000 -- (-3773.332) (-3765.830) [-3766.878] (-3775.658) * [-3776.843] (-3771.450) (-3767.160) (-3770.254) -- 0:03:30
      106500 -- [-3768.768] (-3766.979) (-3770.855) (-3773.493) * (-3773.181) (-3771.236) (-3764.812) [-3767.085] -- 0:03:29
      107000 -- (-3767.602) (-3766.471) [-3765.184] (-3770.890) * [-3768.324] (-3769.158) (-3766.824) (-3769.449) -- 0:03:28
      107500 -- [-3765.374] (-3774.698) (-3770.427) (-3771.286) * [-3765.071] (-3768.294) (-3772.510) (-3777.622) -- 0:03:27
      108000 -- (-3771.362) [-3769.456] (-3770.264) (-3775.095) * (-3769.709) (-3779.480) [-3765.222] (-3774.415) -- 0:03:34
      108500 -- (-3769.954) [-3771.800] (-3766.958) (-3765.357) * (-3769.074) (-3770.374) (-3765.123) [-3771.610] -- 0:03:33
      109000 -- (-3770.439) (-3769.758) (-3775.573) [-3770.669] * (-3762.629) (-3769.273) (-3765.944) [-3768.738] -- 0:03:32
      109500 -- (-3768.205) (-3767.633) (-3762.548) [-3764.820] * (-3764.076) (-3768.243) [-3766.912] (-3772.003) -- 0:03:31
      110000 -- [-3768.770] (-3769.040) (-3770.023) (-3762.800) * (-3772.607) (-3764.373) [-3766.190] (-3765.439) -- 0:03:30

      Average standard deviation of split frequencies: 0.000000

      110500 -- (-3764.687) (-3770.098) (-3766.529) [-3765.153] * (-3766.311) (-3764.428) [-3767.671] (-3766.408) -- 0:03:29
      111000 -- (-3767.105) [-3766.779] (-3770.618) (-3763.941) * (-3769.117) (-3768.543) (-3767.276) [-3766.179] -- 0:03:28
      111500 -- [-3771.164] (-3768.007) (-3774.075) (-3765.944) * (-3763.475) (-3767.319) [-3765.595] (-3769.357) -- 0:03:27
      112000 -- (-3778.322) [-3771.723] (-3770.776) (-3767.515) * [-3772.448] (-3767.457) (-3768.191) (-3775.568) -- 0:03:34
      112500 -- (-3772.402) [-3769.272] (-3774.833) (-3771.341) * [-3766.032] (-3763.774) (-3764.606) (-3773.179) -- 0:03:33
      113000 -- (-3769.006) (-3768.257) [-3768.356] (-3771.621) * (-3769.360) [-3768.881] (-3772.558) (-3771.378) -- 0:03:31
      113500 -- (-3768.009) (-3768.455) [-3768.570] (-3775.018) * [-3764.377] (-3771.172) (-3764.632) (-3773.442) -- 0:03:30
      114000 -- [-3766.457] (-3770.382) (-3763.626) (-3773.243) * (-3768.160) [-3775.198] (-3770.028) (-3767.619) -- 0:03:29
      114500 -- [-3770.641] (-3767.083) (-3766.163) (-3769.264) * [-3768.677] (-3770.296) (-3769.157) (-3771.821) -- 0:03:28
      115000 -- [-3767.277] (-3768.742) (-3771.684) (-3776.130) * (-3773.606) (-3766.181) [-3768.778] (-3770.046) -- 0:03:27

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-3767.188) (-3778.327) (-3769.563) [-3766.922] * (-3770.337) [-3765.428] (-3772.290) (-3771.740) -- 0:03:26
      116000 -- (-3769.219) (-3774.592) (-3773.208) [-3769.924] * (-3766.181) (-3764.762) [-3766.967] (-3770.269) -- 0:03:33
      116500 -- (-3768.730) [-3769.621] (-3768.488) (-3767.275) * (-3772.782) [-3765.644] (-3768.828) (-3778.154) -- 0:03:32
      117000 -- (-3776.424) [-3763.071] (-3765.898) (-3768.456) * (-3773.301) (-3764.579) [-3767.398] (-3775.567) -- 0:03:31
      117500 -- (-3775.027) (-3765.848) (-3766.161) [-3772.642] * (-3768.689) (-3765.502) [-3763.165] (-3779.161) -- 0:03:30
      118000 -- (-3774.056) (-3765.344) [-3769.396] (-3781.451) * (-3766.917) (-3767.356) [-3765.529] (-3777.207) -- 0:03:29
      118500 -- (-3768.651) [-3765.235] (-3770.735) (-3773.385) * (-3764.201) (-3768.478) [-3766.575] (-3770.681) -- 0:03:28
      119000 -- (-3775.163) [-3766.724] (-3775.887) (-3772.027) * (-3768.983) (-3768.982) [-3765.492] (-3766.446) -- 0:03:27
      119500 -- (-3776.722) [-3765.080] (-3775.881) (-3766.042) * [-3765.573] (-3772.994) (-3764.321) (-3766.870) -- 0:03:26
      120000 -- (-3769.639) (-3770.702) (-3767.803) [-3765.752] * (-3770.020) (-3770.003) [-3765.936] (-3766.074) -- 0:03:32

      Average standard deviation of split frequencies: 0.000000

      120500 -- (-3769.469) (-3772.064) [-3767.602] (-3764.613) * (-3766.662) [-3770.637] (-3765.482) (-3782.119) -- 0:03:31
      121000 -- (-3768.933) (-3774.161) [-3764.779] (-3761.659) * [-3763.221] (-3775.052) (-3768.212) (-3768.040) -- 0:03:30
      121500 -- (-3768.250) [-3768.876] (-3774.448) (-3771.337) * (-3765.172) (-3770.390) (-3765.405) [-3767.841] -- 0:03:29
      122000 -- (-3762.980) [-3764.437] (-3772.312) (-3769.529) * (-3768.774) (-3771.889) (-3767.192) [-3767.611] -- 0:03:28
      122500 -- (-3771.560) (-3764.584) [-3770.775] (-3767.228) * [-3771.705] (-3772.117) (-3772.754) (-3775.991) -- 0:03:27
      123000 -- [-3776.832] (-3769.658) (-3769.749) (-3774.643) * (-3771.042) (-3767.839) (-3771.604) [-3765.137] -- 0:03:26
      123500 -- [-3769.259] (-3776.220) (-3774.774) (-3776.785) * (-3766.579) (-3768.682) (-3774.097) [-3768.077] -- 0:03:25
      124000 -- [-3765.283] (-3774.867) (-3775.220) (-3770.028) * (-3769.365) (-3765.287) (-3775.156) [-3766.811] -- 0:03:24
      124500 -- (-3766.837) (-3770.391) [-3765.442] (-3772.176) * (-3764.120) (-3767.679) (-3774.243) [-3766.232] -- 0:03:30
      125000 -- (-3767.864) [-3764.286] (-3768.771) (-3769.211) * (-3768.430) [-3763.053] (-3777.508) (-3767.222) -- 0:03:30

      Average standard deviation of split frequencies: 0.000000

      125500 -- (-3769.691) (-3763.850) (-3770.446) [-3768.464] * (-3766.614) (-3763.519) (-3773.627) [-3766.321] -- 0:03:29
      126000 -- (-3775.307) (-3769.272) (-3771.952) [-3767.751] * (-3764.838) [-3765.447] (-3766.442) (-3768.908) -- 0:03:28
      126500 -- (-3766.789) (-3765.356) [-3766.967] (-3771.970) * (-3764.518) (-3771.270) [-3769.844] (-3769.050) -- 0:03:27
      127000 -- (-3770.743) [-3765.186] (-3767.158) (-3767.983) * (-3768.911) (-3776.041) [-3772.256] (-3765.237) -- 0:03:26
      127500 -- [-3763.683] (-3766.532) (-3769.766) (-3766.882) * (-3765.388) (-3769.406) [-3764.231] (-3772.117) -- 0:03:25
      128000 -- (-3762.350) (-3764.080) [-3774.464] (-3771.639) * (-3766.405) (-3770.393) [-3766.262] (-3768.707) -- 0:03:24
      128500 -- (-3769.912) (-3763.681) [-3769.855] (-3766.251) * (-3771.056) (-3761.801) [-3766.686] (-3764.636) -- 0:03:30
      129000 -- (-3778.336) (-3764.754) (-3769.182) [-3767.897] * (-3768.965) (-3767.442) [-3764.135] (-3765.637) -- 0:03:29
      129500 -- [-3763.978] (-3771.873) (-3764.604) (-3772.255) * (-3768.650) (-3770.129) (-3767.027) [-3763.162] -- 0:03:28
      130000 -- (-3769.550) (-3769.457) (-3769.206) [-3776.588] * (-3769.301) (-3767.059) (-3765.720) [-3769.192] -- 0:03:27

      Average standard deviation of split frequencies: 0.000000

      130500 -- (-3769.866) (-3766.837) [-3767.657] (-3775.521) * (-3770.069) [-3764.393] (-3769.662) (-3768.880) -- 0:03:26
      131000 -- (-3764.703) (-3770.006) [-3762.033] (-3766.667) * (-3770.652) (-3766.412) (-3768.397) [-3764.955] -- 0:03:25
      131500 -- (-3764.448) (-3766.062) (-3764.422) [-3769.194] * [-3769.646] (-3768.248) (-3765.723) (-3778.353) -- 0:03:24
      132000 -- (-3768.029) [-3765.968] (-3767.753) (-3768.604) * (-3776.049) (-3776.496) [-3767.806] (-3773.426) -- 0:03:23
      132500 -- (-3768.214) (-3762.078) [-3770.425] (-3769.171) * (-3770.357) (-3774.190) (-3772.307) [-3765.189] -- 0:03:29
      133000 -- (-3769.468) [-3766.357] (-3769.669) (-3766.130) * (-3764.849) (-3769.007) (-3773.338) [-3764.412] -- 0:03:28
      133500 -- (-3763.882) (-3766.580) (-3768.629) [-3762.978] * (-3770.654) (-3763.653) (-3773.267) [-3767.326] -- 0:03:27
      134000 -- (-3766.675) (-3764.309) (-3770.017) [-3761.040] * (-3773.459) (-3765.922) (-3770.694) [-3767.613] -- 0:03:26
      134500 -- [-3768.533] (-3763.986) (-3768.985) (-3767.372) * (-3764.654) (-3767.746) [-3772.535] (-3772.122) -- 0:03:25
      135000 -- (-3767.907) [-3768.886] (-3771.752) (-3769.998) * (-3765.061) (-3772.260) (-3766.950) [-3770.770] -- 0:03:25

      Average standard deviation of split frequencies: 0.000000

      135500 -- (-3768.943) [-3767.256] (-3775.808) (-3772.662) * (-3770.352) (-3766.400) [-3764.744] (-3764.623) -- 0:03:24
      136000 -- (-3766.463) (-3767.822) (-3768.127) [-3768.577] * (-3777.487) (-3766.910) [-3763.062] (-3770.359) -- 0:03:23
      136500 -- [-3772.501] (-3764.782) (-3770.329) (-3768.138) * (-3769.761) (-3770.919) [-3766.835] (-3765.943) -- 0:03:28
      137000 -- [-3769.896] (-3765.420) (-3768.210) (-3770.780) * (-3771.970) (-3764.872) [-3767.371] (-3774.086) -- 0:03:27
      137500 -- (-3769.715) (-3766.242) [-3762.458] (-3771.485) * (-3768.487) (-3766.604) [-3765.276] (-3773.555) -- 0:03:27
      138000 -- (-3771.825) (-3769.760) [-3766.750] (-3767.639) * (-3762.669) [-3766.463] (-3773.188) (-3764.942) -- 0:03:26
      138500 -- (-3775.692) (-3775.885) [-3765.092] (-3763.937) * (-3768.869) [-3765.799] (-3765.057) (-3775.696) -- 0:03:25
      139000 -- [-3766.338] (-3775.615) (-3771.473) (-3767.092) * (-3777.490) [-3763.156] (-3767.422) (-3774.708) -- 0:03:24
      139500 -- [-3774.178] (-3765.856) (-3766.115) (-3765.214) * (-3772.735) [-3764.461] (-3765.264) (-3772.404) -- 0:03:23
      140000 -- (-3770.019) [-3764.556] (-3768.256) (-3768.713) * [-3765.717] (-3768.529) (-3773.105) (-3771.521) -- 0:03:22

      Average standard deviation of split frequencies: 0.000000

      140500 -- [-3766.553] (-3767.402) (-3773.291) (-3766.786) * (-3767.719) (-3767.201) (-3771.740) [-3769.290] -- 0:03:21
      141000 -- (-3763.251) (-3770.476) (-3776.113) [-3774.352] * (-3774.992) [-3769.757] (-3765.478) (-3773.677) -- 0:03:27
      141500 -- (-3767.747) (-3771.408) (-3774.050) [-3769.449] * (-3765.371) (-3769.367) [-3765.241] (-3769.615) -- 0:03:26
      142000 -- [-3767.101] (-3768.193) (-3769.891) (-3771.635) * (-3769.620) [-3766.696] (-3767.713) (-3763.090) -- 0:03:25
      142500 -- (-3767.679) [-3766.031] (-3767.094) (-3768.783) * (-3766.831) (-3764.078) (-3771.912) [-3770.357] -- 0:03:24
      143000 -- [-3764.888] (-3767.263) (-3762.367) (-3765.654) * (-3764.997) [-3768.440] (-3768.626) (-3767.111) -- 0:03:23
      143500 -- (-3770.000) (-3767.491) [-3765.740] (-3767.081) * (-3762.357) (-3765.325) (-3767.302) [-3764.259] -- 0:03:22
      144000 -- [-3765.843] (-3766.554) (-3766.335) (-3769.289) * (-3765.409) (-3767.642) [-3772.461] (-3774.362) -- 0:03:22
      144500 -- (-3772.749) (-3776.132) (-3771.211) [-3763.923] * (-3764.152) (-3764.056) (-3769.009) [-3766.020] -- 0:03:21
      145000 -- (-3764.704) [-3771.871] (-3772.898) (-3765.345) * [-3764.741] (-3769.680) (-3770.309) (-3767.898) -- 0:03:26

      Average standard deviation of split frequencies: 0.000000

      145500 -- [-3767.413] (-3766.565) (-3772.803) (-3765.689) * (-3770.430) (-3765.636) [-3769.310] (-3773.020) -- 0:03:25
      146000 -- (-3767.089) (-3772.599) (-3770.059) [-3766.078] * (-3774.140) (-3772.277) (-3767.411) [-3765.274] -- 0:03:24
      146500 -- [-3767.559] (-3767.562) (-3765.738) (-3769.430) * (-3770.192) (-3768.256) (-3768.485) [-3767.231] -- 0:03:23
      147000 -- (-3763.765) [-3763.569] (-3772.431) (-3765.157) * (-3767.089) (-3771.298) [-3764.038] (-3768.927) -- 0:03:23
      147500 -- (-3766.916) (-3762.370) (-3769.722) [-3765.495] * (-3766.385) (-3768.502) (-3766.435) [-3763.673] -- 0:03:22
      148000 -- (-3770.300) (-3766.827) (-3773.083) [-3770.621] * (-3767.582) [-3768.955] (-3770.375) (-3768.567) -- 0:03:21
      148500 -- (-3774.237) (-3772.537) [-3770.258] (-3771.195) * (-3765.317) [-3767.690] (-3768.981) (-3761.805) -- 0:03:20
      149000 -- (-3779.323) [-3768.669] (-3768.916) (-3773.695) * (-3767.149) (-3770.499) (-3771.345) [-3764.220] -- 0:03:25
      149500 -- (-3770.460) (-3775.983) (-3763.975) [-3771.292] * (-3765.893) (-3771.104) (-3768.715) [-3765.619] -- 0:03:24
      150000 -- (-3765.941) (-3781.193) [-3768.809] (-3765.064) * [-3765.895] (-3768.911) (-3777.223) (-3769.072) -- 0:03:24

      Average standard deviation of split frequencies: 0.000000

      150500 -- (-3769.909) [-3767.365] (-3770.104) (-3764.502) * (-3771.894) [-3765.830] (-3767.735) (-3770.521) -- 0:03:23
      151000 -- (-3768.910) [-3765.983] (-3768.238) (-3768.312) * [-3763.116] (-3769.822) (-3769.318) (-3768.459) -- 0:03:22
      151500 -- (-3771.547) (-3772.030) (-3766.130) [-3764.052] * [-3762.837] (-3764.198) (-3767.669) (-3768.945) -- 0:03:21
      152000 -- (-3768.625) (-3762.271) (-3769.445) [-3767.993] * [-3765.042] (-3765.667) (-3769.893) (-3771.746) -- 0:03:20
      152500 -- [-3772.740] (-3767.171) (-3766.877) (-3769.638) * (-3767.261) (-3772.958) [-3767.963] (-3773.589) -- 0:03:20
      153000 -- (-3772.812) (-3768.365) [-3772.694] (-3771.502) * (-3767.745) (-3767.232) [-3775.084] (-3775.349) -- 0:03:24
      153500 -- (-3766.599) [-3761.725] (-3772.776) (-3777.125) * (-3766.526) [-3766.334] (-3769.323) (-3771.776) -- 0:03:24
      154000 -- (-3769.080) (-3766.841) [-3767.573] (-3765.782) * [-3770.517] (-3766.538) (-3766.724) (-3772.874) -- 0:03:23
      154500 -- [-3774.500] (-3771.153) (-3766.171) (-3769.772) * (-3773.579) [-3768.819] (-3767.606) (-3772.868) -- 0:03:22
      155000 -- [-3770.986] (-3764.390) (-3769.747) (-3766.911) * (-3770.427) (-3766.252) [-3761.828] (-3768.501) -- 0:03:21

      Average standard deviation of split frequencies: 0.000000

      155500 -- [-3769.833] (-3769.025) (-3767.447) (-3775.188) * (-3775.034) [-3768.613] (-3763.525) (-3777.258) -- 0:03:20
      156000 -- (-3773.484) (-3764.512) [-3768.163] (-3776.528) * [-3766.864] (-3769.584) (-3767.664) (-3773.334) -- 0:03:20
      156500 -- (-3771.054) (-3767.531) (-3770.383) [-3764.373] * (-3775.240) (-3769.397) [-3766.526] (-3765.612) -- 0:03:19
      157000 -- (-3763.321) (-3767.026) (-3762.828) [-3763.081] * (-3763.789) [-3765.335] (-3769.669) (-3769.276) -- 0:03:18
      157500 -- [-3770.773] (-3769.092) (-3766.163) (-3768.869) * (-3769.315) (-3764.126) (-3770.631) [-3770.166] -- 0:03:23
      158000 -- (-3772.380) (-3767.958) [-3766.628] (-3775.573) * (-3771.704) (-3780.560) [-3763.121] (-3773.977) -- 0:03:22
      158500 -- (-3764.042) [-3763.977] (-3767.261) (-3778.400) * [-3765.781] (-3766.054) (-3767.281) (-3775.458) -- 0:03:21
      159000 -- (-3771.561) [-3766.336] (-3767.657) (-3770.793) * (-3768.274) (-3769.767) [-3767.706] (-3770.678) -- 0:03:20
      159500 -- (-3770.155) [-3767.547] (-3769.481) (-3769.754) * (-3774.750) (-3767.791) [-3771.770] (-3770.607) -- 0:03:20
      160000 -- [-3771.434] (-3768.973) (-3768.225) (-3766.674) * (-3766.073) (-3771.109) (-3768.818) [-3773.898] -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

      160500 -- (-3775.594) (-3772.356) (-3765.552) [-3767.188] * (-3765.749) (-3771.803) (-3765.951) [-3772.099] -- 0:03:18
      161000 -- [-3766.969] (-3767.463) (-3768.921) (-3775.172) * (-3766.662) (-3767.819) [-3770.964] (-3769.597) -- 0:03:18
      161500 -- (-3766.786) (-3764.304) (-3764.093) [-3771.346] * (-3766.336) [-3769.232] (-3770.294) (-3770.028) -- 0:03:22
      162000 -- (-3768.378) [-3767.788] (-3768.987) (-3773.597) * [-3763.366] (-3768.947) (-3768.978) (-3770.247) -- 0:03:21
      162500 -- (-3768.798) [-3772.098] (-3766.238) (-3773.885) * (-3766.791) (-3771.999) (-3778.537) [-3769.220] -- 0:03:21
      163000 -- (-3767.880) (-3765.949) [-3763.821] (-3766.423) * (-3766.313) (-3773.080) (-3778.916) [-3768.432] -- 0:03:20
      163500 -- (-3774.451) (-3765.907) (-3765.483) [-3768.906] * (-3771.586) (-3772.573) (-3775.492) [-3769.966] -- 0:03:19
      164000 -- (-3766.214) [-3771.327] (-3764.278) (-3762.819) * [-3777.161] (-3768.770) (-3770.189) (-3766.284) -- 0:03:18
      164500 -- [-3768.408] (-3766.830) (-3764.822) (-3767.651) * [-3769.243] (-3772.544) (-3770.722) (-3769.254) -- 0:03:18
      165000 -- [-3765.781] (-3770.943) (-3777.460) (-3762.991) * (-3768.182) [-3768.543] (-3768.730) (-3765.947) -- 0:03:17

      Average standard deviation of split frequencies: 0.000000

      165500 -- [-3768.773] (-3769.807) (-3778.453) (-3772.015) * (-3771.887) (-3768.003) (-3769.368) [-3766.879] -- 0:03:21
      166000 -- (-3762.673) (-3770.759) (-3773.271) [-3766.681] * (-3769.660) [-3766.596] (-3766.018) (-3763.438) -- 0:03:20
      166500 -- (-3763.824) [-3770.576] (-3768.669) (-3766.308) * (-3779.911) (-3769.743) (-3768.297) [-3764.684] -- 0:03:20
      167000 -- (-3769.229) (-3775.663) (-3770.804) [-3761.956] * (-3773.901) (-3770.340) [-3767.707] (-3778.314) -- 0:03:19
      167500 -- (-3771.864) (-3774.938) (-3766.458) [-3766.521] * (-3767.624) (-3773.356) [-3766.402] (-3771.318) -- 0:03:18
      168000 -- (-3770.247) (-3766.588) (-3769.641) [-3770.858] * (-3766.708) (-3767.285) (-3771.544) [-3769.473] -- 0:03:18
      168500 -- (-3766.526) [-3767.653] (-3768.460) (-3774.193) * (-3765.851) (-3778.131) (-3773.475) [-3774.916] -- 0:03:17
      169000 -- (-3771.747) [-3768.780] (-3772.637) (-3771.958) * [-3765.980] (-3770.590) (-3774.958) (-3770.577) -- 0:03:16
      169500 -- (-3771.974) (-3768.085) [-3770.048] (-3767.630) * (-3770.532) [-3767.841] (-3779.663) (-3769.348) -- 0:03:20
      170000 -- (-3767.669) (-3764.307) (-3769.811) [-3765.967] * [-3768.389] (-3773.517) (-3772.912) (-3766.836) -- 0:03:20

      Average standard deviation of split frequencies: 0.000000

      170500 -- [-3766.269] (-3771.627) (-3777.547) (-3771.602) * (-3768.100) [-3770.481] (-3770.797) (-3773.761) -- 0:03:19
      171000 -- [-3770.704] (-3767.635) (-3774.893) (-3773.791) * (-3768.214) [-3767.939] (-3766.153) (-3768.788) -- 0:03:18
      171500 -- (-3773.771) (-3770.667) [-3766.443] (-3765.049) * (-3765.968) (-3767.277) (-3773.709) [-3766.363] -- 0:03:18
      172000 -- (-3766.637) [-3769.653] (-3771.140) (-3762.852) * (-3767.308) [-3766.430] (-3772.017) (-3766.871) -- 0:03:17
      172500 -- (-3764.918) (-3767.794) (-3769.900) [-3763.038] * (-3768.918) (-3765.468) (-3779.493) [-3766.933] -- 0:03:16
      173000 -- (-3766.506) (-3774.142) [-3773.650] (-3771.436) * [-3764.636] (-3769.789) (-3771.996) (-3767.375) -- 0:03:15
      173500 -- (-3772.684) (-3769.652) [-3768.296] (-3768.518) * [-3770.130] (-3768.569) (-3768.544) (-3764.801) -- 0:03:20
      174000 -- (-3767.400) [-3764.955] (-3777.892) (-3767.875) * (-3770.123) (-3766.772) (-3771.293) [-3762.772] -- 0:03:19
      174500 -- [-3765.274] (-3770.018) (-3771.976) (-3773.692) * (-3768.561) (-3766.851) (-3766.014) [-3770.572] -- 0:03:18
      175000 -- (-3765.832) [-3764.610] (-3773.080) (-3778.604) * (-3771.547) (-3767.815) [-3767.440] (-3770.459) -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      175500 -- (-3768.906) (-3765.921) (-3780.211) [-3769.151] * (-3765.330) (-3765.401) (-3764.338) [-3771.056] -- 0:03:17
      176000 -- (-3768.031) [-3764.084] (-3768.829) (-3775.435) * (-3766.854) (-3764.617) [-3767.267] (-3769.908) -- 0:03:16
      176500 -- (-3767.639) [-3763.661] (-3771.767) (-3769.728) * (-3772.478) (-3774.740) [-3763.697] (-3776.855) -- 0:03:15
      177000 -- (-3767.230) (-3769.531) [-3768.304] (-3773.419) * (-3763.313) (-3771.579) [-3769.257] (-3766.455) -- 0:03:15
      177500 -- (-3776.030) (-3766.714) (-3774.057) [-3771.232] * (-3769.711) (-3769.650) [-3768.594] (-3770.991) -- 0:03:14
      178000 -- (-3768.653) [-3766.653] (-3768.823) (-3769.991) * (-3768.956) (-3766.245) [-3766.356] (-3764.177) -- 0:03:18
      178500 -- [-3772.303] (-3766.966) (-3765.459) (-3770.094) * (-3767.593) [-3766.417] (-3777.009) (-3769.561) -- 0:03:17
      179000 -- [-3765.947] (-3767.396) (-3770.055) (-3771.385) * (-3767.763) [-3764.861] (-3773.082) (-3764.547) -- 0:03:17
      179500 -- [-3766.584] (-3771.349) (-3769.294) (-3775.921) * (-3767.554) (-3762.677) [-3766.085] (-3765.305) -- 0:03:16
      180000 -- (-3765.387) [-3767.325] (-3766.477) (-3768.839) * (-3763.301) (-3767.353) (-3771.116) [-3768.580] -- 0:03:15

      Average standard deviation of split frequencies: 0.000000

      180500 -- (-3764.789) (-3766.890) (-3765.647) [-3770.385] * (-3766.697) [-3767.985] (-3769.207) (-3772.219) -- 0:03:15
      181000 -- (-3768.704) (-3771.277) [-3767.883] (-3766.446) * (-3766.608) [-3762.845] (-3762.221) (-3775.432) -- 0:03:14
      181500 -- [-3766.552] (-3770.977) (-3774.414) (-3765.776) * (-3768.585) (-3768.051) [-3765.934] (-3767.991) -- 0:03:13
      182000 -- (-3768.905) [-3766.350] (-3775.517) (-3765.708) * (-3771.093) [-3764.371] (-3767.421) (-3766.009) -- 0:03:17
      182500 -- [-3764.834] (-3769.300) (-3767.008) (-3770.617) * (-3769.821) [-3766.176] (-3770.345) (-3766.667) -- 0:03:17
      183000 -- (-3765.050) [-3769.518] (-3763.817) (-3770.468) * [-3768.331] (-3768.927) (-3773.328) (-3763.803) -- 0:03:16
      183500 -- [-3766.539] (-3774.357) (-3766.511) (-3774.518) * (-3767.044) (-3766.877) [-3768.809] (-3774.795) -- 0:03:15
      184000 -- (-3772.054) (-3775.551) [-3766.163] (-3770.758) * (-3763.940) (-3771.603) [-3767.584] (-3769.530) -- 0:03:15
      184500 -- (-3765.187) [-3777.621] (-3765.872) (-3772.640) * (-3762.088) [-3767.157] (-3771.427) (-3776.693) -- 0:03:14
      185000 -- (-3765.562) (-3772.897) [-3768.867] (-3780.238) * (-3766.805) [-3776.525] (-3776.902) (-3771.260) -- 0:03:13

      Average standard deviation of split frequencies: 0.000000

      185500 -- (-3768.265) (-3765.905) [-3765.679] (-3773.425) * (-3770.605) (-3771.958) [-3773.201] (-3770.270) -- 0:03:13
      186000 -- [-3763.237] (-3770.230) (-3771.645) (-3775.429) * (-3765.016) [-3765.967] (-3768.378) (-3772.317) -- 0:03:16
      186500 -- (-3766.356) [-3766.791] (-3771.257) (-3768.652) * (-3769.817) (-3766.366) (-3769.335) [-3767.763] -- 0:03:16
      187000 -- (-3772.520) (-3763.635) [-3768.447] (-3768.605) * (-3767.981) [-3764.235] (-3770.634) (-3781.340) -- 0:03:15
      187500 -- (-3777.280) [-3765.353] (-3769.838) (-3771.864) * [-3766.489] (-3764.716) (-3766.679) (-3773.208) -- 0:03:15
      188000 -- (-3768.639) [-3768.468] (-3770.568) (-3767.125) * (-3774.015) (-3772.338) [-3766.694] (-3767.310) -- 0:03:14
      188500 -- (-3769.239) (-3765.401) [-3770.493] (-3769.650) * (-3769.459) (-3769.854) (-3771.716) [-3766.495] -- 0:03:13
      189000 -- [-3764.905] (-3768.167) (-3766.126) (-3763.679) * (-3772.130) [-3771.412] (-3767.949) (-3764.031) -- 0:03:13
      189500 -- (-3762.592) (-3774.261) (-3766.298) [-3769.115] * [-3763.369] (-3764.225) (-3769.675) (-3766.671) -- 0:03:12
      190000 -- (-3770.231) (-3769.906) (-3765.382) [-3767.756] * (-3766.848) (-3770.765) [-3764.164] (-3767.820) -- 0:03:16

      Average standard deviation of split frequencies: 0.000000

      190500 -- (-3770.067) (-3768.387) (-3775.270) [-3766.234] * (-3767.173) [-3770.201] (-3765.095) (-3765.783) -- 0:03:15
      191000 -- (-3767.439) [-3764.474] (-3766.290) (-3766.456) * (-3772.611) [-3766.432] (-3772.300) (-3762.217) -- 0:03:14
      191500 -- [-3769.610] (-3776.412) (-3762.837) (-3773.346) * (-3769.945) (-3765.627) [-3768.258] (-3770.120) -- 0:03:14
      192000 -- (-3770.609) [-3766.524] (-3769.747) (-3777.908) * [-3773.511] (-3764.886) (-3774.011) (-3768.238) -- 0:03:13
      192500 -- (-3769.445) (-3769.598) [-3767.079] (-3766.213) * (-3770.167) (-3766.363) [-3764.949] (-3770.893) -- 0:03:12
      193000 -- (-3765.939) (-3768.753) (-3769.027) [-3767.837] * [-3767.382] (-3778.010) (-3773.135) (-3767.194) -- 0:03:12
      193500 -- (-3763.300) (-3778.102) [-3767.512] (-3770.014) * (-3770.681) (-3769.613) (-3765.884) [-3772.571] -- 0:03:11
      194000 -- [-3768.525] (-3773.084) (-3766.514) (-3768.425) * (-3771.386) (-3767.031) [-3765.445] (-3770.950) -- 0:03:11
      194500 -- (-3769.164) (-3772.194) (-3766.565) [-3768.654] * (-3770.645) [-3766.886] (-3773.901) (-3769.271) -- 0:03:14
      195000 -- (-3770.133) (-3767.898) (-3774.723) [-3766.600] * (-3773.457) (-3765.666) (-3776.852) [-3768.150] -- 0:03:14

      Average standard deviation of split frequencies: 0.000000

      195500 -- (-3775.078) (-3766.667) (-3770.439) [-3766.252] * [-3770.564] (-3767.223) (-3769.597) (-3765.046) -- 0:03:13
      196000 -- (-3771.830) (-3766.628) (-3771.338) [-3764.094] * (-3766.001) (-3770.037) [-3769.826] (-3771.534) -- 0:03:12
      196500 -- (-3771.206) [-3764.286] (-3774.659) (-3766.894) * (-3767.023) [-3776.247] (-3765.645) (-3774.346) -- 0:03:12
      197000 -- (-3768.716) [-3764.102] (-3771.628) (-3768.783) * (-3765.884) (-3767.250) (-3766.345) [-3772.309] -- 0:03:11
      197500 -- [-3765.056] (-3770.346) (-3765.537) (-3769.690) * [-3764.128] (-3769.000) (-3772.336) (-3775.273) -- 0:03:10
      198000 -- [-3764.278] (-3771.998) (-3766.250) (-3770.791) * (-3765.633) (-3776.866) [-3770.148] (-3765.206) -- 0:03:10
      198500 -- (-3765.785) (-3767.693) [-3768.999] (-3769.439) * (-3764.388) (-3765.368) (-3764.616) [-3765.410] -- 0:03:13
      199000 -- [-3767.864] (-3767.649) (-3769.334) (-3772.631) * [-3765.926] (-3769.689) (-3766.906) (-3764.925) -- 0:03:13
      199500 -- (-3773.039) (-3771.109) [-3771.390] (-3766.822) * (-3773.662) (-3773.012) (-3773.839) [-3766.997] -- 0:03:12
      200000 -- (-3778.037) (-3770.572) [-3768.247] (-3769.043) * (-3765.630) (-3769.817) [-3776.035] (-3768.520) -- 0:03:12

      Average standard deviation of split frequencies: 0.000000

      200500 -- (-3771.637) (-3777.367) (-3771.999) [-3769.373] * (-3772.923) [-3768.142] (-3773.963) (-3764.523) -- 0:03:11
      201000 -- [-3769.806] (-3772.954) (-3768.819) (-3773.383) * [-3767.941] (-3774.332) (-3776.155) (-3769.966) -- 0:03:10
      201500 -- (-3768.481) (-3766.968) (-3766.295) [-3766.312] * (-3763.717) [-3770.046] (-3774.761) (-3772.951) -- 0:03:10
      202000 -- (-3766.211) [-3769.349] (-3770.195) (-3769.289) * (-3769.752) (-3767.767) [-3764.871] (-3767.584) -- 0:03:09
      202500 -- (-3771.813) [-3771.976] (-3772.271) (-3773.905) * [-3766.796] (-3770.176) (-3768.994) (-3768.648) -- 0:03:12
      203000 -- [-3775.752] (-3773.208) (-3775.889) (-3770.224) * (-3770.295) (-3769.598) (-3770.232) [-3767.361] -- 0:03:12
      203500 -- [-3769.819] (-3771.371) (-3773.816) (-3773.631) * (-3768.514) (-3773.243) (-3771.895) [-3768.202] -- 0:03:11
      204000 -- (-3769.050) (-3765.346) [-3767.242] (-3771.698) * [-3766.580] (-3767.897) (-3766.259) (-3766.481) -- 0:03:11
      204500 -- (-3770.210) (-3770.171) [-3770.805] (-3764.125) * (-3770.416) (-3766.160) [-3762.732] (-3768.211) -- 0:03:10
      205000 -- (-3770.718) (-3778.796) (-3768.908) [-3768.556] * (-3765.167) (-3771.269) [-3765.271] (-3766.004) -- 0:03:10

      Average standard deviation of split frequencies: 0.000000

      205500 -- (-3769.019) (-3771.072) (-3770.985) [-3772.617] * (-3765.634) [-3770.753] (-3769.903) (-3769.503) -- 0:03:09
      206000 -- (-3763.716) (-3769.762) [-3764.371] (-3772.863) * (-3768.199) (-3767.317) (-3768.418) [-3769.207] -- 0:03:08
      206500 -- [-3769.963] (-3770.611) (-3762.722) (-3771.668) * (-3765.095) (-3771.202) [-3767.602] (-3776.033) -- 0:03:08
      207000 -- [-3770.454] (-3768.832) (-3770.397) (-3764.153) * [-3766.406] (-3765.778) (-3768.129) (-3773.762) -- 0:03:11
      207500 -- [-3768.384] (-3766.874) (-3767.876) (-3766.589) * [-3763.994] (-3767.404) (-3766.564) (-3773.411) -- 0:03:10
      208000 -- (-3769.202) [-3763.902] (-3767.173) (-3767.049) * [-3762.323] (-3768.808) (-3771.632) (-3777.412) -- 0:03:10
      208500 -- (-3765.315) [-3763.137] (-3766.744) (-3770.990) * [-3768.468] (-3774.666) (-3768.576) (-3770.033) -- 0:03:09
      209000 -- [-3767.720] (-3774.242) (-3767.618) (-3763.080) * (-3773.409) (-3770.828) (-3774.944) [-3768.390] -- 0:03:09
      209500 -- (-3770.967) (-3764.980) [-3764.017] (-3771.197) * [-3774.520] (-3768.225) (-3764.329) (-3768.316) -- 0:03:08
      210000 -- [-3765.808] (-3766.294) (-3768.671) (-3769.009) * (-3767.041) (-3771.802) (-3768.965) [-3763.942] -- 0:03:08

      Average standard deviation of split frequencies: 0.000000

      210500 -- (-3765.661) [-3771.605] (-3769.611) (-3780.429) * (-3770.057) [-3768.401] (-3769.167) (-3764.044) -- 0:03:07
      211000 -- (-3766.483) (-3764.263) [-3770.500] (-3777.276) * (-3770.516) (-3772.887) (-3762.434) [-3763.265] -- 0:03:10
      211500 -- (-3767.426) [-3765.081] (-3769.380) (-3777.250) * (-3767.803) (-3768.746) [-3767.731] (-3766.637) -- 0:03:10
      212000 -- (-3774.381) [-3766.021] (-3776.852) (-3763.244) * (-3769.473) (-3774.105) [-3768.520] (-3766.500) -- 0:03:09
      212500 -- (-3773.485) (-3764.089) (-3766.644) [-3764.693] * (-3773.818) (-3770.869) (-3770.125) [-3766.167] -- 0:03:09
      213000 -- (-3772.832) [-3766.203] (-3773.038) (-3762.929) * (-3773.949) (-3771.582) [-3765.783] (-3764.838) -- 0:03:08
      213500 -- (-3769.394) [-3770.027] (-3771.664) (-3768.342) * (-3770.662) (-3766.056) (-3768.061) [-3769.084] -- 0:03:07
      214000 -- (-3768.850) [-3763.586] (-3764.193) (-3765.547) * (-3770.936) [-3767.127] (-3770.833) (-3769.042) -- 0:03:07
      214500 -- (-3774.810) [-3765.989] (-3766.471) (-3771.786) * (-3774.861) [-3776.698] (-3777.968) (-3764.604) -- 0:03:06
      215000 -- [-3772.965] (-3767.659) (-3771.884) (-3767.878) * (-3769.566) (-3770.250) [-3764.704] (-3769.280) -- 0:03:09

      Average standard deviation of split frequencies: 0.000000

      215500 -- (-3768.323) (-3767.594) [-3768.705] (-3769.322) * (-3775.623) (-3776.779) (-3767.251) [-3772.431] -- 0:03:09
      216000 -- (-3771.493) (-3768.455) [-3764.742] (-3772.482) * (-3768.806) (-3771.895) [-3766.064] (-3777.315) -- 0:03:08
      216500 -- (-3770.619) (-3769.882) (-3765.672) [-3767.803] * (-3764.249) [-3765.518] (-3769.300) (-3775.968) -- 0:03:08
      217000 -- (-3768.235) [-3763.899] (-3768.936) (-3778.791) * (-3768.613) (-3768.712) (-3772.792) [-3764.263] -- 0:03:07
      217500 -- (-3769.833) [-3765.430] (-3770.616) (-3774.142) * [-3764.292] (-3770.244) (-3766.421) (-3764.875) -- 0:03:07
      218000 -- (-3766.007) (-3779.092) (-3769.345) [-3767.582] * (-3768.209) (-3769.241) [-3766.900] (-3767.950) -- 0:03:06
      218500 -- (-3771.453) (-3769.000) [-3762.593] (-3769.089) * (-3772.780) (-3766.876) [-3767.035] (-3772.977) -- 0:03:05
      219000 -- (-3771.810) (-3766.090) [-3766.745] (-3765.951) * [-3768.338] (-3764.650) (-3770.753) (-3767.858) -- 0:03:09
      219500 -- (-3769.573) (-3766.018) [-3766.306] (-3768.458) * [-3771.704] (-3766.793) (-3772.919) (-3766.523) -- 0:03:08
      220000 -- (-3771.760) (-3773.143) [-3764.266] (-3773.399) * (-3766.271) (-3766.276) [-3766.449] (-3768.212) -- 0:03:07

      Average standard deviation of split frequencies: 0.000000

      220500 -- (-3768.391) (-3768.573) [-3774.012] (-3765.031) * (-3765.583) (-3767.126) (-3769.376) [-3766.661] -- 0:03:07
      221000 -- (-3766.133) (-3772.405) (-3771.081) [-3772.290] * (-3770.175) (-3764.098) [-3772.925] (-3769.289) -- 0:03:06
      221500 -- (-3769.672) [-3768.277] (-3768.077) (-3777.067) * [-3764.830] (-3765.949) (-3769.661) (-3767.098) -- 0:03:06
      222000 -- (-3767.361) (-3770.510) [-3770.628] (-3771.668) * (-3767.345) (-3768.775) [-3766.006] (-3764.206) -- 0:03:05
      222500 -- (-3770.294) (-3764.697) (-3771.333) [-3771.724] * (-3776.375) (-3765.274) (-3764.771) [-3769.237] -- 0:03:05
      223000 -- (-3762.352) (-3768.262) [-3764.178] (-3770.570) * (-3766.147) (-3765.940) [-3763.037] (-3765.948) -- 0:03:04
      223500 -- (-3768.673) [-3762.423] (-3771.286) (-3775.037) * (-3764.591) [-3766.706] (-3768.607) (-3764.608) -- 0:03:07
      224000 -- (-3767.737) [-3765.616] (-3769.838) (-3774.110) * (-3771.935) (-3772.884) [-3774.157] (-3766.577) -- 0:03:07
      224500 -- (-3770.566) (-3768.168) (-3767.970) [-3770.982] * (-3772.227) (-3766.162) [-3768.485] (-3764.780) -- 0:03:06
      225000 -- (-3772.748) (-3766.524) [-3766.213] (-3768.983) * (-3774.484) (-3774.358) (-3766.514) [-3767.653] -- 0:03:06

      Average standard deviation of split frequencies: 0.000000

      225500 -- [-3770.536] (-3769.021) (-3767.326) (-3767.275) * (-3772.958) (-3767.476) [-3771.607] (-3768.259) -- 0:03:05
      226000 -- (-3767.763) (-3769.993) (-3766.378) [-3764.997] * (-3769.440) (-3767.449) (-3765.723) [-3766.913] -- 0:03:04
      226500 -- (-3769.584) [-3765.103] (-3770.930) (-3769.187) * [-3768.382] (-3765.305) (-3766.058) (-3776.649) -- 0:03:04
      227000 -- (-3766.477) [-3771.429] (-3770.692) (-3772.327) * (-3763.784) (-3765.030) [-3766.383] (-3768.383) -- 0:03:03
      227500 -- (-3770.757) (-3770.030) (-3764.108) [-3765.807] * (-3770.394) (-3770.643) (-3770.026) [-3766.168] -- 0:03:06
      228000 -- (-3773.420) [-3767.710] (-3764.059) (-3765.333) * (-3772.944) (-3770.272) [-3766.052] (-3764.610) -- 0:03:06
      228500 -- (-3781.507) (-3766.426) (-3769.570) [-3768.293] * (-3770.721) (-3767.237) [-3763.091] (-3766.937) -- 0:03:05
      229000 -- [-3765.906] (-3761.815) (-3768.741) (-3770.823) * (-3766.671) (-3764.328) (-3762.039) [-3768.032] -- 0:03:05
      229500 -- (-3769.827) [-3767.395] (-3768.687) (-3765.668) * (-3774.475) (-3771.161) [-3775.842] (-3765.414) -- 0:03:04
      230000 -- [-3774.099] (-3772.484) (-3775.411) (-3767.779) * (-3768.771) (-3770.519) (-3770.273) [-3766.695] -- 0:03:04

      Average standard deviation of split frequencies: 0.000000

      230500 -- [-3766.208] (-3766.045) (-3764.536) (-3770.645) * (-3772.799) (-3776.274) (-3772.734) [-3766.843] -- 0:03:03
      231000 -- [-3764.394] (-3772.283) (-3765.788) (-3767.460) * (-3774.865) (-3772.946) (-3767.126) [-3766.545] -- 0:03:03
      231500 -- [-3766.258] (-3774.024) (-3775.674) (-3764.073) * (-3767.590) (-3774.065) (-3766.978) [-3762.313] -- 0:03:05
      232000 -- (-3764.138) (-3767.778) [-3770.202] (-3772.358) * [-3770.240] (-3773.199) (-3763.520) (-3765.465) -- 0:03:05
      232500 -- [-3765.915] (-3770.583) (-3766.270) (-3766.081) * (-3767.203) (-3767.371) [-3764.179] (-3767.196) -- 0:03:04
      233000 -- (-3767.716) (-3765.702) (-3770.144) [-3764.427] * (-3768.454) (-3771.544) [-3768.605] (-3770.319) -- 0:03:04
      233500 -- (-3764.481) (-3766.860) (-3772.912) [-3766.889] * (-3768.074) (-3774.855) [-3762.996] (-3769.499) -- 0:03:03
      234000 -- (-3766.420) [-3767.026] (-3776.765) (-3769.741) * (-3767.896) [-3769.346] (-3768.039) (-3766.551) -- 0:03:03
      234500 -- [-3767.088] (-3770.824) (-3768.762) (-3765.056) * (-3767.288) [-3767.585] (-3768.104) (-3766.958) -- 0:03:02
      235000 -- (-3775.141) [-3763.849] (-3767.351) (-3765.906) * (-3766.796) [-3764.633] (-3772.630) (-3767.255) -- 0:03:02

      Average standard deviation of split frequencies: 0.000000

      235500 -- (-3785.593) [-3764.839] (-3766.053) (-3775.478) * (-3764.754) (-3769.388) [-3772.770] (-3768.249) -- 0:03:05
      236000 -- (-3771.036) (-3767.328) [-3763.107] (-3772.733) * (-3771.521) (-3766.667) [-3765.867] (-3769.646) -- 0:03:04
      236500 -- (-3768.843) (-3766.389) [-3766.556] (-3766.366) * (-3769.910) (-3772.549) (-3767.381) [-3771.033] -- 0:03:04
      237000 -- (-3769.277) [-3768.997] (-3773.743) (-3767.041) * (-3765.998) [-3769.388] (-3770.410) (-3770.665) -- 0:03:03
      237500 -- (-3771.174) (-3766.333) (-3771.311) [-3761.494] * (-3769.818) (-3761.750) (-3768.380) [-3775.610] -- 0:03:03
      238000 -- [-3770.855] (-3767.299) (-3764.744) (-3770.625) * (-3770.124) (-3766.728) [-3767.821] (-3771.403) -- 0:03:02
      238500 -- (-3773.113) [-3768.922] (-3766.804) (-3768.013) * (-3767.701) (-3763.958) [-3770.985] (-3768.059) -- 0:03:01
      239000 -- [-3768.527] (-3769.698) (-3764.076) (-3772.643) * (-3768.047) [-3764.795] (-3772.558) (-3765.057) -- 0:03:01
      239500 -- [-3765.588] (-3768.802) (-3768.265) (-3774.527) * (-3769.954) (-3768.631) [-3765.982] (-3763.988) -- 0:03:00
      240000 -- (-3766.134) (-3765.167) (-3767.360) [-3772.179] * (-3766.963) (-3777.671) (-3766.881) [-3766.043] -- 0:03:03

      Average standard deviation of split frequencies: 0.000000

      240500 -- (-3775.379) (-3768.735) [-3766.500] (-3766.362) * (-3767.816) [-3767.048] (-3766.604) (-3766.346) -- 0:03:03
      241000 -- (-3770.996) [-3764.734] (-3770.519) (-3767.725) * (-3767.038) (-3766.058) [-3766.595] (-3769.789) -- 0:03:02
      241500 -- (-3776.795) [-3769.554] (-3768.398) (-3766.580) * (-3766.863) [-3767.892] (-3774.817) (-3776.484) -- 0:03:02
      242000 -- (-3772.936) [-3766.409] (-3774.638) (-3768.272) * (-3764.558) [-3765.327] (-3767.703) (-3774.318) -- 0:03:01
      242500 -- (-3767.935) (-3768.411) (-3772.229) [-3765.602] * (-3770.913) [-3767.860] (-3767.220) (-3765.607) -- 0:03:01
      243000 -- (-3771.191) [-3766.785] (-3769.790) (-3767.994) * (-3769.242) (-3763.665) (-3774.363) [-3766.914] -- 0:03:00
      243500 -- [-3765.295] (-3771.902) (-3766.636) (-3767.679) * (-3775.239) [-3767.073] (-3777.416) (-3767.382) -- 0:03:00
      244000 -- (-3766.378) (-3771.735) [-3769.455] (-3766.768) * (-3777.468) (-3770.253) (-3772.870) [-3762.909] -- 0:03:02
      244500 -- (-3768.798) [-3770.946] (-3771.838) (-3766.618) * (-3771.388) (-3769.282) [-3768.218] (-3769.680) -- 0:03:02
      245000 -- (-3765.264) (-3767.198) [-3772.318] (-3770.294) * (-3768.978) (-3764.911) (-3766.395) [-3769.943] -- 0:03:01

      Average standard deviation of split frequencies: 0.000000

      245500 -- (-3768.320) [-3766.801] (-3768.742) (-3764.673) * [-3766.595] (-3764.633) (-3770.917) (-3768.686) -- 0:03:01
      246000 -- [-3766.699] (-3765.612) (-3764.386) (-3763.316) * (-3766.994) (-3773.641) (-3773.221) [-3768.421] -- 0:03:00
      246500 -- (-3768.619) (-3772.934) (-3767.401) [-3767.934] * (-3769.811) [-3775.818] (-3771.057) (-3776.805) -- 0:03:00
      247000 -- (-3778.954) [-3766.797] (-3767.307) (-3770.041) * [-3767.755] (-3770.413) (-3774.321) (-3772.522) -- 0:02:59
      247500 -- (-3780.609) (-3765.008) [-3763.836] (-3768.229) * (-3764.768) (-3770.985) (-3770.508) [-3766.653] -- 0:02:59
      248000 -- (-3775.306) (-3769.617) (-3764.132) [-3767.335] * [-3763.505] (-3765.161) (-3766.814) (-3767.494) -- 0:03:01
      248500 -- (-3771.262) (-3775.013) [-3764.908] (-3768.489) * [-3772.877] (-3765.796) (-3764.404) (-3771.144) -- 0:03:01
      249000 -- (-3772.895) [-3770.843] (-3763.930) (-3767.746) * (-3763.318) (-3771.041) [-3765.664] (-3772.708) -- 0:03:00
      249500 -- (-3765.637) (-3770.809) [-3765.324] (-3764.383) * (-3775.281) [-3765.800] (-3770.166) (-3770.290) -- 0:03:00
      250000 -- [-3768.774] (-3771.774) (-3772.405) (-3772.288) * (-3773.121) [-3768.630] (-3767.636) (-3768.641) -- 0:03:00

      Average standard deviation of split frequencies: 0.000000

      250500 -- (-3777.339) (-3771.997) [-3768.265] (-3764.054) * (-3772.465) [-3764.273] (-3770.427) (-3770.517) -- 0:02:59
      251000 -- (-3769.996) (-3767.435) (-3766.246) [-3767.547] * (-3773.973) (-3774.779) (-3765.803) [-3764.962] -- 0:02:59
      251500 -- [-3763.406] (-3766.494) (-3764.734) (-3769.231) * (-3770.919) (-3765.799) [-3772.924] (-3775.605) -- 0:02:58
      252000 -- (-3771.907) (-3763.959) [-3770.714] (-3776.856) * (-3765.757) (-3765.446) [-3768.518] (-3772.791) -- 0:02:58
      252500 -- (-3776.915) [-3772.644] (-3769.933) (-3765.221) * (-3769.181) [-3766.001] (-3772.015) (-3763.736) -- 0:03:00
      253000 -- [-3769.803] (-3767.979) (-3770.710) (-3771.717) * (-3772.583) [-3768.307] (-3772.006) (-3767.831) -- 0:03:00
      253500 -- (-3766.523) (-3768.225) [-3767.087] (-3767.912) * [-3768.799] (-3771.761) (-3773.266) (-3771.361) -- 0:02:59
      254000 -- (-3765.056) (-3764.580) (-3774.533) [-3766.310] * (-3772.185) (-3767.060) (-3766.479) [-3775.181] -- 0:02:59
      254500 -- (-3779.507) [-3767.609] (-3770.637) (-3773.000) * (-3770.592) (-3765.436) [-3765.041] (-3773.075) -- 0:02:58
      255000 -- [-3769.572] (-3764.084) (-3770.072) (-3763.591) * [-3765.596] (-3773.105) (-3766.416) (-3769.402) -- 0:02:58

      Average standard deviation of split frequencies: 0.000000

      255500 -- (-3772.341) (-3768.508) (-3768.048) [-3766.337] * (-3766.335) (-3772.443) (-3766.422) [-3769.943] -- 0:02:57
      256000 -- (-3767.821) (-3765.772) [-3767.670] (-3762.943) * [-3771.704] (-3770.624) (-3774.172) (-3771.688) -- 0:02:57
      256500 -- (-3765.582) (-3770.145) [-3769.769] (-3765.150) * [-3767.832] (-3768.707) (-3767.078) (-3770.451) -- 0:02:59
      257000 -- [-3765.901] (-3774.886) (-3771.401) (-3768.048) * (-3766.160) [-3773.746] (-3771.892) (-3772.166) -- 0:02:59
      257500 -- (-3764.331) [-3765.368] (-3772.311) (-3768.974) * [-3770.547] (-3765.625) (-3777.337) (-3773.106) -- 0:02:58
      258000 -- (-3767.622) (-3766.305) (-3768.525) [-3770.374] * (-3771.847) [-3766.556] (-3768.718) (-3769.168) -- 0:02:58
      258500 -- (-3770.946) (-3768.796) [-3766.384] (-3764.948) * [-3765.796] (-3762.270) (-3772.298) (-3765.984) -- 0:02:57
      259000 -- (-3766.324) [-3769.336] (-3771.794) (-3768.388) * [-3774.697] (-3766.025) (-3767.061) (-3769.978) -- 0:02:57
      259500 -- (-3768.119) (-3772.248) [-3770.859] (-3770.571) * (-3771.552) (-3767.753) [-3769.189] (-3771.175) -- 0:02:56
      260000 -- (-3764.139) (-3775.943) (-3769.013) [-3767.071] * (-3769.673) (-3766.391) (-3777.197) [-3768.807] -- 0:02:56

      Average standard deviation of split frequencies: 0.000000

      260500 -- (-3766.328) [-3766.622] (-3771.061) (-3767.198) * (-3767.380) (-3770.153) (-3774.148) [-3767.553] -- 0:02:58
      261000 -- (-3767.415) (-3765.762) (-3774.396) [-3769.370] * (-3768.896) [-3768.136] (-3768.479) (-3767.292) -- 0:02:58
      261500 -- (-3769.202) [-3770.236] (-3771.170) (-3773.100) * (-3766.714) [-3766.274] (-3771.345) (-3762.612) -- 0:02:57
      262000 -- (-3767.480) (-3767.460) [-3765.679] (-3771.132) * [-3767.292] (-3764.366) (-3770.915) (-3771.462) -- 0:02:57
      262500 -- (-3771.464) (-3769.008) [-3772.925] (-3767.937) * (-3764.999) (-3768.460) [-3770.126] (-3773.327) -- 0:02:57
      263000 -- (-3767.929) [-3768.215] (-3773.099) (-3772.352) * [-3763.666] (-3772.746) (-3767.398) (-3767.929) -- 0:02:56
      263500 -- [-3765.512] (-3766.787) (-3777.210) (-3769.525) * (-3769.570) (-3764.034) (-3772.517) [-3769.201] -- 0:02:56
      264000 -- (-3767.139) [-3771.094] (-3770.745) (-3769.134) * (-3772.227) [-3763.396] (-3773.111) (-3765.698) -- 0:02:55
      264500 -- (-3768.666) [-3765.802] (-3771.950) (-3769.114) * [-3765.191] (-3765.369) (-3764.817) (-3768.167) -- 0:02:57
      265000 -- (-3764.815) (-3765.010) (-3767.131) [-3769.311] * (-3763.609) (-3776.972) (-3773.861) [-3769.956] -- 0:02:57

      Average standard deviation of split frequencies: 0.000000

      265500 -- (-3773.997) (-3767.565) (-3768.794) [-3767.569] * [-3766.535] (-3765.423) (-3773.887) (-3766.542) -- 0:02:57
      266000 -- (-3768.100) [-3767.001] (-3765.025) (-3770.811) * [-3764.415] (-3770.377) (-3769.727) (-3767.978) -- 0:02:56
      266500 -- (-3766.104) (-3765.281) (-3774.652) [-3769.984] * (-3764.637) (-3769.856) [-3764.542] (-3762.616) -- 0:02:56
      267000 -- (-3767.028) (-3773.271) (-3771.074) [-3768.445] * (-3762.413) (-3766.122) (-3765.587) [-3765.834] -- 0:02:55
      267500 -- (-3773.522) [-3765.084] (-3770.342) (-3770.806) * (-3767.643) (-3769.677) [-3762.707] (-3766.618) -- 0:02:55
      268000 -- [-3767.543] (-3768.943) (-3766.008) (-3772.085) * (-3771.791) [-3767.732] (-3770.758) (-3765.836) -- 0:02:54
      268500 -- (-3769.300) (-3768.482) [-3769.509] (-3764.372) * [-3765.672] (-3768.225) (-3768.145) (-3767.449) -- 0:02:54
      269000 -- (-3768.736) [-3776.658] (-3770.491) (-3774.375) * [-3767.584] (-3767.422) (-3771.814) (-3770.146) -- 0:02:56
      269500 -- (-3769.818) [-3764.915] (-3767.602) (-3772.179) * (-3778.598) [-3765.889] (-3771.848) (-3771.698) -- 0:02:56
      270000 -- (-3771.488) [-3764.128] (-3766.804) (-3770.016) * (-3770.871) (-3772.778) [-3763.913] (-3772.570) -- 0:02:55

      Average standard deviation of split frequencies: 0.000000

      270500 -- (-3760.761) [-3765.663] (-3777.022) (-3770.086) * (-3767.867) (-3768.316) (-3765.194) [-3768.622] -- 0:02:55
      271000 -- (-3769.627) (-3769.957) [-3767.262] (-3768.614) * (-3770.549) (-3765.871) (-3770.252) [-3764.698] -- 0:02:54
      271500 -- (-3772.239) (-3765.549) (-3772.713) [-3769.632] * (-3773.709) (-3764.432) (-3765.205) [-3766.982] -- 0:02:54
      272000 -- (-3774.257) (-3767.272) (-3777.736) [-3767.462] * (-3771.657) (-3764.786) [-3765.413] (-3765.987) -- 0:02:53
      272500 -- (-3768.492) (-3772.654) [-3765.434] (-3766.405) * (-3770.166) (-3771.273) [-3767.205] (-3767.106) -- 0:02:53
      273000 -- (-3765.845) [-3765.443] (-3775.013) (-3768.540) * (-3762.963) (-3773.783) (-3772.764) [-3765.073] -- 0:02:55
      273500 -- (-3767.122) (-3768.466) [-3768.086] (-3768.343) * (-3764.342) (-3782.024) (-3766.429) [-3769.334] -- 0:02:55
      274000 -- (-3770.418) (-3767.716) (-3769.273) [-3768.111] * [-3764.037] (-3772.649) (-3766.676) (-3768.537) -- 0:02:54
      274500 -- (-3769.601) (-3765.191) (-3766.261) [-3769.601] * [-3769.336] (-3771.545) (-3771.827) (-3774.865) -- 0:02:54
      275000 -- [-3765.188] (-3764.776) (-3770.245) (-3768.612) * [-3764.496] (-3768.983) (-3772.130) (-3764.030) -- 0:02:54

      Average standard deviation of split frequencies: 0.000000

      275500 -- (-3772.900) (-3769.965) [-3768.777] (-3770.108) * (-3766.155) (-3765.903) [-3768.735] (-3773.056) -- 0:02:53
      276000 -- (-3771.181) (-3764.884) [-3768.881] (-3768.215) * [-3767.043] (-3772.194) (-3763.275) (-3764.163) -- 0:02:53
      276500 -- (-3771.907) (-3768.127) (-3767.597) [-3764.678] * (-3768.616) (-3773.455) (-3767.438) [-3766.536] -- 0:02:52
      277000 -- (-3772.408) [-3773.748] (-3771.972) (-3766.711) * (-3769.164) (-3771.440) [-3767.074] (-3768.147) -- 0:02:54
      277500 -- (-3767.262) [-3776.518] (-3767.667) (-3770.002) * (-3766.527) (-3765.515) (-3770.737) [-3769.757] -- 0:02:54
      278000 -- (-3770.495) (-3774.101) (-3768.803) [-3772.318] * (-3764.231) (-3772.312) [-3770.433] (-3770.562) -- 0:02:54
      278500 -- (-3762.908) (-3768.236) [-3765.676] (-3768.781) * (-3762.896) (-3765.332) (-3770.521) [-3771.294] -- 0:02:53
      279000 -- (-3764.364) (-3778.274) [-3769.994] (-3770.230) * (-3764.267) (-3767.729) (-3766.728) [-3766.981] -- 0:02:53
      279500 -- (-3765.261) (-3776.461) [-3770.290] (-3764.739) * (-3768.872) [-3770.721] (-3774.287) (-3767.163) -- 0:02:52
      280000 -- [-3765.644] (-3773.089) (-3767.620) (-3769.880) * (-3776.281) (-3766.538) (-3770.523) [-3767.527] -- 0:02:52

      Average standard deviation of split frequencies: 0.000000

      280500 -- [-3766.491] (-3772.215) (-3771.464) (-3766.355) * [-3768.441] (-3764.393) (-3768.916) (-3764.542) -- 0:02:51
      281000 -- (-3770.450) [-3771.176] (-3771.381) (-3770.161) * [-3765.813] (-3766.454) (-3770.259) (-3768.976) -- 0:02:53
      281500 -- (-3776.062) [-3770.434] (-3769.031) (-3773.886) * (-3767.839) (-3776.813) (-3778.334) [-3765.854] -- 0:02:53
      282000 -- (-3772.392) [-3770.868] (-3767.357) (-3769.634) * (-3762.947) (-3775.679) (-3764.343) [-3765.674] -- 0:02:53
      282500 -- (-3766.984) (-3770.554) (-3763.361) [-3766.579] * [-3766.843] (-3761.517) (-3766.301) (-3768.603) -- 0:02:52
      283000 -- (-3771.752) (-3774.529) [-3764.297] (-3765.500) * (-3768.423) [-3764.114] (-3770.565) (-3768.293) -- 0:02:52
      283500 -- (-3764.369) [-3774.047] (-3773.210) (-3769.179) * (-3770.404) [-3764.492] (-3769.426) (-3770.852) -- 0:02:51
      284000 -- (-3766.690) (-3765.870) (-3765.937) [-3767.531] * [-3767.286] (-3771.178) (-3767.900) (-3772.988) -- 0:02:51
      284500 -- (-3766.097) [-3763.292] (-3766.110) (-3768.730) * (-3770.937) (-3773.495) (-3765.753) [-3765.359] -- 0:02:51
      285000 -- (-3772.009) [-3769.582] (-3772.956) (-3761.982) * (-3770.853) (-3770.023) (-3764.931) [-3766.264] -- 0:02:53

      Average standard deviation of split frequencies: 0.000000

      285500 -- (-3768.265) [-3763.661] (-3768.977) (-3766.989) * [-3769.584] (-3771.745) (-3765.741) (-3771.022) -- 0:02:52
      286000 -- (-3765.340) [-3767.407] (-3763.092) (-3764.441) * (-3768.435) (-3771.089) [-3764.395] (-3778.680) -- 0:02:52
      286500 -- (-3769.260) (-3765.304) (-3765.604) [-3768.751] * [-3771.207] (-3768.075) (-3770.907) (-3780.822) -- 0:02:51
      287000 -- (-3772.024) (-3765.121) [-3763.198] (-3765.516) * (-3766.802) [-3765.608] (-3771.536) (-3773.664) -- 0:02:51
      287500 -- (-3765.015) (-3767.231) (-3771.669) [-3771.991] * [-3769.637] (-3777.350) (-3764.902) (-3774.867) -- 0:02:51
      288000 -- [-3768.746] (-3768.223) (-3769.737) (-3765.159) * (-3767.941) [-3767.181] (-3767.971) (-3768.443) -- 0:02:50
      288500 -- (-3766.123) (-3768.897) [-3768.462] (-3771.104) * (-3768.855) (-3768.399) [-3766.151] (-3775.389) -- 0:02:50
      289000 -- (-3768.890) (-3770.566) (-3767.816) [-3767.834] * [-3765.250] (-3768.754) (-3768.101) (-3776.461) -- 0:02:52
      289500 -- [-3769.873] (-3762.546) (-3766.106) (-3770.209) * (-3769.006) [-3768.584] (-3776.942) (-3765.599) -- 0:02:51
      290000 -- (-3772.879) (-3769.412) (-3766.091) [-3768.020] * (-3767.823) (-3766.311) [-3770.305] (-3767.308) -- 0:02:51

      Average standard deviation of split frequencies: 0.000000

      290500 -- (-3777.528) (-3763.859) [-3773.749] (-3765.182) * [-3767.109] (-3769.963) (-3765.894) (-3773.700) -- 0:02:50
      291000 -- (-3771.949) (-3768.093) [-3762.902] (-3763.876) * [-3765.629] (-3766.279) (-3778.285) (-3769.449) -- 0:02:50
      291500 -- [-3769.603] (-3767.444) (-3765.886) (-3765.693) * (-3766.398) [-3765.591] (-3766.470) (-3765.204) -- 0:02:50
      292000 -- [-3768.294] (-3774.507) (-3768.167) (-3767.790) * [-3769.687] (-3768.792) (-3776.992) (-3766.812) -- 0:02:49
      292500 -- [-3768.065] (-3770.648) (-3763.228) (-3771.679) * (-3768.235) (-3771.197) [-3767.107] (-3769.928) -- 0:02:49
      293000 -- [-3768.860] (-3768.988) (-3765.586) (-3764.945) * [-3770.227] (-3772.177) (-3771.435) (-3766.012) -- 0:02:48
      293500 -- [-3767.468] (-3766.724) (-3772.531) (-3770.669) * (-3766.854) (-3779.420) [-3764.735] (-3766.875) -- 0:02:50
      294000 -- [-3766.983] (-3777.869) (-3772.772) (-3766.245) * (-3765.742) (-3762.463) [-3765.637] (-3765.567) -- 0:02:50
      294500 -- [-3766.174] (-3772.127) (-3764.977) (-3768.937) * (-3773.200) [-3762.998] (-3767.876) (-3764.517) -- 0:02:50
      295000 -- [-3761.214] (-3766.803) (-3769.706) (-3771.057) * (-3777.277) (-3764.822) (-3767.979) [-3768.913] -- 0:02:49

      Average standard deviation of split frequencies: 0.000000

      295500 -- (-3763.136) (-3765.943) (-3768.908) [-3768.183] * (-3768.737) (-3766.388) [-3766.704] (-3765.903) -- 0:02:49
      296000 -- (-3767.574) (-3768.200) [-3766.217] (-3764.710) * [-3766.038] (-3768.073) (-3763.322) (-3766.010) -- 0:02:48
      296500 -- (-3765.786) (-3772.538) [-3770.851] (-3773.193) * (-3776.247) (-3769.243) [-3769.632] (-3770.046) -- 0:02:48
      297000 -- (-3776.340) [-3766.517] (-3774.754) (-3768.258) * (-3767.789) (-3767.930) [-3765.591] (-3770.148) -- 0:02:48
      297500 -- (-3765.540) (-3771.329) (-3765.639) [-3765.012] * [-3764.251] (-3766.881) (-3768.576) (-3772.215) -- 0:02:50
      298000 -- (-3766.868) (-3767.555) (-3766.471) [-3766.025] * (-3770.544) (-3766.568) [-3765.866] (-3767.606) -- 0:02:49
      298500 -- [-3769.493] (-3769.387) (-3770.706) (-3768.672) * (-3783.310) (-3767.489) [-3768.214] (-3767.563) -- 0:02:49
      299000 -- (-3767.561) (-3764.901) (-3772.189) [-3772.385] * (-3770.942) [-3769.678] (-3774.487) (-3773.565) -- 0:02:48
      299500 -- [-3765.652] (-3771.238) (-3777.282) (-3770.151) * (-3771.281) [-3765.495] (-3769.660) (-3766.716) -- 0:02:48
      300000 -- (-3765.584) (-3762.068) (-3771.278) [-3771.681] * (-3771.771) (-3764.596) [-3762.029] (-3773.157) -- 0:02:48

      Average standard deviation of split frequencies: 0.000000

      300500 -- (-3767.771) [-3768.283] (-3772.774) (-3773.334) * [-3764.899] (-3772.675) (-3768.575) (-3767.025) -- 0:02:47
      301000 -- (-3768.520) (-3766.031) (-3772.411) [-3767.652] * (-3766.746) [-3768.870] (-3777.369) (-3770.471) -- 0:02:47
      301500 -- (-3774.696) (-3769.805) (-3765.085) [-3766.900] * (-3765.627) (-3767.936) (-3765.592) [-3768.578] -- 0:02:49
      302000 -- [-3768.219] (-3778.370) (-3764.111) (-3764.446) * (-3765.524) (-3765.966) [-3764.853] (-3768.640) -- 0:02:48
      302500 -- [-3767.157] (-3773.763) (-3766.002) (-3769.625) * [-3770.262] (-3765.480) (-3764.957) (-3768.578) -- 0:02:48
      303000 -- (-3766.522) (-3770.924) (-3770.873) [-3766.943] * (-3768.103) (-3767.313) (-3772.620) [-3767.249] -- 0:02:47
      303500 -- (-3767.503) (-3770.629) (-3767.170) [-3770.215] * [-3766.435] (-3771.907) (-3765.699) (-3770.571) -- 0:02:47
      304000 -- (-3775.586) [-3774.089] (-3765.869) (-3769.788) * (-3772.863) [-3765.706] (-3771.848) (-3769.391) -- 0:02:47
      304500 -- (-3770.006) (-3770.617) [-3768.333] (-3771.667) * [-3767.896] (-3766.216) (-3775.896) (-3765.386) -- 0:02:46
      305000 -- (-3771.693) [-3763.800] (-3765.937) (-3771.893) * (-3769.186) (-3772.863) [-3766.803] (-3764.650) -- 0:02:46

      Average standard deviation of split frequencies: 0.000000

      305500 -- [-3773.183] (-3769.320) (-3764.811) (-3778.879) * [-3764.935] (-3768.196) (-3770.789) (-3769.207) -- 0:02:48
      306000 -- (-3772.100) (-3776.889) [-3766.115] (-3771.683) * (-3766.844) (-3767.035) (-3768.006) [-3767.990] -- 0:02:47
      306500 -- (-3769.023) [-3769.712] (-3765.893) (-3771.845) * (-3767.371) (-3768.168) [-3766.564] (-3770.543) -- 0:02:47
      307000 -- (-3763.199) (-3770.062) [-3768.140] (-3776.637) * [-3764.939] (-3768.156) (-3766.536) (-3769.637) -- 0:02:47
      307500 -- (-3765.624) (-3765.143) [-3764.902] (-3773.742) * (-3772.352) [-3768.708] (-3763.082) (-3777.352) -- 0:02:46
      308000 -- [-3766.530] (-3765.319) (-3769.951) (-3771.696) * [-3768.003] (-3768.407) (-3765.703) (-3767.433) -- 0:02:46
      308500 -- (-3768.427) [-3770.492] (-3769.044) (-3775.336) * (-3769.978) (-3768.457) [-3769.188] (-3767.072) -- 0:02:45
      309000 -- (-3773.114) [-3766.672] (-3775.099) (-3768.271) * (-3764.473) (-3770.083) [-3769.912] (-3768.783) -- 0:02:45
      309500 -- (-3766.649) (-3763.959) (-3774.292) [-3763.492] * (-3769.108) (-3766.263) [-3771.144] (-3769.815) -- 0:02:45
      310000 -- (-3771.829) (-3765.803) (-3769.595) [-3771.011] * (-3770.071) (-3765.371) [-3767.012] (-3773.447) -- 0:02:46

      Average standard deviation of split frequencies: 0.000000

      310500 -- (-3770.269) (-3767.381) [-3767.541] (-3765.180) * (-3765.439) (-3769.207) (-3767.003) [-3766.222] -- 0:02:46
      311000 -- (-3767.521) (-3766.156) (-3776.709) [-3765.455] * (-3772.511) [-3770.335] (-3767.857) (-3767.917) -- 0:02:46
      311500 -- (-3776.154) (-3765.911) [-3765.102] (-3766.794) * (-3773.352) [-3762.920] (-3767.988) (-3764.743) -- 0:02:45
      312000 -- [-3766.600] (-3764.297) (-3765.497) (-3770.589) * (-3770.594) (-3766.063) (-3769.435) [-3772.068] -- 0:02:45
      312500 -- (-3764.772) (-3766.362) [-3769.032] (-3768.098) * (-3769.711) (-3765.987) (-3766.336) [-3772.363] -- 0:02:45
      313000 -- (-3768.139) [-3772.377] (-3769.597) (-3770.370) * [-3768.094] (-3769.795) (-3763.774) (-3768.375) -- 0:02:44
      313500 -- (-3764.811) [-3769.477] (-3771.000) (-3770.690) * [-3767.942] (-3777.438) (-3768.778) (-3770.023) -- 0:02:44
      314000 -- (-3767.477) (-3774.234) (-3765.997) [-3764.677] * (-3776.564) (-3783.225) (-3764.972) [-3768.783] -- 0:02:46
      314500 -- [-3765.128] (-3772.664) (-3767.380) (-3771.665) * (-3766.076) (-3765.860) (-3768.813) [-3774.005] -- 0:02:45
      315000 -- (-3763.449) (-3775.314) (-3772.613) [-3766.348] * [-3762.951] (-3765.090) (-3766.242) (-3765.891) -- 0:02:45

      Average standard deviation of split frequencies: 0.000000

      315500 -- (-3765.790) (-3770.936) [-3767.643] (-3769.535) * (-3772.720) (-3768.783) [-3768.798] (-3769.015) -- 0:02:44
      316000 -- (-3770.903) [-3770.984] (-3767.674) (-3768.119) * [-3767.346] (-3765.285) (-3771.569) (-3767.585) -- 0:02:44
      316500 -- (-3772.297) (-3775.324) [-3765.913] (-3763.149) * (-3773.866) (-3763.052) (-3771.072) [-3763.669] -- 0:02:44
      317000 -- [-3767.503] (-3775.395) (-3767.336) (-3769.238) * (-3765.134) (-3766.848) [-3770.606] (-3767.011) -- 0:02:43
      317500 -- [-3768.514] (-3770.443) (-3766.270) (-3772.050) * (-3767.964) [-3769.203] (-3768.057) (-3760.616) -- 0:02:43
      318000 -- [-3768.449] (-3778.681) (-3773.745) (-3767.626) * (-3772.777) (-3767.317) [-3770.620] (-3764.179) -- 0:02:45
      318500 -- (-3772.325) (-3773.117) [-3771.747] (-3769.087) * (-3768.458) (-3769.860) [-3766.987] (-3771.103) -- 0:02:44
      319000 -- [-3770.533] (-3767.587) (-3768.216) (-3768.774) * (-3773.523) (-3765.039) (-3765.789) [-3767.535] -- 0:02:44
      319500 -- (-3775.953) (-3787.380) [-3765.451] (-3764.565) * (-3764.045) (-3765.882) (-3765.028) [-3766.907] -- 0:02:44
      320000 -- (-3774.516) (-3770.419) (-3767.265) [-3764.924] * (-3771.130) [-3772.700] (-3765.033) (-3767.247) -- 0:02:43

      Average standard deviation of split frequencies: 0.000000

      320500 -- (-3773.086) [-3767.872] (-3765.516) (-3770.305) * (-3768.276) (-3770.792) [-3765.036] (-3771.648) -- 0:02:43
      321000 -- (-3769.868) (-3768.387) (-3774.677) [-3765.652] * [-3765.186] (-3763.823) (-3766.415) (-3768.455) -- 0:02:42
      321500 -- [-3772.194] (-3773.192) (-3765.830) (-3764.207) * [-3770.380] (-3763.038) (-3765.874) (-3768.998) -- 0:02:42
      322000 -- (-3771.084) [-3764.710] (-3766.461) (-3769.562) * (-3764.218) (-3765.789) (-3769.424) [-3766.860] -- 0:02:42
      322500 -- (-3769.339) [-3765.433] (-3767.600) (-3772.894) * (-3771.156) (-3768.463) [-3767.103] (-3764.952) -- 0:02:43
      323000 -- (-3774.167) (-3768.752) (-3772.546) [-3769.124] * [-3767.217] (-3768.136) (-3764.946) (-3769.586) -- 0:02:43
      323500 -- (-3778.382) (-3763.925) [-3770.306] (-3767.948) * (-3771.898) [-3768.719] (-3771.874) (-3771.118) -- 0:02:43
      324000 -- (-3765.231) (-3767.218) [-3765.505] (-3772.877) * [-3766.304] (-3767.760) (-3769.802) (-3763.619) -- 0:02:42
      324500 -- (-3769.519) [-3769.527] (-3762.472) (-3764.189) * (-3767.127) [-3766.500] (-3763.683) (-3767.421) -- 0:02:42
      325000 -- (-3772.058) (-3769.191) [-3768.992] (-3767.520) * (-3772.408) (-3770.111) (-3770.683) [-3772.738] -- 0:02:42

      Average standard deviation of split frequencies: 0.000000

      325500 -- [-3765.241] (-3766.595) (-3774.531) (-3765.486) * [-3767.564] (-3770.563) (-3771.848) (-3769.235) -- 0:02:41
      326000 -- [-3762.051] (-3774.599) (-3769.760) (-3770.187) * (-3774.266) (-3771.329) (-3766.308) [-3765.231] -- 0:02:41
      326500 -- [-3769.606] (-3776.319) (-3768.644) (-3770.990) * (-3771.405) (-3765.364) (-3768.180) [-3768.161] -- 0:02:42
      327000 -- (-3766.703) (-3766.973) (-3769.005) [-3767.874] * (-3768.436) (-3769.324) (-3771.704) [-3771.794] -- 0:02:42
      327500 -- (-3769.145) [-3767.456] (-3768.299) (-3770.256) * (-3766.262) (-3772.668) [-3768.865] (-3767.443) -- 0:02:42
      328000 -- (-3764.268) [-3766.922] (-3765.836) (-3769.833) * (-3772.861) [-3767.813] (-3766.864) (-3768.274) -- 0:02:41
      328500 -- (-3767.061) [-3766.071] (-3768.625) (-3766.099) * (-3766.636) [-3771.094] (-3768.623) (-3767.778) -- 0:02:41
      329000 -- (-3765.798) (-3772.597) (-3768.658) [-3768.978] * (-3766.447) (-3770.814) [-3769.925] (-3764.232) -- 0:02:41
      329500 -- (-3770.465) (-3765.723) (-3770.712) [-3773.729] * [-3769.960] (-3767.894) (-3768.210) (-3772.701) -- 0:02:40
      330000 -- (-3767.025) (-3767.867) [-3776.183] (-3772.085) * [-3772.276] (-3772.795) (-3767.010) (-3772.335) -- 0:02:40

      Average standard deviation of split frequencies: 0.000000

      330500 -- (-3769.312) (-3767.651) (-3765.368) [-3776.383] * [-3768.403] (-3765.182) (-3773.536) (-3765.322) -- 0:02:42
      331000 -- [-3776.418] (-3770.125) (-3770.382) (-3771.101) * (-3763.904) [-3771.190] (-3780.051) (-3768.433) -- 0:02:41
      331500 -- [-3771.117] (-3766.856) (-3769.090) (-3762.084) * (-3772.167) (-3773.813) (-3768.900) [-3764.708] -- 0:02:41
      332000 -- (-3766.318) (-3765.386) [-3766.915] (-3767.867) * (-3779.477) (-3776.037) [-3767.817] (-3768.507) -- 0:02:40
      332500 -- [-3764.562] (-3769.770) (-3766.630) (-3767.351) * (-3770.972) (-3765.766) (-3769.664) [-3764.100] -- 0:02:40
      333000 -- (-3767.227) (-3766.521) [-3767.029] (-3762.697) * (-3769.052) [-3768.244] (-3774.351) (-3770.593) -- 0:02:40
      333500 -- (-3771.185) (-3767.088) [-3765.364] (-3762.038) * (-3770.356) [-3770.563] (-3764.273) (-3769.292) -- 0:02:39
      334000 -- (-3778.370) [-3769.178] (-3764.974) (-3763.875) * (-3776.566) [-3773.425] (-3770.089) (-3768.890) -- 0:02:39
      334500 -- (-3768.641) (-3769.202) (-3767.923) [-3764.193] * (-3772.437) (-3766.541) (-3768.607) [-3774.535] -- 0:02:41
      335000 -- (-3771.340) [-3767.469] (-3771.023) (-3768.253) * (-3766.881) [-3772.693] (-3774.068) (-3773.993) -- 0:02:40

      Average standard deviation of split frequencies: 0.000000

      335500 -- (-3769.479) (-3763.105) (-3778.378) [-3768.131] * (-3765.119) [-3766.213] (-3767.694) (-3764.348) -- 0:02:40
      336000 -- (-3766.276) (-3770.044) (-3776.630) [-3767.630] * [-3766.948] (-3770.226) (-3763.457) (-3765.771) -- 0:02:40
      336500 -- [-3765.133] (-3765.451) (-3776.158) (-3766.443) * [-3767.576] (-3771.318) (-3764.599) (-3768.304) -- 0:02:39
      337000 -- (-3769.388) (-3769.069) (-3785.141) [-3770.835] * (-3771.951) [-3767.932] (-3766.586) (-3767.726) -- 0:02:39
      337500 -- (-3766.634) (-3767.436) [-3766.020] (-3763.149) * (-3762.235) (-3770.816) [-3770.351] (-3768.405) -- 0:02:39
      338000 -- (-3771.371) [-3769.459] (-3766.135) (-3770.963) * (-3766.368) [-3769.567] (-3769.991) (-3769.453) -- 0:02:38
      338500 -- (-3775.089) (-3762.933) [-3769.602] (-3771.403) * (-3765.605) [-3768.024] (-3769.738) (-3771.900) -- 0:02:40
      339000 -- (-3772.568) (-3769.158) [-3764.185] (-3766.117) * (-3763.358) [-3763.853] (-3766.991) (-3771.394) -- 0:02:39
      339500 -- (-3775.687) [-3766.531] (-3768.587) (-3774.693) * (-3770.468) (-3763.877) (-3766.983) [-3768.455] -- 0:02:39
      340000 -- (-3769.797) (-3767.057) [-3765.695] (-3771.569) * (-3767.165) [-3768.211] (-3771.632) (-3771.689) -- 0:02:39

      Average standard deviation of split frequencies: 0.000000

      340500 -- (-3766.585) [-3767.645] (-3766.797) (-3765.937) * [-3765.429] (-3771.837) (-3762.906) (-3767.414) -- 0:02:38
      341000 -- (-3774.905) (-3772.989) (-3764.745) [-3771.069] * (-3769.101) (-3767.458) [-3766.449] (-3777.604) -- 0:02:38
      341500 -- (-3766.962) (-3772.248) (-3767.191) [-3773.942] * [-3767.189] (-3770.004) (-3765.181) (-3770.678) -- 0:02:38
      342000 -- (-3778.231) (-3769.060) [-3770.494] (-3776.518) * (-3765.785) (-3780.688) [-3763.679] (-3764.982) -- 0:02:37
      342500 -- (-3768.529) [-3764.509] (-3770.221) (-3769.351) * [-3764.244] (-3774.336) (-3767.174) (-3764.820) -- 0:02:39
      343000 -- (-3763.292) (-3764.510) [-3765.075] (-3765.627) * (-3781.826) [-3769.837] (-3762.638) (-3768.580) -- 0:02:38
      343500 -- [-3768.476] (-3765.205) (-3771.367) (-3769.125) * [-3767.841] (-3770.618) (-3770.243) (-3771.273) -- 0:02:38
      344000 -- (-3766.786) (-3765.673) [-3764.056] (-3772.405) * (-3770.858) (-3765.098) [-3771.831] (-3767.662) -- 0:02:38
      344500 -- (-3770.399) (-3770.283) [-3764.671] (-3767.334) * (-3765.695) [-3769.643] (-3768.581) (-3766.306) -- 0:02:37
      345000 -- (-3765.777) (-3774.349) [-3762.940] (-3773.385) * [-3771.054] (-3776.973) (-3775.676) (-3772.227) -- 0:02:37

      Average standard deviation of split frequencies: 0.000000

      345500 -- (-3773.526) [-3773.838] (-3769.840) (-3775.008) * (-3767.490) [-3766.602] (-3766.258) (-3766.816) -- 0:02:37
      346000 -- (-3770.888) [-3768.883] (-3769.478) (-3773.618) * (-3766.914) (-3770.487) [-3769.386] (-3772.748) -- 0:02:36
      346500 -- (-3767.257) (-3766.309) [-3765.558] (-3769.035) * [-3765.425] (-3766.965) (-3774.049) (-3765.817) -- 0:02:38
      347000 -- (-3769.403) (-3769.588) (-3767.995) [-3764.358] * (-3765.703) (-3770.035) (-3771.436) [-3767.895] -- 0:02:38
      347500 -- (-3776.366) [-3778.119] (-3765.701) (-3773.791) * [-3767.341] (-3768.412) (-3769.537) (-3775.036) -- 0:02:37
      348000 -- [-3768.081] (-3775.651) (-3766.206) (-3768.858) * (-3765.809) (-3763.851) [-3766.755] (-3772.317) -- 0:02:37
      348500 -- (-3767.042) (-3766.308) [-3766.072] (-3763.040) * (-3775.222) (-3767.075) [-3768.490] (-3769.317) -- 0:02:37
      349000 -- (-3765.512) (-3778.013) [-3765.899] (-3763.993) * (-3767.564) (-3774.932) (-3773.421) [-3764.008] -- 0:02:36
      349500 -- (-3770.024) (-3766.849) (-3767.323) [-3764.206] * [-3763.816] (-3776.881) (-3766.158) (-3767.260) -- 0:02:36
      350000 -- [-3769.622] (-3763.046) (-3766.208) (-3766.748) * (-3763.909) (-3775.236) [-3773.082] (-3767.706) -- 0:02:36

      Average standard deviation of split frequencies: 0.000000

      350500 -- (-3765.774) (-3767.452) [-3767.471] (-3767.069) * [-3764.905] (-3771.683) (-3769.099) (-3764.984) -- 0:02:35
      351000 -- [-3767.186] (-3768.199) (-3769.424) (-3769.077) * [-3768.385] (-3766.074) (-3771.179) (-3769.403) -- 0:02:37
      351500 -- [-3765.320] (-3770.116) (-3769.653) (-3770.334) * (-3770.551) (-3767.504) [-3763.279] (-3767.233) -- 0:02:36
      352000 -- (-3769.349) (-3767.593) [-3770.957] (-3765.751) * (-3782.121) (-3767.372) [-3766.460] (-3769.934) -- 0:02:36
      352500 -- (-3772.861) (-3771.182) [-3765.220] (-3768.549) * (-3766.687) [-3767.339] (-3768.082) (-3768.493) -- 0:02:36
      353000 -- (-3769.887) (-3774.790) [-3768.700] (-3778.773) * (-3769.110) (-3768.842) [-3761.521] (-3763.376) -- 0:02:35
      353500 -- (-3765.570) (-3769.951) [-3767.143] (-3766.141) * (-3771.473) (-3770.984) [-3766.045] (-3772.881) -- 0:02:35
      354000 -- [-3765.576] (-3779.701) (-3766.544) (-3767.350) * (-3766.956) (-3775.119) [-3766.923] (-3766.733) -- 0:02:35
      354500 -- (-3769.839) (-3763.942) (-3766.958) [-3771.425] * [-3766.990] (-3777.455) (-3764.330) (-3767.473) -- 0:02:34
      355000 -- (-3763.666) [-3764.577] (-3766.895) (-3771.013) * (-3767.303) (-3785.087) [-3765.707] (-3764.711) -- 0:02:36

      Average standard deviation of split frequencies: 0.000000

      355500 -- [-3768.715] (-3770.771) (-3768.126) (-3766.975) * (-3768.794) (-3768.482) [-3764.899] (-3769.132) -- 0:02:35
      356000 -- (-3769.180) (-3767.811) (-3773.708) [-3767.127] * (-3764.443) (-3772.483) [-3770.424] (-3768.856) -- 0:02:35
      356500 -- [-3770.641] (-3775.955) (-3772.836) (-3770.612) * (-3772.827) (-3773.865) [-3763.693] (-3770.041) -- 0:02:35
      357000 -- (-3773.499) (-3766.748) (-3771.126) [-3765.775] * (-3772.611) (-3772.713) [-3767.033] (-3768.626) -- 0:02:34
      357500 -- (-3772.076) (-3770.147) (-3772.735) [-3767.207] * (-3766.012) (-3768.319) (-3766.540) [-3774.600] -- 0:02:34
      358000 -- (-3766.554) [-3769.039] (-3770.490) (-3766.799) * (-3768.738) [-3768.145] (-3769.829) (-3777.144) -- 0:02:34
      358500 -- (-3764.619) [-3767.482] (-3771.975) (-3774.353) * [-3771.747] (-3769.575) (-3767.827) (-3773.857) -- 0:02:33
      359000 -- (-3769.238) (-3773.447) (-3770.979) [-3766.041] * [-3773.781] (-3777.220) (-3771.034) (-3772.779) -- 0:02:35
      359500 -- (-3770.969) (-3781.122) [-3770.403] (-3765.777) * (-3773.475) (-3772.120) [-3774.171] (-3769.430) -- 0:02:35
      360000 -- (-3764.596) (-3776.153) [-3772.431] (-3770.369) * (-3772.415) (-3771.839) [-3771.380] (-3768.733) -- 0:02:34

      Average standard deviation of split frequencies: 0.000000

      360500 -- (-3763.219) (-3783.287) [-3768.984] (-3772.263) * (-3777.998) (-3768.769) [-3767.228] (-3768.451) -- 0:02:34
      361000 -- (-3768.711) (-3772.162) (-3769.456) [-3767.099] * (-3770.023) (-3766.905) [-3766.104] (-3766.629) -- 0:02:33
      361500 -- [-3764.858] (-3767.886) (-3772.078) (-3772.237) * (-3771.200) (-3767.305) [-3769.354] (-3766.028) -- 0:02:33
      362000 -- (-3767.089) [-3770.261] (-3769.638) (-3767.944) * (-3769.500) (-3766.535) [-3772.140] (-3767.489) -- 0:02:33
      362500 -- (-3769.754) [-3767.188] (-3773.849) (-3766.518) * (-3773.131) (-3769.747) [-3767.708] (-3766.651) -- 0:02:33
      363000 -- [-3766.133] (-3770.184) (-3773.753) (-3765.222) * (-3768.414) (-3770.916) (-3771.121) [-3771.165] -- 0:02:34
      363500 -- (-3767.421) (-3768.674) [-3771.232] (-3771.440) * (-3769.461) [-3765.479] (-3771.790) (-3764.892) -- 0:02:34
      364000 -- (-3773.165) [-3762.785] (-3768.365) (-3761.579) * (-3767.068) [-3766.363] (-3768.194) (-3764.428) -- 0:02:33
      364500 -- (-3768.991) (-3770.445) [-3764.585] (-3765.458) * (-3767.078) (-3767.826) (-3766.842) [-3767.303] -- 0:02:33
      365000 -- (-3770.483) (-3768.471) (-3771.727) [-3763.615] * (-3769.701) (-3774.632) [-3768.665] (-3773.576) -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      365500 -- (-3776.434) [-3768.272] (-3772.305) (-3766.607) * (-3765.693) [-3767.545] (-3768.550) (-3764.492) -- 0:02:32
      366000 -- (-3771.700) (-3765.477) [-3768.760] (-3770.640) * (-3767.821) (-3770.068) (-3768.454) [-3765.296] -- 0:02:32
      366500 -- [-3764.978] (-3770.798) (-3763.511) (-3765.913) * [-3768.105] (-3774.382) (-3772.479) (-3769.167) -- 0:02:32
      367000 -- [-3767.023] (-3772.342) (-3766.540) (-3770.506) * (-3774.589) (-3772.244) [-3767.681] (-3772.193) -- 0:02:33
      367500 -- (-3765.784) (-3767.267) [-3772.329] (-3773.267) * (-3766.398) (-3768.773) [-3768.054] (-3773.512) -- 0:02:33
      368000 -- (-3766.673) (-3773.118) [-3769.309] (-3769.522) * (-3769.680) (-3767.974) [-3764.872] (-3769.153) -- 0:02:32
      368500 -- (-3773.964) (-3766.988) [-3765.394] (-3769.261) * [-3767.531] (-3773.362) (-3766.114) (-3765.520) -- 0:02:32
      369000 -- [-3774.878] (-3769.011) (-3769.236) (-3772.157) * [-3768.098] (-3770.378) (-3767.784) (-3772.289) -- 0:02:32
      369500 -- (-3771.798) (-3773.079) [-3768.117] (-3767.304) * (-3766.845) [-3764.747] (-3768.889) (-3772.257) -- 0:02:31
      370000 -- (-3770.456) (-3766.456) [-3767.059] (-3770.002) * (-3766.381) [-3770.816] (-3768.530) (-3764.670) -- 0:02:31

      Average standard deviation of split frequencies: 0.000000

      370500 -- (-3765.447) [-3764.283] (-3765.142) (-3770.963) * (-3772.390) (-3765.786) [-3769.202] (-3773.141) -- 0:02:31
      371000 -- (-3766.344) [-3767.511] (-3766.494) (-3765.797) * [-3772.360] (-3766.526) (-3773.023) (-3772.989) -- 0:02:32
      371500 -- (-3764.412) [-3763.673] (-3766.315) (-3767.321) * (-3767.791) (-3765.537) (-3768.456) [-3763.860] -- 0:02:32
      372000 -- (-3765.238) [-3772.985] (-3770.193) (-3766.761) * (-3782.212) (-3775.349) (-3767.896) [-3765.912] -- 0:02:31
      372500 -- (-3764.902) (-3771.952) (-3772.094) [-3767.677] * [-3772.231] (-3765.189) (-3767.675) (-3768.886) -- 0:02:31
      373000 -- (-3763.883) (-3776.550) (-3767.790) [-3769.751] * (-3765.041) (-3768.186) [-3768.355] (-3767.618) -- 0:02:31
      373500 -- (-3764.670) [-3763.819] (-3772.688) (-3768.771) * (-3766.886) (-3765.697) (-3767.106) [-3768.731] -- 0:02:30
      374000 -- (-3770.081) (-3762.349) [-3767.027] (-3769.067) * (-3767.136) [-3763.672] (-3764.110) (-3769.943) -- 0:02:30
      374500 -- (-3770.117) (-3773.102) (-3770.684) [-3762.094] * (-3765.087) (-3767.285) (-3762.910) [-3762.447] -- 0:02:30
      375000 -- [-3769.196] (-3766.945) (-3769.968) (-3768.989) * (-3772.330) (-3774.814) (-3762.789) [-3765.113] -- 0:02:30

      Average standard deviation of split frequencies: 0.000000

      375500 -- (-3770.461) [-3763.957] (-3764.669) (-3776.033) * (-3765.736) (-3775.029) (-3769.599) [-3764.187] -- 0:02:31
      376000 -- [-3767.360] (-3764.205) (-3766.060) (-3763.201) * (-3764.999) [-3769.869] (-3775.123) (-3763.880) -- 0:02:31
      376500 -- (-3767.830) (-3770.581) [-3769.563] (-3771.482) * [-3764.443] (-3769.167) (-3765.503) (-3765.844) -- 0:02:30
      377000 -- [-3771.175] (-3769.316) (-3765.403) (-3770.382) * (-3769.076) (-3763.928) (-3771.490) [-3773.945] -- 0:02:30
      377500 -- (-3766.649) [-3761.974] (-3769.730) (-3764.639) * [-3767.423] (-3762.073) (-3763.197) (-3767.619) -- 0:02:30
      378000 -- (-3762.660) (-3764.218) [-3768.360] (-3770.011) * (-3764.594) (-3771.345) [-3763.592] (-3762.329) -- 0:02:29
      378500 -- [-3767.529] (-3766.335) (-3768.519) (-3764.369) * [-3765.416] (-3762.954) (-3774.169) (-3767.873) -- 0:02:29
      379000 -- (-3769.540) (-3770.473) [-3768.333] (-3775.810) * (-3764.349) [-3771.203] (-3768.198) (-3765.969) -- 0:02:29
      379500 -- (-3770.368) (-3763.936) [-3769.056] (-3778.256) * (-3770.645) (-3770.655) (-3769.367) [-3765.734] -- 0:02:30
      380000 -- (-3768.915) (-3763.481) [-3764.435] (-3767.754) * (-3767.157) (-3776.961) [-3766.739] (-3763.338) -- 0:02:30

      Average standard deviation of split frequencies: 0.000000

      380500 -- (-3771.268) [-3766.530] (-3766.455) (-3767.236) * (-3765.138) [-3763.173] (-3767.567) (-3766.719) -- 0:02:29
      381000 -- (-3780.030) [-3767.679] (-3763.698) (-3762.521) * [-3762.303] (-3766.377) (-3767.096) (-3764.444) -- 0:02:29
      381500 -- (-3764.819) [-3770.467] (-3767.586) (-3770.521) * (-3767.475) [-3763.952] (-3771.144) (-3769.023) -- 0:02:29
      382000 -- [-3766.962] (-3775.623) (-3772.758) (-3770.537) * (-3770.415) [-3762.100] (-3771.472) (-3766.865) -- 0:02:28
      382500 -- (-3769.447) (-3771.551) (-3779.210) [-3770.268] * (-3765.319) (-3767.992) (-3770.418) [-3769.927] -- 0:02:28
      383000 -- (-3771.933) (-3770.804) [-3764.785] (-3767.941) * [-3767.738] (-3767.593) (-3765.329) (-3772.338) -- 0:02:28
      383500 -- (-3768.975) (-3765.666) (-3772.581) [-3766.228] * (-3767.615) [-3770.054] (-3770.039) (-3766.745) -- 0:02:29
      384000 -- (-3775.296) (-3770.080) [-3767.877] (-3772.246) * (-3768.108) [-3767.060] (-3764.555) (-3764.477) -- 0:02:29
      384500 -- (-3765.860) (-3768.757) [-3766.346] (-3766.549) * [-3766.986] (-3767.093) (-3766.226) (-3761.870) -- 0:02:28
      385000 -- [-3767.958] (-3769.105) (-3768.861) (-3767.282) * [-3773.149] (-3776.404) (-3764.923) (-3770.621) -- 0:02:28

      Average standard deviation of split frequencies: 0.000000

      385500 -- [-3768.289] (-3771.253) (-3765.425) (-3765.512) * [-3766.777] (-3768.968) (-3766.292) (-3767.217) -- 0:02:28
      386000 -- (-3771.823) (-3778.526) (-3767.890) [-3765.527] * (-3771.124) [-3764.670] (-3768.064) (-3763.529) -- 0:02:27
      386500 -- [-3771.497] (-3766.495) (-3767.645) (-3765.243) * (-3769.988) (-3763.634) [-3765.998] (-3768.696) -- 0:02:27
      387000 -- (-3766.652) (-3772.007) (-3769.013) [-3766.914] * (-3763.251) [-3761.250] (-3773.457) (-3767.643) -- 0:02:27
      387500 -- (-3770.571) [-3774.952] (-3768.562) (-3772.792) * (-3768.605) [-3764.755] (-3775.159) (-3767.053) -- 0:02:28
      388000 -- (-3769.562) [-3766.741] (-3769.968) (-3765.406) * (-3771.202) (-3762.772) [-3774.900] (-3767.187) -- 0:02:28
      388500 -- (-3776.498) (-3770.095) [-3768.516] (-3768.633) * (-3768.214) (-3767.828) [-3778.302] (-3770.115) -- 0:02:27
      389000 -- (-3770.587) (-3766.340) [-3764.625] (-3765.579) * (-3766.710) [-3767.246] (-3770.793) (-3766.660) -- 0:02:27
      389500 -- (-3766.816) [-3766.607] (-3764.750) (-3767.592) * [-3767.568] (-3765.570) (-3764.289) (-3768.073) -- 0:02:27
      390000 -- (-3768.700) [-3765.672] (-3775.577) (-3762.710) * (-3775.812) (-3767.455) (-3769.391) [-3768.323] -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      390500 -- (-3762.689) [-3765.548] (-3774.585) (-3769.601) * (-3768.772) [-3766.505] (-3768.935) (-3770.368) -- 0:02:26
      391000 -- (-3762.138) (-3770.386) [-3772.023] (-3765.956) * (-3765.501) [-3765.526] (-3769.797) (-3770.824) -- 0:02:26
      391500 -- (-3769.045) (-3762.449) (-3775.216) [-3763.201] * (-3769.191) (-3762.923) [-3767.556] (-3768.957) -- 0:02:26
      392000 -- (-3770.668) (-3769.275) (-3770.073) [-3761.944] * (-3769.378) (-3765.986) (-3762.924) [-3769.981] -- 0:02:27
      392500 -- (-3767.288) (-3770.358) (-3769.430) [-3767.453] * (-3766.297) (-3764.455) [-3769.731] (-3770.238) -- 0:02:27
      393000 -- (-3764.765) (-3767.460) [-3767.062] (-3771.371) * (-3766.985) [-3766.824] (-3768.933) (-3767.847) -- 0:02:26
      393500 -- [-3768.958] (-3770.065) (-3768.346) (-3768.646) * [-3768.294] (-3764.360) (-3772.058) (-3767.634) -- 0:02:26
      394000 -- [-3766.474] (-3770.714) (-3777.474) (-3767.541) * [-3769.215] (-3764.095) (-3769.936) (-3765.248) -- 0:02:26
      394500 -- [-3768.942] (-3771.328) (-3780.391) (-3776.584) * (-3765.798) (-3774.179) [-3768.997] (-3770.145) -- 0:02:25
      395000 -- (-3765.727) (-3768.592) [-3772.035] (-3769.649) * [-3767.290] (-3765.707) (-3766.479) (-3775.864) -- 0:02:25

      Average standard deviation of split frequencies: 0.000000

      395500 -- (-3767.912) [-3768.624] (-3766.945) (-3769.594) * [-3766.156] (-3769.491) (-3768.263) (-3765.172) -- 0:02:25
      396000 -- [-3767.432] (-3770.871) (-3762.264) (-3772.779) * (-3771.108) [-3766.426] (-3767.585) (-3769.167) -- 0:02:26
      396500 -- [-3771.173] (-3768.016) (-3766.363) (-3768.025) * (-3763.705) (-3770.232) (-3770.222) [-3766.371] -- 0:02:26
      397000 -- (-3767.361) (-3768.270) (-3771.325) [-3768.509] * (-3768.925) [-3766.482] (-3768.429) (-3770.685) -- 0:02:25
      397500 -- (-3764.153) [-3771.586] (-3765.803) (-3768.399) * (-3775.244) (-3768.806) (-3775.543) [-3770.185] -- 0:02:25
      398000 -- (-3765.604) [-3770.165] (-3766.208) (-3770.104) * [-3765.638] (-3767.341) (-3780.120) (-3775.173) -- 0:02:25
      398500 -- [-3764.849] (-3768.579) (-3769.206) (-3766.079) * [-3767.352] (-3767.764) (-3775.325) (-3761.910) -- 0:02:24
      399000 -- [-3765.350] (-3766.916) (-3767.351) (-3771.154) * (-3771.999) [-3765.105] (-3770.960) (-3765.580) -- 0:02:24
      399500 -- (-3765.044) (-3770.313) (-3778.944) [-3772.422] * (-3775.275) (-3764.681) (-3768.034) [-3770.242] -- 0:02:24
      400000 -- (-3765.630) (-3764.637) (-3765.895) [-3768.076] * (-3776.800) (-3775.003) [-3770.552] (-3768.219) -- 0:02:25

      Average standard deviation of split frequencies: 0.000000

      400500 -- (-3765.462) (-3772.534) (-3767.600) [-3764.339] * (-3772.145) [-3774.440] (-3768.313) (-3769.315) -- 0:02:25
      401000 -- [-3770.534] (-3764.919) (-3765.146) (-3773.031) * [-3765.128] (-3772.840) (-3772.282) (-3766.333) -- 0:02:24
      401500 -- [-3764.924] (-3768.618) (-3764.081) (-3766.714) * (-3774.038) (-3768.486) [-3768.200] (-3776.105) -- 0:02:24
      402000 -- (-3766.054) [-3764.341] (-3768.134) (-3773.111) * (-3772.568) (-3768.471) (-3767.613) [-3766.126] -- 0:02:24
      402500 -- [-3768.110] (-3769.046) (-3766.778) (-3769.069) * (-3765.988) (-3771.711) (-3770.538) [-3763.069] -- 0:02:23
      403000 -- (-3767.750) (-3765.545) [-3773.591] (-3770.238) * [-3766.452] (-3765.156) (-3767.801) (-3766.020) -- 0:02:23
      403500 -- [-3769.103] (-3766.827) (-3767.069) (-3763.304) * (-3766.247) (-3772.416) (-3768.338) [-3769.984] -- 0:02:23
      404000 -- [-3768.551] (-3770.453) (-3773.056) (-3770.918) * [-3767.682] (-3771.647) (-3774.252) (-3784.168) -- 0:02:24
      404500 -- [-3764.157] (-3777.826) (-3769.220) (-3764.444) * [-3765.900] (-3768.655) (-3770.669) (-3767.215) -- 0:02:24
      405000 -- (-3768.511) (-3771.164) (-3768.195) [-3768.600] * (-3771.846) (-3769.373) [-3765.125] (-3763.183) -- 0:02:23

      Average standard deviation of split frequencies: 0.000000

      405500 -- (-3770.780) (-3765.704) (-3767.693) [-3766.927] * (-3774.106) [-3768.231] (-3765.194) (-3771.798) -- 0:02:23
      406000 -- (-3769.541) [-3768.179] (-3770.057) (-3766.595) * (-3771.964) (-3774.884) (-3766.673) [-3763.100] -- 0:02:23
      406500 -- [-3772.486] (-3781.396) (-3767.767) (-3765.992) * (-3771.899) (-3771.175) [-3765.242] (-3764.594) -- 0:02:23
      407000 -- (-3766.852) [-3764.817] (-3764.731) (-3768.744) * (-3769.746) (-3765.692) (-3771.978) [-3769.854] -- 0:02:22
      407500 -- (-3773.431) (-3770.565) [-3766.817] (-3763.415) * [-3764.359] (-3772.665) (-3769.418) (-3762.640) -- 0:02:22
      408000 -- (-3771.930) (-3766.355) [-3769.606] (-3769.499) * (-3765.833) [-3773.006] (-3767.168) (-3765.463) -- 0:02:22
      408500 -- [-3764.020] (-3771.801) (-3763.761) (-3773.211) * (-3770.224) (-3768.074) (-3771.219) [-3768.873] -- 0:02:23
      409000 -- [-3765.084] (-3769.605) (-3765.866) (-3775.873) * (-3767.217) (-3769.906) (-3763.466) [-3763.957] -- 0:02:23
      409500 -- [-3765.966] (-3772.131) (-3768.028) (-3769.370) * (-3769.978) (-3771.444) (-3766.461) [-3767.228] -- 0:02:22
      410000 -- (-3765.149) [-3768.905] (-3763.582) (-3771.863) * [-3767.845] (-3779.120) (-3768.718) (-3771.620) -- 0:02:22

      Average standard deviation of split frequencies: 0.000000

      410500 -- (-3767.325) (-3767.567) [-3768.621] (-3770.545) * [-3766.509] (-3764.337) (-3766.977) (-3774.471) -- 0:02:22
      411000 -- (-3768.768) (-3770.330) [-3771.685] (-3763.077) * (-3768.762) (-3768.841) [-3770.624] (-3766.379) -- 0:02:21
      411500 -- (-3767.562) [-3766.438] (-3768.411) (-3767.274) * (-3768.811) (-3777.005) (-3766.196) [-3767.754] -- 0:02:21
      412000 -- [-3766.963] (-3767.405) (-3775.898) (-3771.109) * (-3776.899) (-3771.756) [-3768.195] (-3764.452) -- 0:02:21
      412500 -- (-3772.887) (-3769.762) (-3762.190) [-3773.288] * [-3760.562] (-3769.207) (-3762.535) (-3768.939) -- 0:02:22
      413000 -- [-3766.571] (-3764.413) (-3766.345) (-3767.618) * (-3766.008) (-3765.210) (-3771.806) [-3769.222] -- 0:02:22
      413500 -- (-3764.565) [-3763.364] (-3768.152) (-3766.583) * [-3765.470] (-3766.709) (-3767.023) (-3769.712) -- 0:02:21
      414000 -- (-3766.110) [-3767.351] (-3771.532) (-3765.883) * (-3768.342) (-3773.121) [-3767.960] (-3768.471) -- 0:02:21
      414500 -- [-3765.527] (-3767.231) (-3764.770) (-3767.785) * (-3764.786) (-3772.722) (-3768.879) [-3763.814] -- 0:02:21
      415000 -- (-3775.227) (-3769.926) [-3768.360] (-3763.767) * [-3766.053] (-3766.979) (-3769.249) (-3766.481) -- 0:02:20

      Average standard deviation of split frequencies: 0.000000

      415500 -- (-3774.172) (-3767.411) [-3770.078] (-3762.732) * (-3763.424) [-3767.154] (-3765.161) (-3766.163) -- 0:02:20
      416000 -- (-3768.218) (-3775.157) (-3765.034) [-3769.940] * (-3778.095) (-3769.969) [-3764.412] (-3771.205) -- 0:02:20
      416500 -- (-3765.566) [-3771.384] (-3764.253) (-3770.427) * (-3768.301) [-3764.735] (-3764.277) (-3768.798) -- 0:02:21
      417000 -- (-3766.035) (-3775.157) (-3772.064) [-3763.830] * (-3764.474) (-3765.284) (-3771.343) [-3766.644] -- 0:02:21
      417500 -- [-3764.650] (-3776.490) (-3767.431) (-3764.217) * (-3767.654) (-3766.317) (-3771.622) [-3765.534] -- 0:02:20
      418000 -- (-3772.515) (-3776.936) [-3764.599] (-3764.246) * (-3767.319) [-3767.856] (-3767.850) (-3765.131) -- 0:02:20
      418500 -- (-3770.740) [-3774.656] (-3776.904) (-3763.585) * (-3770.660) (-3773.880) [-3771.637] (-3768.377) -- 0:02:20
      419000 -- (-3767.662) (-3766.731) [-3765.969] (-3760.688) * (-3779.407) (-3766.356) (-3767.243) [-3765.755] -- 0:02:20
      419500 -- (-3770.440) (-3768.580) (-3767.140) [-3769.234] * (-3764.510) [-3769.965] (-3774.458) (-3763.036) -- 0:02:19
      420000 -- [-3764.915] (-3772.723) (-3776.176) (-3764.924) * (-3764.129) [-3763.493] (-3773.626) (-3768.510) -- 0:02:19

      Average standard deviation of split frequencies: 0.000000

      420500 -- [-3764.967] (-3770.169) (-3771.538) (-3764.169) * (-3772.599) (-3767.953) [-3768.977] (-3773.460) -- 0:02:19
      421000 -- [-3766.158] (-3767.680) (-3765.274) (-3763.990) * (-3772.173) (-3770.113) [-3771.780] (-3765.429) -- 0:02:20
      421500 -- (-3764.131) [-3768.610] (-3763.666) (-3764.033) * [-3771.197] (-3771.691) (-3768.304) (-3776.303) -- 0:02:19
      422000 -- (-3766.751) (-3768.553) (-3768.044) [-3768.295] * [-3764.678] (-3771.050) (-3772.674) (-3776.191