--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Mon Oct 31 15:00:11 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/110/CG31344-PA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2636.47 -2650.76 2 -2636.38 -2648.79 -------------------------------------- TOTAL -2636.42 -2650.20 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.265048 0.001297 0.200728 0.338737 0.263109 1323.43 1412.21 1.000 r(A<->C){all} 0.101834 0.000787 0.050844 0.158733 0.099981 838.79 900.81 1.002 r(A<->G){all} 0.223364 0.001599 0.145480 0.299709 0.221629 966.26 978.66 1.000 r(A<->T){all} 0.153448 0.001533 0.081050 0.227897 0.150388 713.04 841.62 1.000 r(C<->G){all} 0.032116 0.000215 0.007681 0.063461 0.030432 786.92 966.25 1.000 r(C<->T){all} 0.411639 0.002714 0.314381 0.517202 0.409638 917.27 938.56 1.001 r(G<->T){all} 0.077597 0.000553 0.037376 0.127206 0.075162 944.87 1053.66 1.000 pi(A){all} 0.237616 0.000134 0.215239 0.260798 0.237491 1433.11 1446.12 1.000 pi(C){all} 0.259306 0.000153 0.237050 0.284759 0.258952 1157.68 1226.56 1.000 pi(G){all} 0.282081 0.000158 0.255279 0.304790 0.281884 1267.34 1292.21 1.001 pi(T){all} 0.220996 0.000136 0.198676 0.243893 0.220781 1165.01 1246.78 1.002 alpha{1,2} 0.051052 0.001360 0.000146 0.119656 0.044448 1501.00 1501.00 1.000 alpha{3} 2.393420 0.727893 0.950996 4.082431 2.265720 1290.37 1395.69 1.000 pinvar{all} 0.388266 0.008204 0.190037 0.541954 0.398662 1052.75 1157.34 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2542.169526 Model 2: PositiveSelection -2542.169526 Model 0: one-ratio -2542.377859 Model 3: discrete -2541.814005 Model 7: beta -2541.869513 Model 8: beta&w>1 -2541.869617 Model 0 vs 1 0.4166660000000775 Model 2 vs 1 0.0 Model 8 vs 7 2.0799999947485048E-4
>C1 MQVDGCTSSSSEIPHPAKRETWISGKMQSSSHSKDGHNAAGASKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLKDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTGEDFKRMTEALINGLWHINTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL VRWYLNFRVWLVDIFTYYLPYVAIWKFGPKSAYVRIFRNGGEAQDFALGL KDD >C2 MQVDGCTSSSSEIPHPANRESWNSVKMQSSSHSKDGHNGVGATKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSWTAFTAYRRYVRTIFHTQAWYNYNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDQVFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTDEEFNRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFIVTYLHRYAL VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL KDD >C3 MQVDGCTSSSSEIPHPTNRETWNSVKMQSSSHSKDGHNGVGATKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTDEEFNRMTKALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRLIVSYGLFLVTYLHRYAL VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL KDD >C4 MQVDSCTSNSSEIPDPTKREAWNSGKMQSSPHSKDGHNAAGASKLVQDQQ AAEDYLEHLMTKGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICARNWAESKLRLDI VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYFSFDHENGVERDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL VRWYFNFRIWLGDVLTYYLPYVAIWKFGPKFAYVRIFRKGGEAQDFTSGL KDD >C5 MQVDSCASSSSEIPNHTKRETWNSGKMQSSPHSKDGHNAAGASKLVQDQQ AAEDYLQHLMTEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVEQDPQQKLHYYDMGWWDRFVVSYGLFLVTYLHKYAL VRWYFNFRVWLVDVLTYYLPYVAIWKFGPRFAYVRIFRKGGEAQDFTSGL KDD CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=403 C1 MQVDGCTSSSSEIPHPAKRETWISGKMQSSSHSKDGHNAAGASKLLQDHQ C2 MQVDGCTSSSSEIPHPANRESWNSVKMQSSSHSKDGHNGVGATKLLQDHQ C3 MQVDGCTSSSSEIPHPTNRETWNSVKMQSSSHSKDGHNGVGATKLLQDHQ C4 MQVDSCTSNSSEIPDPTKREAWNSGKMQSSPHSKDGHNAAGASKLVQDQQ C5 MQVDSCASSSSEIPNHTKRETWNSGKMQSSPHSKDGHNAAGASKLVQDQQ ****.*:*.*****. ::**:* * *****.*******..**:**:**:* C1 EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA C2 EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA C3 EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA C4 AAEDYLEHLMTKGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA C5 AAEDYLQHLMTEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA .****:***.:**********************:*************** C1 GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI C2 GMLAGLIAVLAIPSILRVLSCTRQSWTAFTAYRRYVRTIFHTQAWYNYNI C3 GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI C4 GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI C5 GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ************************* *********************:** C1 ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT C2 ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT C3 ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT C4 ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT C5 ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT ***************************:********************** C1 MGAHRIKLKDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI C2 MGAHRIKLNDQVFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI C3 MGAHRIKLNDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI C4 MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICARNWAESKLRLDI C5 MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI ********:* *************************.************ C1 VMRKVYEPALANTGEDFKRMTEALINGLWHINTMLSVNANIFFAKRLACV C2 VMRKVYEPALANTDEEFNRMTEALINGLWHMNTMLSVNANIFFAKRLACV C3 VMRKVYEPALANTDEEFNRMTKALINGLWHMNTMLSVNANIFFAKRLACV C4 VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV C5 VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV **********:**.*:* ***:********:******************* C1 KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL C2 KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFIVTYLHRYAL C3 KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRLIVSYGLFLVTYLHRYAL C4 KGYEYFSFDHENGVERDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL C5 KGYEYYSFDHENGVEQDPQQKLHYYDMGWWDRFVVSYGLFLVTYLHKYAL *****:******** :****************::******:*****:*** C1 VRWYLNFRVWLVDIFTYYLPYVAIWKFGPKSAYVRIFRNGGEAQDFALGL C2 VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL C3 VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL C4 VRWYFNFRIWLGDVLTYYLPYVAIWKFGPKFAYVRIFRKGGEAQDFTSGL C5 VRWYFNFRVWLVDVLTYYLPYVAIWKFGPRFAYVRIFRKGGEAQDFTSGL ****:***:** *::**************: *******:*******: ** C1 KDD C2 KDD C3 KDD C4 KDD C5 KDD *** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 403 type PROTEIN Struct Unchecked Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 403 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8060] Library Relaxation: Multi_proc [72] Relaxation Summary: [8060]--->[8060] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.306 Mb, Max= 30.683 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MQVDGCTSSSSEIPHPAKRETWISGKMQSSSHSKDGHNAAGASKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLKDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTGEDFKRMTEALINGLWHINTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL VRWYLNFRVWLVDIFTYYLPYVAIWKFGPKSAYVRIFRNGGEAQDFALGL KDD >C2 MQVDGCTSSSSEIPHPANRESWNSVKMQSSSHSKDGHNGVGATKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSWTAFTAYRRYVRTIFHTQAWYNYNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDQVFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTDEEFNRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFIVTYLHRYAL VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL KDD >C3 MQVDGCTSSSSEIPHPTNRETWNSVKMQSSSHSKDGHNGVGATKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTDEEFNRMTKALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRLIVSYGLFLVTYLHRYAL VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL KDD >C4 MQVDSCTSNSSEIPDPTKREAWNSGKMQSSPHSKDGHNAAGASKLVQDQQ AAEDYLEHLMTKGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICARNWAESKLRLDI VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYFSFDHENGVERDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL VRWYFNFRIWLGDVLTYYLPYVAIWKFGPKFAYVRIFRKGGEAQDFTSGL KDD >C5 MQVDSCASSSSEIPNHTKRETWNSGKMQSSPHSKDGHNAAGASKLVQDQQ AAEDYLQHLMTEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVEQDPQQKLHYYDMGWWDRFVVSYGLFLVTYLHKYAL VRWYFNFRVWLVDVLTYYLPYVAIWKFGPRFAYVRIFRKGGEAQDFTSGL KDD FORMAT of file /tmp/tmp3990113748442366930aln Not Supported[FATAL:T-COFFEE] >C1 MQVDGCTSSSSEIPHPAKRETWISGKMQSSSHSKDGHNAAGASKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLKDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTGEDFKRMTEALINGLWHINTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL VRWYLNFRVWLVDIFTYYLPYVAIWKFGPKSAYVRIFRNGGEAQDFALGL KDD >C2 MQVDGCTSSSSEIPHPANRESWNSVKMQSSSHSKDGHNGVGATKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSWTAFTAYRRYVRTIFHTQAWYNYNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDQVFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTDEEFNRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFIVTYLHRYAL VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL KDD >C3 MQVDGCTSSSSEIPHPTNRETWNSVKMQSSSHSKDGHNGVGATKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTDEEFNRMTKALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRLIVSYGLFLVTYLHRYAL VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL KDD >C4 MQVDSCTSNSSEIPDPTKREAWNSGKMQSSPHSKDGHNAAGASKLVQDQQ AAEDYLEHLMTKGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICARNWAESKLRLDI VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYFSFDHENGVERDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL VRWYFNFRIWLGDVLTYYLPYVAIWKFGPKFAYVRIFRKGGEAQDFTSGL KDD >C5 MQVDSCASSSSEIPNHTKRETWNSGKMQSSPHSKDGHNAAGASKLVQDQQ AAEDYLQHLMTEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVEQDPQQKLHYYDMGWWDRFVVSYGLFLVTYLHKYAL VRWYFNFRVWLVDVLTYYLPYVAIWKFGPRFAYVRIFRKGGEAQDFTSGL KDD input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:403 S:100 BS:403 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # PW_SEQ_DISTANCES BOT 0 1 95.29 C1 C2 95.29 TOP 1 0 95.29 C2 C1 95.29 BOT 0 2 95.78 C1 C3 95.78 TOP 2 0 95.78 C3 C1 95.78 BOT 0 3 92.06 C1 C4 92.06 TOP 3 0 92.06 C4 C1 92.06 BOT 0 4 92.56 C1 C5 92.56 TOP 4 0 92.56 C5 C1 92.56 BOT 1 2 98.01 C2 C3 98.01 TOP 2 1 98.01 C3 C2 98.01 BOT 1 3 90.32 C2 C4 90.32 TOP 3 1 90.32 C4 C2 90.32 BOT 1 4 90.57 C2 C5 90.57 TOP 4 1 90.57 C5 C2 90.57 BOT 2 3 91.07 C3 C4 91.07 TOP 3 2 91.07 C4 C3 91.07 BOT 2 4 91.56 C3 C5 91.56 TOP 4 2 91.56 C5 C3 91.56 BOT 3 4 96.28 C4 C5 96.28 TOP 4 3 96.28 C5 C4 96.28 AVG 0 C1 * 93.92 AVG 1 C2 * 93.55 AVG 2 C3 * 94.11 AVG 3 C4 * 92.43 AVG 4 C5 * 92.74 TOT TOT * 93.35 CLUSTAL W (1.83) multiple sequence alignment C1 ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCGC C2 ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCGC C3 ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCAC C4 ATGCAGGTTGATAGTTGCACCAGCAACTCATCTGAGATCCCCGACCCCAC C5 ATGCAGGTGGATAGTTGCGCAAGCAGCTCATCTGAGATCCCCAACCACAC ******** ***.**** .*.****.****** ********* * *.*.* C1 GAAGCGTGAAACGTGGATCAGTGGGAAAATGCAGTCGTCATCGCATTCCA C2 AAATCGTGAATCGTGGAACAGTGTGAAAATGCAGTCGTCGTCGCATTCCA C3 AAATCGTGAAACGTGGAACAGTGTGAAAATGCAGTCGTCGTCGCATTCCA C4 AAAGCGTGAAGCGTGGAACAGTGGGAAAATGCAGTCGTCGCCGCATTCCA C5 AAAACGTGAAACGTGGAACAGTGGGAAAATGCAGTCGTCGCCGCATTCCA .** ****** ******:***** ***************. ********* C1 AAGATGGTCATAATGCAGCGGGGGCTTCAAAACTGCTTCAGGATCACCAG C2 AAGATGGTCATAATGGAGTGGGGGCTACCAAACTGCTCCAGGATCACCAG C3 AAGATGGTCATAATGGAGTGGGGGCTACCAAACTGCTCCAAGATCACCAG C4 AAGATGGTCATAATGCAGCGGGGGCTAGCAAACTGGTCCAGGATCAGCAG C5 AAGATGGTCATAATGCAGCGGGGGCTAGCAAACTGGTCCAGGATCAGCAG *************** ** *******: .****** * **.***** *** C1 GAGCCCGAGGACTACTTGGAGCACCTAATGAAGGAGGGCAGTCAGGAGGG C2 GAGCCCGAGGACTACTTGGAGCACCTGATGAAGGAGGGCAGTCAGGAGGG C3 GAGCCCGAGGACTACTTGGAGCACCTGATGAAGGAGGGCAGTCAGGAGGG C4 GCAGCCGAGGACTACCTGGAGCACCTGATGACGAAGGGCAGTCAGGAGGG C5 GCAGCCGAGGACTACTTGCAGCACCTGATGACGGAGGGCAGTCAGGAGGG *.. *********** ** *******.****.*.**************** C1 CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT C2 CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT C3 CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT C4 CGACAGTGGGGCAGACTTGGAACTACCTTCATGGTACGATGAGCAGCTAT C5 CGACAGCGGGGCTGACTTGGAGCTACCTTCATGGTACGATGAGCAGCTAT ****** ** **:** *****.********.******************* C1 TCAGGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTTGTAATGAACGCC C2 TCAAGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTCGTAATGAACGCC C3 TCAAGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTCGTAATGAACGCC C4 TCAGGCGTGGTCAGAGCTACTTCAGCACGTATCGCTTCGTAATGAACGCC C5 TCAGGCGTGGTCAGAGCTATTTCAGCACGTATCGCTTCGTAATGAACGCC ***.*************** ** ************** ************ C1 GGAATGCTGGCTGGTCTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG C2 GGAATGCTGGCTGGACTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG C3 GGAATGCTGGCTGGACTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG C4 GGAATGCTGGCCGGTCTTATAGCTGTTCTGGCTATTCCCTCTATTCTACG C5 GGAATGCTGGCTGGTCTAATAGCCGTGCTGGCTATTCCCTCTATTCTTCG *********** **:**:**:** ** ***********.** ***** ** C1 GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCCTACCGTC C2 GGTGCTGTCGTGCACACGCCAATCCTGGACAGCGTTCACTGCCTACCGTC C3 TGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACTGCCTACCGTC C4 GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCATACCGTC C5 GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCCTACCGTC ************************* ************ **.******* C1 GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAACATC C2 GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACTACAACATC C3 GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAACATC C4 GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAATATC C5 GCTATGTGCGCACTATATTCCACACGCAAGCCTGGTATAACCACAACATC ********** ****************************** **** *** C1 GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC C2 GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC C3 GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC C4 GCGGACCGTGGGAGCAGGTTTTGGACCAGTATTGCGGCCGTGAGACGGGC C5 GCGGACCGTGGGAGCAGGTTCTGGACCAGTATTGCGGCCGTGAGGCGGGC *********** ******** ******** **************.***** C1 CCACAGCCGCTCCAGTCATGCGTGCGCCCGCCAAGGAGCTGGACAGATCA C2 CCACAGCCGCTCCAGTCATGCGTGCGCCCGTCAAGGAGCTGGACAGATCA C3 CCACAGCCGCTCCAGTCATGCGTGCGCCCGACAAGGAGCTGGACAGATCA C4 CCACAGCCGCTCCAGTCATGCTTGCGCCCGCAAAGGAGCTGGACAGATAA C5 CCACAGCCGCTCCAGTCATGCGTGCGCTCGCAAAGGAGCTGGACAGATCA ********************* ***** ** .****************.* C1 CCCAGAAGGATTTGGCGCTCACGCAGTTCGGTTTCATTGGCTTCATAACG C2 CCCAGAAGGATTTGGCCCTCACACAGTTCGGTTTCATTGGTTTCATAACG C3 CCCAGAAGGATTTGGCCCTCACACAGTTCGGTTTCATTGGCTTCATAACG C4 CCCAGAAAGATTTGGCCCTCACACAGTTCGGATTTATTGGCTTCATAACG C5 CCCAGAAAGATTTGGCTCTCACACAATTTGGATTCATTGGCTTTATAACG *******.******** *****.**.** **:** ***** ** ****** C1 ATGGGCGCACATCGCATAAAGCTGAAAGATCAGGACTTCCTGGAGGCCAC C2 ATGGGCGCTCATCGCATAAAGCTGAACGATCAGGTCTTTCTGGAGGCCAC C3 ATGGGCGCTCATCGCATAAAGCTGAACGATCAGGACTTCCTGGAGGCCAC C4 ATGGGCGCTCATCGCATAAAGCTGAACGATCCGGACTTCCTAGAGGCCAC C5 ATGGGCGCTCATCGCATAAAGCTTAACGATCCAGACTTCCTGGAGGCCAC ********:************** **.****..*:*** **.******** C1 TACGCATATGTGGCGCGTTCTCGGCTATCTGCTGGGCATCAAGGATGAGT C2 TACGCATATGTGGCGCGTTCTTGGCTATCTGCTGGGCATCAAGGATGAGT C3 TACGCATATGTGGCGCGTTCTTGGCTATCTGCTGGGCATCAAGGATGAGT C4 GACGCATATGTGGCGCGTTCTCGGTTATCTGCTGGGCATCAAGGATGAGT C5 GACGCATATGTGGCGCGTTCTCGGCTATCTGCTGGGCATCAAGGATGAGT ******************** ** ************************* C1 ACAACATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTCCGCCTGGACATT C2 ACAATATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTTCGCCTCGACATT C3 ACAATATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTTCGCCTCGACATT C4 ACAACATCTGCGCAAGGAACTGGGCGGAATCAAAGCTTCGCCTGGACATT C5 ACAATATCTGCGGAAGGAACTGGGCGGAATCAAAGCTTCGCCTGGACATT **** ******* :**************.******** ***** ****** C1 GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGGGGAGGATTT C2 GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGATGAGGAATT C3 GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGATGAGGAATT C4 GTGATGCGAAAGGTATACGAACCAGCTTTGACAAACACTGGTGAGGACTT C5 GTGATGCGAAAAGTATATGAACCAGCTCTGACAAACACTGGTGAGGATTT ********:**.***** ********* **.*********. ***** ** C1 CAAACGAATGACCGAGGCCCTGATTAATGGCTTGTGGCACATAAACACCA C2 CAACCGAATGACCGAGGCTCTGATTAATGGCTTGTGGCACATGAACACCA C3 CAACCGAATGACCAAGGCTCTGATTAATGGCTTGTGGCACATGAACACCA C4 CTACCGAATGACCGAGGCCTTGATTAATGGATTGTGGCACATGAACACCA C5 TTACCGAATGACCGAGGCCTTGATTAATGGTTTGTGGCACATGAACACTA :*.*********.**** ********** ***********.***** * C1 TGCTGTCGGTGAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTT C2 TGCTGTCGGTAAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTC C3 TGCTGTCGGTAAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTC C4 TGCTTTCGGTAAACGCCAACATATTCTTCGCCAAGCGATTGGCCTGCGTT C5 TGCTTTCGGTAAACGCCAACATATTCTTCGCCAAGCGATTGGCATGTGTC **** *****.** ************** **************.** ** C1 AAGGGATACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA C2 AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA C3 AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA C4 AAGGGCTACGAGTACTTCAGTTTCGATCATGAAAACGGCGTGGAACGGGA C5 AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGAGCAGGA *****.**********:***************.*****.****..*.*** C1 TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGACCGATTCA C2 TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGATCGATTCA C3 TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGATCGATTAA C4 TCCCCAGCAGAAACTGCACTACTACGACATGGGATGGTGGGATCGTTTCA C5 TCCTCAGCAGAAACTGCACTACTACGACATGGGATGGTGGGATCGTTTCG *** ********.***************************** **:**.. C1 TAGTCAGCTACGGCCTGTTCCTCGTCACATATCTGCACAGGTATGCCCTG C2 TAGTCAGCTACGGCCTGTTCATCGTCACATATCTGCACAGGTACGCCCTG C3 TAGTCAGCTACGGCCTGTTCCTCGTCACATATCTGCACAGGTACGCCCTG C4 TAGTCAGCTACGGCCTGTTCCTTGTCACATATCTGCACAGGTACGCCCTG C5 TAGTCAGCTACGGCCTGTTCCTTGTCACATATCTGCACAAGTACGCCCTG ********************.* ****************.*** ****** C1 GTGCGATGGTACTTGAACTTCCGCGTCTGGCTGGTGGACATATTCACCTA C2 GTGCGATGGTACTTGAACTTCCGTGTCTGGCTGGTGGACATACTCACATA C3 GTGCGATGGTACTTGAACTTCCGTGTCTGGCTGGTGGACATACTCACATA C4 GTGCGATGGTATTTCAACTTCCGCATCTGGCTGGGTGACGTACTGACCTA C5 GTGCGATGGTATTTCAACTTCCGCGTCTGGCTGGTGGACGTACTGACCTA *********** ** ******** .********* ***.** * **.** C1 TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCGTATG C2 TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCGTATG C3 TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCTTATG C4 TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCAAAGTTCGCGTATG C5 TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCAAGGTTCGCGTATG ************************************.*.** *** **** C1 TGCGGATTTTCAGGAATGGCGGGGAAGCCCAAGACTTTGCCCTGGGCTTG C2 TGCGGATCTTCAGGAAAGGCGGGGAGGCTCAAGACTTTGCACTGGGCTTA C3 TGCGGATCTTCAGGAAAGGCGGGGAGGCCCAAGATTTTGCCCTGGGCTTG C4 TGCGGATCTTCAGGAAGGGAGGGGAGGCCCAAGATTTTACCTCGGGCTTG C5 TGCGGATCTTCAGAAAAGGAGGGGAGGCCCAAGATTTTACCTCGGGCTTG ******* *****.** **.*****.** ***** ***.*. ******. C1 AAGGACGAT C2 AAGGACGAT C3 AAGGACGAT C4 AAGGACGAT C5 AAGGACGAT ********* >C1 ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCGC GAAGCGTGAAACGTGGATCAGTGGGAAAATGCAGTCGTCATCGCATTCCA AAGATGGTCATAATGCAGCGGGGGCTTCAAAACTGCTTCAGGATCACCAG GAGCCCGAGGACTACTTGGAGCACCTAATGAAGGAGGGCAGTCAGGAGGG CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT TCAGGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTTGTAATGAACGCC GGAATGCTGGCTGGTCTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCCTACCGTC GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAACATC GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC CCACAGCCGCTCCAGTCATGCGTGCGCCCGCCAAGGAGCTGGACAGATCA CCCAGAAGGATTTGGCGCTCACGCAGTTCGGTTTCATTGGCTTCATAACG ATGGGCGCACATCGCATAAAGCTGAAAGATCAGGACTTCCTGGAGGCCAC TACGCATATGTGGCGCGTTCTCGGCTATCTGCTGGGCATCAAGGATGAGT ACAACATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTCCGCCTGGACATT GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGGGGAGGATTT CAAACGAATGACCGAGGCCCTGATTAATGGCTTGTGGCACATAAACACCA TGCTGTCGGTGAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTT AAGGGATACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGACCGATTCA TAGTCAGCTACGGCCTGTTCCTCGTCACATATCTGCACAGGTATGCCCTG GTGCGATGGTACTTGAACTTCCGCGTCTGGCTGGTGGACATATTCACCTA TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCGTATG TGCGGATTTTCAGGAATGGCGGGGAAGCCCAAGACTTTGCCCTGGGCTTG AAGGACGAT >C2 ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCGC AAATCGTGAATCGTGGAACAGTGTGAAAATGCAGTCGTCGTCGCATTCCA AAGATGGTCATAATGGAGTGGGGGCTACCAAACTGCTCCAGGATCACCAG GAGCCCGAGGACTACTTGGAGCACCTGATGAAGGAGGGCAGTCAGGAGGG CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT TCAAGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTCGTAATGAACGCC GGAATGCTGGCTGGACTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG GGTGCTGTCGTGCACACGCCAATCCTGGACAGCGTTCACTGCCTACCGTC GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACTACAACATC GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC CCACAGCCGCTCCAGTCATGCGTGCGCCCGTCAAGGAGCTGGACAGATCA CCCAGAAGGATTTGGCCCTCACACAGTTCGGTTTCATTGGTTTCATAACG ATGGGCGCTCATCGCATAAAGCTGAACGATCAGGTCTTTCTGGAGGCCAC TACGCATATGTGGCGCGTTCTTGGCTATCTGCTGGGCATCAAGGATGAGT ACAATATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTTCGCCTCGACATT GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGATGAGGAATT CAACCGAATGACCGAGGCTCTGATTAATGGCTTGTGGCACATGAACACCA TGCTGTCGGTAAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTC AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGATCGATTCA TAGTCAGCTACGGCCTGTTCATCGTCACATATCTGCACAGGTACGCCCTG GTGCGATGGTACTTGAACTTCCGTGTCTGGCTGGTGGACATACTCACATA TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCGTATG TGCGGATCTTCAGGAAAGGCGGGGAGGCTCAAGACTTTGCACTGGGCTTA AAGGACGAT >C3 ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCAC AAATCGTGAAACGTGGAACAGTGTGAAAATGCAGTCGTCGTCGCATTCCA AAGATGGTCATAATGGAGTGGGGGCTACCAAACTGCTCCAAGATCACCAG GAGCCCGAGGACTACTTGGAGCACCTGATGAAGGAGGGCAGTCAGGAGGG CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT TCAAGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTCGTAATGAACGCC GGAATGCTGGCTGGACTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG TGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACTGCCTACCGTC GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAACATC GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC CCACAGCCGCTCCAGTCATGCGTGCGCCCGACAAGGAGCTGGACAGATCA CCCAGAAGGATTTGGCCCTCACACAGTTCGGTTTCATTGGCTTCATAACG ATGGGCGCTCATCGCATAAAGCTGAACGATCAGGACTTCCTGGAGGCCAC TACGCATATGTGGCGCGTTCTTGGCTATCTGCTGGGCATCAAGGATGAGT ACAATATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTTCGCCTCGACATT GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGATGAGGAATT CAACCGAATGACCAAGGCTCTGATTAATGGCTTGTGGCACATGAACACCA TGCTGTCGGTAAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTC AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGATCGATTAA TAGTCAGCTACGGCCTGTTCCTCGTCACATATCTGCACAGGTACGCCCTG GTGCGATGGTACTTGAACTTCCGTGTCTGGCTGGTGGACATACTCACATA TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCTTATG TGCGGATCTTCAGGAAAGGCGGGGAGGCCCAAGATTTTGCCCTGGGCTTG AAGGACGAT >C4 ATGCAGGTTGATAGTTGCACCAGCAACTCATCTGAGATCCCCGACCCCAC AAAGCGTGAAGCGTGGAACAGTGGGAAAATGCAGTCGTCGCCGCATTCCA AAGATGGTCATAATGCAGCGGGGGCTAGCAAACTGGTCCAGGATCAGCAG GCAGCCGAGGACTACCTGGAGCACCTGATGACGAAGGGCAGTCAGGAGGG CGACAGTGGGGCAGACTTGGAACTACCTTCATGGTACGATGAGCAGCTAT TCAGGCGTGGTCAGAGCTACTTCAGCACGTATCGCTTCGTAATGAACGCC GGAATGCTGGCCGGTCTTATAGCTGTTCTGGCTATTCCCTCTATTCTACG GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCATACCGTC GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAATATC GCGGACCGTGGGAGCAGGTTTTGGACCAGTATTGCGGCCGTGAGACGGGC CCACAGCCGCTCCAGTCATGCTTGCGCCCGCAAAGGAGCTGGACAGATAA CCCAGAAAGATTTGGCCCTCACACAGTTCGGATTTATTGGCTTCATAACG ATGGGCGCTCATCGCATAAAGCTGAACGATCCGGACTTCCTAGAGGCCAC GACGCATATGTGGCGCGTTCTCGGTTATCTGCTGGGCATCAAGGATGAGT ACAACATCTGCGCAAGGAACTGGGCGGAATCAAAGCTTCGCCTGGACATT GTGATGCGAAAGGTATACGAACCAGCTTTGACAAACACTGGTGAGGACTT CTACCGAATGACCGAGGCCTTGATTAATGGATTGTGGCACATGAACACCA TGCTTTCGGTAAACGCCAACATATTCTTCGCCAAGCGATTGGCCTGCGTT AAGGGCTACGAGTACTTCAGTTTCGATCATGAAAACGGCGTGGAACGGGA TCCCCAGCAGAAACTGCACTACTACGACATGGGATGGTGGGATCGTTTCA TAGTCAGCTACGGCCTGTTCCTTGTCACATATCTGCACAGGTACGCCCTG GTGCGATGGTATTTCAACTTCCGCATCTGGCTGGGTGACGTACTGACCTA TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCAAAGTTCGCGTATG TGCGGATCTTCAGGAAGGGAGGGGAGGCCCAAGATTTTACCTCGGGCTTG AAGGACGAT >C5 ATGCAGGTGGATAGTTGCGCAAGCAGCTCATCTGAGATCCCCAACCACAC AAAACGTGAAACGTGGAACAGTGGGAAAATGCAGTCGTCGCCGCATTCCA AAGATGGTCATAATGCAGCGGGGGCTAGCAAACTGGTCCAGGATCAGCAG GCAGCCGAGGACTACTTGCAGCACCTGATGACGGAGGGCAGTCAGGAGGG CGACAGCGGGGCTGACTTGGAGCTACCTTCATGGTACGATGAGCAGCTAT TCAGGCGTGGTCAGAGCTATTTCAGCACGTATCGCTTCGTAATGAACGCC GGAATGCTGGCTGGTCTAATAGCCGTGCTGGCTATTCCCTCTATTCTTCG GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCCTACCGTC GCTATGTGCGCACTATATTCCACACGCAAGCCTGGTATAACCACAACATC GCGGACCGTGGGAGCAGGTTCTGGACCAGTATTGCGGCCGTGAGGCGGGC CCACAGCCGCTCCAGTCATGCGTGCGCTCGCAAAGGAGCTGGACAGATCA CCCAGAAAGATTTGGCTCTCACACAATTTGGATTCATTGGCTTTATAACG ATGGGCGCTCATCGCATAAAGCTTAACGATCCAGACTTCCTGGAGGCCAC GACGCATATGTGGCGCGTTCTCGGCTATCTGCTGGGCATCAAGGATGAGT ACAATATCTGCGGAAGGAACTGGGCGGAATCAAAGCTTCGCCTGGACATT GTGATGCGAAAAGTATATGAACCAGCTCTGACAAACACTGGTGAGGATTT TTACCGAATGACCGAGGCCTTGATTAATGGTTTGTGGCACATGAACACTA TGCTTTCGGTAAACGCCAACATATTCTTCGCCAAGCGATTGGCATGTGTC AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGAGCAGGA TCCTCAGCAGAAACTGCACTACTACGACATGGGATGGTGGGATCGTTTCG TAGTCAGCTACGGCCTGTTCCTTGTCACATATCTGCACAAGTACGCCCTG GTGCGATGGTATTTCAACTTCCGCGTCTGGCTGGTGGACGTACTGACCTA TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCAAGGTTCGCGTATG TGCGGATCTTCAGAAAAGGAGGGGAGGCCCAAGATTTTACCTCGGGCTTG AAGGACGAT >C1 MQVDGCTSSSSEIPHPAKRETWISGKMQSSSHSKDGHNAAGASKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLKDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTGEDFKRMTEALINGLWHINTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL VRWYLNFRVWLVDIFTYYLPYVAIWKFGPKSAYVRIFRNGGEAQDFALGL KDD >C2 MQVDGCTSSSSEIPHPANRESWNSVKMQSSSHSKDGHNGVGATKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSWTAFTAYRRYVRTIFHTQAWYNYNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDQVFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTDEEFNRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFIVTYLHRYAL VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL KDD >C3 MQVDGCTSSSSEIPHPTNRETWNSVKMQSSSHSKDGHNGVGATKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTDEEFNRMTKALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRLIVSYGLFLVTYLHRYAL VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL KDD >C4 MQVDSCTSNSSEIPDPTKREAWNSGKMQSSPHSKDGHNAAGASKLVQDQQ AAEDYLEHLMTKGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICARNWAESKLRLDI VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYFSFDHENGVERDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL VRWYFNFRIWLGDVLTYYLPYVAIWKFGPKFAYVRIFRKGGEAQDFTSGL KDD >C5 MQVDSCASSSSEIPNHTKRETWNSGKMQSSPHSKDGHNAAGASKLVQDQQ AAEDYLQHLMTEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVEQDPQQKLHYYDMGWWDRFVVSYGLFLVTYLHKYAL VRWYFNFRVWLVDVLTYYLPYVAIWKFGPRFAYVRIFRKGGEAQDFTSGL KDD MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 5 taxa and 1209 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1477925720 Setting output file names to "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1329312427 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 7284912462 Seed = 581468397 Swapseed = 1477925720 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 24 unique site patterns Division 2 has 24 unique site patterns Division 3 has 55 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3200.307100 -- -25.624409 Chain 2 -- -3267.722626 -- -25.624409 Chain 3 -- -3247.680214 -- -25.624409 Chain 4 -- -3247.347120 -- -25.624409 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3267.722626 -- -25.624409 Chain 2 -- -3276.080210 -- -25.624409 Chain 3 -- -3068.274125 -- -25.624409 Chain 4 -- -3276.080210 -- -25.624409 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3200.307] (-3267.723) (-3247.680) (-3247.347) * [-3267.723] (-3276.080) (-3068.274) (-3276.080) 500 -- (-2690.009) (-2684.555) (-2681.891) [-2675.866] * (-2677.576) (-2668.772) [-2672.069] (-2676.658) -- 0:00:00 1000 -- (-2672.859) (-2681.591) [-2672.830] (-2666.369) * (-2675.631) (-2660.808) [-2667.862] (-2670.873) -- 0:00:00 1500 -- (-2671.939) (-2663.717) (-2669.447) [-2657.105] * (-2673.835) [-2660.171] (-2662.822) (-2671.411) -- 0:00:00 2000 -- [-2654.923] (-2664.027) (-2657.254) (-2660.461) * (-2665.206) (-2653.014) (-2659.292) [-2648.250] -- 0:00:00 2500 -- (-2652.017) (-2658.308) (-2654.523) [-2652.573] * (-2655.597) [-2647.103] (-2651.115) (-2646.225) -- 0:00:00 3000 -- (-2640.768) (-2655.208) (-2645.290) [-2640.755] * (-2655.017) [-2642.675] (-2648.432) (-2645.001) -- 0:00:00 3500 -- (-2634.186) [-2648.261] (-2648.803) (-2640.118) * [-2646.508] (-2644.067) (-2655.483) (-2643.555) -- 0:04:44 4000 -- (-2640.661) (-2640.810) (-2646.490) [-2638.238] * (-2641.382) (-2636.687) (-2653.946) [-2636.123] -- 0:04:09 4500 -- (-2637.598) [-2637.093] (-2647.182) (-2637.068) * [-2637.095] (-2640.120) (-2648.088) (-2645.592) -- 0:03:41 5000 -- (-2643.643) [-2637.310] (-2644.455) (-2641.847) * (-2640.338) [-2641.160] (-2640.413) (-2645.421) -- 0:03:19 Average standard deviation of split frequencies: 0.000000 5500 -- (-2651.908) [-2635.915] (-2642.775) (-2644.285) * [-2635.385] (-2638.999) (-2647.394) (-2641.519) -- 0:03:00 6000 -- (-2642.307) (-2636.422) [-2641.422] (-2645.780) * (-2643.740) (-2635.077) [-2636.934] (-2641.998) -- 0:02:45 6500 -- (-2644.950) [-2642.306] (-2645.451) (-2646.195) * (-2646.639) (-2640.632) [-2640.611] (-2640.817) -- 0:02:32 7000 -- (-2635.579) [-2634.031] (-2640.593) (-2648.028) * (-2647.827) (-2637.734) [-2643.670] (-2638.398) -- 0:02:21 7500 -- (-2642.409) [-2640.641] (-2644.692) (-2646.401) * (-2646.413) [-2641.309] (-2640.931) (-2642.591) -- 0:02:12 8000 -- (-2640.455) [-2649.471] (-2640.550) (-2645.778) * (-2641.467) [-2636.114] (-2642.734) (-2635.668) -- 0:04:08 8500 -- (-2637.160) (-2642.036) [-2643.020] (-2641.563) * [-2639.513] (-2641.001) (-2644.695) (-2637.342) -- 0:03:53 9000 -- [-2642.416] (-2644.833) (-2640.627) (-2642.867) * (-2639.066) (-2637.970) (-2639.448) [-2634.554] -- 0:03:40 9500 -- (-2642.919) [-2640.083] (-2639.029) (-2642.911) * (-2643.702) (-2643.923) [-2634.665] (-2639.663) -- 0:03:28 10000 -- (-2640.559) (-2643.847) (-2637.767) [-2636.816] * (-2641.876) (-2643.499) (-2641.588) [-2640.943] -- 0:03:18 Average standard deviation of split frequencies: 0.000000 10500 -- (-2638.493) (-2645.629) [-2639.620] (-2637.358) * (-2639.167) (-2639.681) (-2645.219) [-2640.663] -- 0:03:08 11000 -- [-2641.517] (-2648.051) (-2640.681) (-2640.442) * (-2640.223) [-2641.981] (-2644.596) (-2637.477) -- 0:02:59 11500 -- (-2636.198) [-2649.015] (-2643.708) (-2648.398) * (-2644.949) [-2641.670] (-2641.758) (-2642.816) -- 0:02:51 12000 -- (-2638.572) (-2642.195) [-2639.702] (-2641.638) * (-2651.531) (-2644.561) (-2643.410) [-2638.891] -- 0:02:44 12500 -- (-2635.038) [-2637.293] (-2641.398) (-2638.432) * [-2641.414] (-2643.753) (-2638.282) (-2640.268) -- 0:03:57 13000 -- (-2637.083) [-2639.778] (-2638.061) (-2643.804) * (-2642.675) (-2638.253) (-2640.431) [-2638.227] -- 0:03:47 13500 -- [-2638.591] (-2642.809) (-2647.945) (-2650.765) * (-2648.522) [-2641.022] (-2638.865) (-2643.217) -- 0:03:39 14000 -- [-2632.173] (-2644.099) (-2640.719) (-2644.084) * [-2643.684] (-2641.862) (-2637.998) (-2639.398) -- 0:03:31 14500 -- (-2638.703) (-2656.385) (-2639.218) [-2635.513] * (-2638.381) (-2641.264) [-2639.548] (-2641.374) -- 0:03:23 15000 -- [-2642.046] (-2640.131) (-2645.152) (-2642.533) * [-2640.224] (-2641.493) (-2641.283) (-2638.258) -- 0:03:17 Average standard deviation of split frequencies: 0.000000 15500 -- (-2636.893) [-2636.701] (-2641.526) (-2635.222) * (-2640.058) (-2641.285) [-2638.763] (-2641.676) -- 0:03:10 16000 -- (-2649.483) (-2640.678) (-2638.494) [-2637.154] * (-2639.930) (-2647.348) [-2635.761] (-2643.016) -- 0:03:04 16500 -- (-2640.577) (-2642.311) (-2643.565) [-2638.645] * (-2636.210) (-2649.059) [-2645.435] (-2644.501) -- 0:02:58 17000 -- (-2653.315) (-2643.353) [-2644.313] (-2640.313) * [-2635.408] (-2652.335) (-2638.242) (-2641.598) -- 0:02:53 17500 -- (-2645.151) (-2641.166) [-2642.584] (-2638.057) * (-2637.703) (-2640.517) [-2640.607] (-2636.033) -- 0:03:44 18000 -- (-2642.968) (-2635.744) (-2640.676) [-2638.936] * (-2636.223) [-2639.387] (-2635.051) (-2641.396) -- 0:03:38 18500 -- (-2639.527) (-2639.418) (-2645.384) [-2636.176] * (-2637.572) (-2639.857) [-2634.516] (-2641.004) -- 0:03:32 19000 -- [-2636.930] (-2638.733) (-2645.077) (-2641.924) * (-2637.015) [-2636.830] (-2638.640) (-2641.551) -- 0:03:26 19500 -- (-2639.201) (-2640.885) (-2651.467) [-2637.488] * (-2637.077) (-2635.384) [-2636.532] (-2649.374) -- 0:03:21 20000 -- (-2641.423) (-2644.312) [-2641.944] (-2635.041) * (-2637.784) [-2640.331] (-2645.449) (-2644.281) -- 0:03:16 Average standard deviation of split frequencies: 0.000000 20500 -- (-2634.608) (-2643.995) (-2640.528) [-2640.955] * (-2640.653) [-2636.822] (-2639.083) (-2638.244) -- 0:03:11 21000 -- [-2637.228] (-2645.101) (-2640.060) (-2642.505) * (-2638.472) [-2638.962] (-2653.123) (-2644.439) -- 0:03:06 21500 -- (-2636.761) [-2636.266] (-2640.730) (-2642.669) * [-2641.600] (-2639.577) (-2645.386) (-2645.305) -- 0:03:02 22000 -- [-2636.359] (-2641.106) (-2640.935) (-2642.511) * (-2638.425) (-2641.806) [-2646.291] (-2645.596) -- 0:02:57 22500 -- [-2640.210] (-2643.541) (-2641.619) (-2643.179) * (-2639.787) [-2636.115] (-2644.372) (-2640.591) -- 0:03:37 23000 -- (-2640.959) (-2640.889) (-2652.467) [-2640.230] * (-2648.194) (-2640.000) (-2635.720) [-2638.443] -- 0:03:32 23500 -- (-2642.515) (-2637.164) (-2641.199) [-2640.010] * (-2640.728) (-2638.569) [-2640.367] (-2643.125) -- 0:03:27 24000 -- (-2634.202) (-2639.149) [-2640.710] (-2641.414) * [-2636.418] (-2639.021) (-2637.315) (-2643.463) -- 0:03:23 24500 -- (-2646.075) (-2640.615) [-2643.105] (-2636.869) * [-2638.844] (-2643.594) (-2638.228) (-2641.832) -- 0:03:19 25000 -- (-2641.672) (-2638.421) [-2633.931] (-2639.817) * [-2640.884] (-2644.132) (-2642.488) (-2636.985) -- 0:03:15 Average standard deviation of split frequencies: 0.000000 25500 -- (-2641.566) (-2645.358) (-2644.869) [-2643.715] * (-2639.727) (-2642.263) (-2637.693) [-2638.109] -- 0:03:11 26000 -- (-2634.549) (-2645.814) [-2641.534] (-2636.645) * (-2634.726) (-2636.087) [-2641.156] (-2645.671) -- 0:03:07 26500 -- (-2639.753) (-2640.943) [-2635.842] (-2643.941) * (-2633.407) [-2640.619] (-2637.286) (-2646.037) -- 0:03:03 27000 -- [-2636.657] (-2642.657) (-2638.556) (-2641.554) * [-2632.739] (-2640.433) (-2635.577) (-2637.086) -- 0:03:36 27500 -- (-2637.271) (-2643.416) (-2639.634) [-2641.454] * (-2635.942) [-2634.855] (-2641.598) (-2638.805) -- 0:03:32 28000 -- [-2635.847] (-2640.778) (-2644.519) (-2640.649) * (-2641.840) (-2641.094) [-2639.252] (-2639.026) -- 0:03:28 28500 -- [-2637.987] (-2635.224) (-2645.273) (-2647.249) * [-2637.306] (-2638.697) (-2638.531) (-2644.013) -- 0:03:24 29000 -- [-2638.909] (-2639.746) (-2641.694) (-2641.833) * (-2641.132) [-2638.990] (-2636.665) (-2644.646) -- 0:03:20 29500 -- (-2649.531) (-2637.737) (-2646.358) [-2637.626] * (-2635.147) (-2641.801) (-2639.991) [-2641.758] -- 0:03:17 30000 -- (-2648.242) [-2639.169] (-2640.230) (-2647.680) * (-2642.843) (-2637.310) [-2634.592] (-2636.254) -- 0:03:14 Average standard deviation of split frequencies: 0.000000 30500 -- (-2638.431) (-2644.466) [-2641.957] (-2641.616) * (-2640.827) (-2638.057) (-2640.818) [-2637.923] -- 0:03:10 31000 -- (-2639.479) [-2639.146] (-2641.930) (-2654.125) * (-2639.221) (-2635.852) (-2636.055) [-2633.015] -- 0:03:07 31500 -- (-2649.297) (-2644.194) (-2636.966) [-2637.584] * [-2640.345] (-2637.054) (-2647.958) (-2638.618) -- 0:03:04 32000 -- [-2644.552] (-2641.480) (-2641.591) (-2636.199) * (-2638.885) (-2640.465) (-2642.898) [-2636.802] -- 0:03:31 32500 -- (-2642.594) (-2640.950) [-2637.647] (-2641.672) * (-2641.487) (-2637.378) [-2640.474] (-2644.011) -- 0:03:28 33000 -- [-2637.086] (-2638.239) (-2637.807) (-2641.090) * (-2647.067) (-2641.159) (-2640.010) [-2638.306] -- 0:03:25 33500 -- [-2639.881] (-2639.297) (-2645.343) (-2644.037) * (-2640.616) (-2639.457) (-2634.893) [-2637.872] -- 0:03:21 34000 -- (-2636.565) [-2636.497] (-2638.759) (-2636.873) * [-2637.301] (-2637.539) (-2635.556) (-2644.207) -- 0:03:18 34500 -- (-2637.292) [-2646.046] (-2638.793) (-2638.113) * (-2635.766) (-2635.019) (-2636.419) [-2641.670] -- 0:03:15 35000 -- [-2635.116] (-2639.704) (-2636.768) (-2641.803) * [-2637.172] (-2637.368) (-2636.538) (-2646.565) -- 0:03:13 Average standard deviation of split frequencies: 0.000000 35500 -- (-2636.916) [-2645.481] (-2644.898) (-2644.457) * (-2639.346) [-2638.246] (-2636.001) (-2643.306) -- 0:03:10 36000 -- [-2638.259] (-2643.015) (-2642.059) (-2645.184) * [-2636.623] (-2638.509) (-2641.314) (-2647.348) -- 0:03:07 36500 -- [-2642.978] (-2640.240) (-2638.661) (-2643.280) * (-2640.664) [-2639.793] (-2637.891) (-2647.776) -- 0:03:31 37000 -- (-2641.907) (-2645.851) [-2637.606] (-2639.269) * (-2641.479) (-2641.582) [-2637.190] (-2644.679) -- 0:03:28 37500 -- [-2642.748] (-2647.375) (-2638.409) (-2640.570) * (-2647.474) (-2639.432) (-2638.955) [-2639.900] -- 0:03:25 38000 -- [-2637.995] (-2644.299) (-2640.612) (-2635.234) * (-2639.160) (-2643.656) [-2636.527] (-2646.546) -- 0:03:22 38500 -- [-2641.779] (-2638.389) (-2636.602) (-2638.410) * (-2636.846) [-2633.699] (-2640.100) (-2646.504) -- 0:03:19 39000 -- (-2647.829) (-2637.999) (-2641.244) [-2636.335] * (-2641.939) [-2644.445] (-2642.323) (-2645.482) -- 0:03:17 39500 -- (-2643.773) [-2638.312] (-2641.119) (-2641.828) * (-2639.888) [-2639.284] (-2636.132) (-2638.423) -- 0:03:14 40000 -- (-2639.117) (-2636.499) (-2637.524) [-2638.289] * (-2646.067) (-2636.222) [-2638.630] (-2636.954) -- 0:03:12 Average standard deviation of split frequencies: 0.000000 40500 -- (-2635.421) (-2638.146) (-2641.863) [-2639.114] * (-2640.508) (-2639.163) [-2639.874] (-2640.012) -- 0:03:09 41000 -- (-2638.360) [-2639.089] (-2638.123) (-2641.928) * [-2644.653] (-2644.198) (-2641.425) (-2641.253) -- 0:03:07 41500 -- (-2640.179) (-2639.423) [-2642.424] (-2638.097) * (-2642.463) (-2634.453) [-2635.329] (-2644.993) -- 0:03:27 42000 -- [-2642.460] (-2638.431) (-2641.125) (-2640.004) * (-2638.226) [-2633.112] (-2638.752) (-2642.394) -- 0:03:25 42500 -- (-2642.575) (-2642.222) [-2639.331] (-2638.249) * (-2639.946) (-2637.705) [-2639.462] (-2646.772) -- 0:03:22 43000 -- (-2643.045) (-2642.387) [-2638.691] (-2637.540) * (-2634.997) [-2635.986] (-2643.824) (-2640.599) -- 0:03:20 43500 -- (-2637.091) (-2634.872) (-2640.010) [-2638.445] * (-2635.702) [-2643.076] (-2640.374) (-2635.855) -- 0:03:17 44000 -- (-2643.852) [-2642.894] (-2639.391) (-2641.148) * [-2639.005] (-2640.292) (-2642.014) (-2641.224) -- 0:03:15 44500 -- (-2638.388) (-2637.477) (-2645.205) [-2637.306] * (-2639.402) [-2638.626] (-2645.291) (-2644.908) -- 0:03:13 45000 -- (-2636.408) (-2638.076) [-2642.042] (-2637.691) * (-2639.918) (-2642.791) [-2638.522] (-2644.324) -- 0:03:11 Average standard deviation of split frequencies: 0.000000 45500 -- (-2641.477) (-2640.491) (-2638.747) [-2639.387] * [-2638.900] (-2647.048) (-2636.145) (-2641.832) -- 0:03:08 46000 -- [-2640.368] (-2642.800) (-2643.484) (-2635.560) * (-2639.628) (-2641.297) [-2638.919] (-2639.332) -- 0:03:27 46500 -- (-2636.316) (-2639.905) [-2636.158] (-2636.156) * [-2635.327] (-2639.317) (-2641.638) (-2638.111) -- 0:03:25 47000 -- [-2642.122] (-2638.585) (-2639.737) (-2635.105) * (-2641.521) (-2640.631) (-2639.718) [-2644.761] -- 0:03:22 47500 -- (-2636.809) (-2634.690) [-2638.756] (-2640.624) * (-2639.000) [-2645.328] (-2640.712) (-2647.117) -- 0:03:20 48000 -- (-2646.055) [-2637.119] (-2640.405) (-2645.802) * [-2643.887] (-2640.754) (-2643.282) (-2639.328) -- 0:03:18 48500 -- [-2636.742] (-2644.093) (-2635.389) (-2638.605) * (-2640.564) (-2640.714) (-2647.172) [-2641.282] -- 0:03:16 49000 -- (-2640.811) (-2643.736) (-2645.462) [-2639.574] * (-2645.024) (-2641.750) [-2642.928] (-2636.305) -- 0:03:14 49500 -- (-2638.864) (-2642.348) [-2649.304] (-2648.355) * (-2643.594) (-2645.086) [-2639.803] (-2641.233) -- 0:03:12 50000 -- [-2639.806] (-2636.335) (-2643.651) (-2656.818) * (-2638.455) (-2642.802) (-2640.637) [-2634.168] -- 0:03:10 Average standard deviation of split frequencies: 0.000000 50500 -- [-2635.617] (-2641.534) (-2644.046) (-2646.035) * (-2637.918) (-2639.580) [-2643.371] (-2640.185) -- 0:03:08 51000 -- (-2647.573) [-2642.414] (-2637.239) (-2641.410) * [-2640.025] (-2638.328) (-2642.993) (-2639.583) -- 0:03:24 51500 -- (-2644.435) [-2642.968] (-2648.508) (-2638.558) * (-2638.818) (-2637.525) [-2640.763] (-2637.576) -- 0:03:22 52000 -- [-2639.569] (-2641.292) (-2647.021) (-2641.501) * (-2639.995) [-2635.091] (-2637.038) (-2641.222) -- 0:03:20 52500 -- (-2645.548) [-2644.304] (-2636.898) (-2636.715) * [-2640.966] (-2636.929) (-2639.296) (-2640.646) -- 0:03:18 53000 -- (-2641.343) (-2636.569) [-2636.690] (-2640.099) * (-2641.242) (-2639.673) [-2638.751] (-2643.366) -- 0:03:16 53500 -- [-2643.918] (-2645.209) (-2639.990) (-2638.069) * (-2642.921) (-2642.087) [-2636.240] (-2639.145) -- 0:03:14 54000 -- (-2641.139) (-2642.658) (-2647.965) [-2640.523] * (-2637.834) (-2640.866) [-2636.290] (-2644.625) -- 0:03:12 54500 -- (-2639.674) (-2639.829) (-2646.774) [-2640.929] * (-2636.678) (-2635.395) [-2641.669] (-2640.766) -- 0:03:10 55000 -- (-2645.129) (-2644.834) (-2636.605) [-2642.259] * [-2640.680] (-2638.488) (-2638.863) (-2639.663) -- 0:03:09 Average standard deviation of split frequencies: 0.000000 55500 -- (-2638.568) [-2636.628] (-2635.921) (-2645.165) * (-2640.025) [-2638.064] (-2638.969) (-2635.627) -- 0:03:24 56000 -- (-2638.744) (-2636.320) [-2639.164] (-2645.500) * (-2641.287) [-2643.263] (-2642.381) (-2638.463) -- 0:03:22 56500 -- (-2637.178) [-2645.462] (-2641.054) (-2649.430) * (-2639.239) (-2636.826) [-2637.802] (-2644.154) -- 0:03:20 57000 -- (-2639.100) (-2644.814) [-2638.543] (-2642.413) * (-2632.813) (-2639.067) (-2639.250) [-2640.201] -- 0:03:18 57500 -- (-2641.521) [-2634.932] (-2642.376) (-2651.728) * (-2642.512) [-2636.717] (-2636.035) (-2642.532) -- 0:03:16 58000 -- [-2638.186] (-2639.571) (-2640.554) (-2642.024) * (-2642.811) (-2639.053) (-2641.620) [-2640.273] -- 0:03:14 58500 -- [-2637.240] (-2639.925) (-2636.144) (-2640.631) * (-2642.244) (-2636.675) [-2640.914] (-2642.903) -- 0:03:13 59000 -- (-2642.756) (-2643.884) (-2633.624) [-2637.806] * (-2640.653) (-2647.284) (-2646.318) [-2641.133] -- 0:03:11 59500 -- (-2646.570) (-2639.648) [-2635.041] (-2640.284) * [-2640.187] (-2643.200) (-2645.409) (-2642.017) -- 0:03:09 60000 -- (-2636.110) (-2640.940) [-2635.235] (-2639.684) * (-2638.589) (-2652.119) [-2645.471] (-2641.347) -- 0:03:08 Average standard deviation of split frequencies: 0.000000 60500 -- [-2639.504] (-2638.782) (-2645.812) (-2644.086) * (-2639.165) (-2641.903) (-2640.474) [-2642.488] -- 0:03:21 61000 -- (-2633.069) [-2637.496] (-2641.776) (-2640.318) * [-2645.503] (-2636.888) (-2647.794) (-2638.174) -- 0:03:20 61500 -- (-2638.637) [-2633.432] (-2643.505) (-2644.196) * (-2644.931) (-2648.698) [-2642.499] (-2637.079) -- 0:03:18 62000 -- (-2643.061) [-2637.491] (-2643.812) (-2643.264) * [-2640.895] (-2644.848) (-2640.162) (-2649.310) -- 0:03:16 62500 -- (-2643.274) [-2635.752] (-2640.344) (-2641.493) * [-2638.280] (-2637.687) (-2633.913) (-2642.645) -- 0:03:15 63000 -- (-2637.355) [-2643.622] (-2636.102) (-2641.534) * (-2636.491) [-2634.024] (-2638.545) (-2639.906) -- 0:03:13 63500 -- (-2639.080) (-2640.025) (-2636.482) [-2642.267] * (-2640.855) (-2637.204) [-2636.556] (-2632.877) -- 0:03:11 64000 -- (-2643.287) (-2641.271) [-2636.282] (-2642.554) * (-2640.477) (-2636.240) [-2635.192] (-2642.709) -- 0:03:10 64500 -- [-2640.574] (-2644.944) (-2639.259) (-2642.173) * (-2641.106) (-2640.802) (-2639.186) [-2644.170] -- 0:03:08 65000 -- (-2644.902) (-2636.429) (-2648.442) [-2640.765] * (-2645.197) (-2637.872) (-2644.255) [-2641.280] -- 0:03:21 Average standard deviation of split frequencies: 0.003571 65500 -- (-2645.480) (-2643.215) (-2638.625) [-2640.576] * (-2643.304) (-2641.041) (-2638.549) [-2637.108] -- 0:03:19 66000 -- (-2638.746) (-2641.458) [-2643.479] (-2633.516) * [-2638.944] (-2640.134) (-2642.409) (-2648.226) -- 0:03:18 66500 -- [-2634.776] (-2637.423) (-2636.939) (-2633.915) * [-2641.931] (-2641.942) (-2647.363) (-2648.472) -- 0:03:16 67000 -- [-2633.547] (-2637.433) (-2641.792) (-2638.006) * (-2644.290) (-2644.328) (-2637.913) [-2639.222] -- 0:03:14 67500 -- (-2642.898) (-2646.189) (-2645.105) [-2640.665] * [-2635.734] (-2643.216) (-2639.899) (-2638.668) -- 0:03:13 68000 -- [-2643.805] (-2637.817) (-2644.134) (-2641.764) * [-2636.018] (-2637.995) (-2638.896) (-2652.584) -- 0:03:11 68500 -- (-2641.682) (-2636.672) (-2640.024) [-2640.734] * (-2635.635) (-2633.929) (-2641.356) [-2643.837] -- 0:03:10 69000 -- (-2640.687) [-2642.247] (-2639.640) (-2642.124) * (-2639.003) [-2636.556] (-2641.596) (-2646.261) -- 0:03:08 69500 -- (-2642.949) (-2639.170) (-2634.705) [-2640.872] * [-2636.010] (-2635.423) (-2643.694) (-2638.554) -- 0:03:20 70000 -- (-2641.788) [-2638.651] (-2638.572) (-2645.527) * (-2638.017) (-2641.254) [-2641.232] (-2636.785) -- 0:03:19 Average standard deviation of split frequencies: 0.003335 70500 -- (-2640.502) [-2634.430] (-2648.989) (-2644.191) * (-2635.828) [-2642.133] (-2647.856) (-2644.503) -- 0:03:17 71000 -- (-2641.846) (-2641.203) (-2648.883) [-2640.632] * (-2644.559) [-2637.476] (-2646.083) (-2638.461) -- 0:03:16 71500 -- [-2636.739] (-2646.556) (-2642.706) (-2636.208) * (-2639.572) (-2640.082) (-2641.732) [-2642.868] -- 0:03:14 72000 -- (-2639.298) (-2634.288) (-2639.120) [-2636.150] * (-2641.016) [-2640.811] (-2644.001) (-2645.201) -- 0:03:13 72500 -- (-2637.159) (-2639.530) (-2638.700) [-2636.793] * (-2643.597) (-2640.845) [-2639.371] (-2638.463) -- 0:03:11 73000 -- (-2641.390) [-2639.644] (-2642.735) (-2639.064) * (-2638.154) [-2640.761] (-2642.561) (-2641.416) -- 0:03:10 73500 -- (-2641.978) [-2641.459] (-2636.722) (-2641.054) * (-2639.318) (-2646.460) (-2641.089) [-2639.728] -- 0:03:09 74000 -- [-2641.146] (-2641.504) (-2638.515) (-2644.726) * (-2634.800) (-2638.753) [-2641.865] (-2643.152) -- 0:03:07 74500 -- (-2650.125) (-2645.973) (-2639.080) [-2637.236] * (-2638.804) [-2641.640] (-2643.196) (-2643.327) -- 0:03:18 75000 -- (-2639.010) [-2640.111] (-2637.816) (-2640.390) * (-2641.167) (-2637.412) [-2637.432] (-2644.162) -- 0:03:17 Average standard deviation of split frequencies: 0.003101 75500 -- (-2645.182) (-2647.062) (-2639.204) [-2642.319] * (-2642.199) (-2638.697) (-2645.524) [-2649.090] -- 0:03:15 76000 -- (-2637.874) (-2642.805) (-2643.534) [-2641.272] * (-2642.944) [-2639.732] (-2642.483) (-2645.473) -- 0:03:14 76500 -- (-2637.903) [-2632.558] (-2641.228) (-2641.305) * (-2636.019) [-2641.313] (-2637.986) (-2640.083) -- 0:03:13 77000 -- (-2634.760) [-2636.431] (-2637.961) (-2637.597) * [-2635.671] (-2647.030) (-2650.571) (-2637.489) -- 0:03:11 77500 -- (-2639.270) (-2642.925) [-2637.332] (-2641.028) * (-2641.707) [-2637.864] (-2644.411) (-2635.879) -- 0:03:10 78000 -- [-2645.772] (-2636.484) (-2644.739) (-2635.152) * [-2641.065] (-2642.279) (-2640.699) (-2642.557) -- 0:03:09 78500 -- (-2641.023) (-2637.092) [-2641.271] (-2647.332) * (-2640.118) (-2642.156) [-2645.959] (-2645.440) -- 0:03:07 79000 -- (-2637.519) (-2640.935) (-2641.463) [-2647.432] * (-2643.339) (-2644.178) (-2636.630) [-2638.450] -- 0:03:06 79500 -- [-2636.601] (-2645.483) (-2649.546) (-2641.358) * (-2649.539) (-2645.785) [-2636.838] (-2636.293) -- 0:03:16 80000 -- [-2636.147] (-2648.961) (-2640.604) (-2639.729) * (-2635.229) [-2637.714] (-2637.967) (-2636.746) -- 0:03:15 Average standard deviation of split frequencies: 0.002922 80500 -- [-2636.707] (-2646.234) (-2643.548) (-2641.489) * (-2639.880) [-2635.055] (-2646.231) (-2636.380) -- 0:03:14 81000 -- (-2639.839) (-2646.307) (-2640.712) [-2641.871] * [-2637.549] (-2637.492) (-2643.436) (-2642.597) -- 0:03:12 81500 -- (-2641.613) [-2644.073] (-2654.185) (-2643.485) * [-2636.789] (-2642.071) (-2641.063) (-2643.744) -- 0:03:11 82000 -- (-2636.159) [-2640.751] (-2651.502) (-2637.475) * (-2642.396) [-2640.646] (-2644.182) (-2643.630) -- 0:03:10 82500 -- (-2639.713) [-2637.664] (-2645.282) (-2636.283) * (-2641.684) (-2640.451) (-2637.891) [-2640.195] -- 0:03:09 83000 -- (-2641.445) (-2639.439) (-2640.245) [-2633.898] * (-2640.591) (-2643.625) (-2635.118) [-2639.388] -- 0:03:07 83500 -- (-2639.217) (-2636.714) [-2640.623] (-2638.021) * [-2642.318] (-2651.060) (-2636.744) (-2644.990) -- 0:03:06 84000 -- (-2637.887) [-2638.008] (-2639.487) (-2655.728) * (-2638.069) (-2644.288) [-2639.083] (-2642.735) -- 0:03:16 84500 -- [-2639.053] (-2642.995) (-2644.977) (-2645.818) * (-2645.028) (-2641.817) [-2639.017] (-2643.021) -- 0:03:15 85000 -- (-2635.881) (-2643.183) [-2636.592] (-2650.577) * [-2637.383] (-2637.478) (-2643.924) (-2644.032) -- 0:03:13 Average standard deviation of split frequencies: 0.002741 85500 -- (-2636.855) (-2646.225) [-2635.971] (-2647.218) * (-2640.045) (-2635.884) [-2639.420] (-2643.431) -- 0:03:12 86000 -- [-2637.986] (-2652.084) (-2641.984) (-2643.455) * (-2641.418) (-2638.189) [-2635.229] (-2638.147) -- 0:03:11 86500 -- (-2640.324) [-2650.135] (-2638.752) (-2648.885) * (-2642.727) (-2637.819) [-2635.507] (-2639.064) -- 0:03:10 87000 -- (-2639.681) (-2646.999) [-2638.543] (-2649.270) * [-2639.873] (-2637.503) (-2635.710) (-2639.224) -- 0:03:08 87500 -- (-2639.077) (-2642.483) [-2635.597] (-2645.704) * [-2646.333] (-2636.560) (-2643.526) (-2635.114) -- 0:03:07 88000 -- [-2640.313] (-2650.280) (-2646.487) (-2646.434) * (-2637.657) [-2633.748] (-2638.874) (-2636.389) -- 0:03:06 88500 -- (-2639.829) (-2649.887) [-2639.218] (-2641.149) * (-2642.821) (-2638.154) [-2637.533] (-2642.232) -- 0:03:05 89000 -- (-2646.468) (-2644.182) (-2641.977) [-2637.533] * (-2644.125) [-2640.363] (-2636.385) (-2649.412) -- 0:03:14 89500 -- (-2640.391) (-2636.752) (-2635.844) [-2640.457] * (-2638.375) (-2647.665) (-2636.297) [-2644.965] -- 0:03:13 90000 -- (-2638.318) (-2640.334) (-2634.736) [-2637.126] * [-2640.699] (-2637.909) (-2637.622) (-2644.505) -- 0:03:12 Average standard deviation of split frequencies: 0.002600 90500 -- (-2641.615) (-2639.763) [-2633.472] (-2637.088) * (-2639.785) (-2639.653) [-2644.889] (-2643.331) -- 0:03:10 91000 -- (-2641.060) (-2645.520) [-2635.874] (-2641.851) * [-2636.114] (-2640.398) (-2635.190) (-2644.388) -- 0:03:09 91500 -- (-2638.566) (-2638.773) [-2638.618] (-2640.535) * (-2647.228) (-2640.596) [-2639.360] (-2646.041) -- 0:03:08 92000 -- [-2646.732] (-2639.810) (-2639.048) (-2639.284) * (-2636.895) [-2634.255] (-2641.055) (-2643.866) -- 0:03:07 92500 -- (-2637.384) (-2638.142) (-2641.212) [-2635.870] * (-2645.991) [-2639.638] (-2638.184) (-2644.061) -- 0:03:06 93000 -- (-2639.710) (-2640.559) [-2640.037] (-2638.535) * (-2649.295) (-2641.430) [-2636.768] (-2647.571) -- 0:03:05 93500 -- (-2645.803) (-2638.313) [-2638.134] (-2640.421) * [-2640.192] (-2635.537) (-2636.224) (-2637.293) -- 0:03:04 94000 -- (-2645.653) (-2641.241) (-2642.744) [-2636.396] * (-2648.844) [-2637.097] (-2645.936) (-2638.978) -- 0:03:12 94500 -- (-2646.623) [-2639.293] (-2640.994) (-2639.969) * (-2641.580) (-2646.867) [-2638.806] (-2640.105) -- 0:03:11 95000 -- (-2642.863) (-2643.080) [-2637.497] (-2639.852) * (-2638.949) [-2636.101] (-2637.272) (-2636.381) -- 0:03:10 Average standard deviation of split frequencies: 0.002455 95500 -- [-2641.385] (-2639.806) (-2639.599) (-2636.810) * (-2638.753) [-2637.034] (-2634.174) (-2640.859) -- 0:03:09 96000 -- (-2642.120) (-2638.623) [-2637.727] (-2635.373) * [-2634.325] (-2635.254) (-2640.501) (-2641.310) -- 0:03:08 96500 -- (-2642.496) (-2639.023) (-2643.627) [-2636.775] * (-2634.923) (-2643.245) (-2642.930) [-2633.325] -- 0:03:07 97000 -- (-2642.689) [-2642.991] (-2649.233) (-2647.777) * (-2637.091) [-2643.534] (-2643.264) (-2637.453) -- 0:03:06 97500 -- [-2638.366] (-2640.368) (-2638.114) (-2638.410) * (-2641.795) (-2648.616) (-2638.286) [-2642.488] -- 0:03:05 98000 -- (-2641.889) [-2640.878] (-2642.742) (-2644.848) * (-2638.760) [-2653.891] (-2642.631) (-2641.333) -- 0:03:04 98500 -- (-2639.403) [-2636.776] (-2638.770) (-2642.571) * (-2639.587) (-2649.437) [-2636.163] (-2635.664) -- 0:03:12 99000 -- (-2639.025) [-2637.523] (-2641.605) (-2635.029) * [-2642.609] (-2645.150) (-2636.598) (-2643.770) -- 0:03:11 99500 -- (-2642.859) (-2638.457) (-2633.596) [-2637.261] * (-2638.252) (-2651.632) (-2646.393) [-2638.236] -- 0:03:10 100000 -- [-2639.694] (-2640.124) (-2637.973) (-2637.237) * (-2637.535) (-2645.168) (-2645.059) [-2635.551] -- 0:03:09 Average standard deviation of split frequencies: 0.002341 100500 -- (-2634.353) [-2647.189] (-2640.600) (-2634.753) * (-2636.275) (-2648.074) [-2635.276] (-2638.847) -- 0:03:07 101000 -- (-2636.538) [-2649.197] (-2639.552) (-2638.304) * (-2637.145) [-2642.092] (-2639.447) (-2638.339) -- 0:03:06 101500 -- (-2648.791) (-2645.952) [-2631.929] (-2642.253) * (-2649.263) (-2643.282) (-2645.147) [-2641.514] -- 0:03:05 102000 -- (-2642.758) (-2641.981) (-2636.707) [-2637.855] * (-2639.661) [-2641.426] (-2643.478) (-2639.654) -- 0:03:04 102500 -- (-2643.366) (-2638.798) (-2639.284) [-2640.175] * (-2642.683) (-2640.674) [-2640.647] (-2643.637) -- 0:03:03 103000 -- (-2644.888) (-2639.078) [-2643.592] (-2640.624) * (-2635.973) (-2639.909) (-2637.767) [-2636.628] -- 0:03:02 103500 -- [-2639.221] (-2634.603) (-2640.807) (-2643.394) * (-2633.132) [-2641.738] (-2637.430) (-2641.091) -- 0:03:10 104000 -- [-2635.639] (-2641.988) (-2637.792) (-2639.339) * [-2639.570] (-2641.968) (-2639.851) (-2645.322) -- 0:03:09 104500 -- (-2638.984) (-2639.368) [-2638.413] (-2638.108) * (-2638.374) [-2638.258] (-2642.833) (-2637.377) -- 0:03:08 105000 -- (-2640.517) (-2642.467) (-2636.172) [-2641.515] * (-2641.269) [-2641.744] (-2642.922) (-2644.181) -- 0:03:07 Average standard deviation of split frequencies: 0.002224 105500 -- (-2638.876) [-2638.675] (-2644.910) (-2641.746) * (-2640.297) [-2639.603] (-2639.645) (-2644.772) -- 0:03:06 106000 -- (-2641.069) (-2634.638) (-2639.401) [-2636.658] * (-2638.335) (-2641.455) (-2644.707) [-2636.173] -- 0:03:05 106500 -- [-2636.942] (-2638.086) (-2643.463) (-2637.044) * (-2638.082) [-2644.780] (-2640.328) (-2637.573) -- 0:03:04 107000 -- (-2638.804) (-2642.314) [-2640.237] (-2647.023) * (-2639.982) (-2637.967) [-2643.474] (-2638.557) -- 0:03:03 107500 -- [-2639.886] (-2637.943) (-2641.913) (-2637.998) * (-2642.505) (-2636.104) (-2639.622) [-2642.163] -- 0:03:02 108000 -- (-2636.206) [-2637.709] (-2639.880) (-2637.304) * (-2634.548) [-2638.468] (-2640.979) (-2637.519) -- 0:03:09 108500 -- (-2640.645) (-2641.059) (-2637.156) [-2642.635] * [-2636.972] (-2636.007) (-2646.472) (-2638.128) -- 0:03:08 109000 -- (-2638.448) (-2644.435) (-2635.445) [-2643.905] * [-2640.172] (-2638.622) (-2635.961) (-2636.667) -- 0:03:08 109500 -- (-2641.415) (-2635.461) (-2648.059) [-2639.311] * [-2640.918] (-2643.195) (-2636.651) (-2641.672) -- 0:03:07 110000 -- [-2638.120] (-2640.706) (-2639.253) (-2637.520) * (-2637.871) (-2636.226) [-2635.372] (-2644.069) -- 0:03:06 Average standard deviation of split frequencies: 0.002130 110500 -- [-2639.009] (-2647.922) (-2637.750) (-2632.227) * [-2641.505] (-2640.141) (-2636.716) (-2641.726) -- 0:03:05 111000 -- [-2640.049] (-2653.107) (-2640.362) (-2641.304) * (-2642.044) [-2642.985] (-2637.206) (-2640.301) -- 0:03:04 111500 -- (-2632.952) (-2647.888) [-2642.548] (-2637.790) * [-2637.868] (-2638.151) (-2638.328) (-2638.565) -- 0:03:03 112000 -- (-2641.916) (-2654.404) (-2643.949) [-2636.217] * (-2634.034) [-2639.784] (-2642.258) (-2638.814) -- 0:03:02 112500 -- [-2636.453] (-2644.530) (-2643.895) (-2635.711) * (-2640.129) [-2640.743] (-2643.366) (-2636.082) -- 0:03:01 113000 -- (-2644.235) (-2638.431) [-2641.751] (-2638.424) * (-2648.486) (-2637.212) (-2648.366) [-2639.166] -- 0:03:08 113500 -- (-2642.945) (-2635.994) (-2640.715) [-2633.224] * (-2637.732) (-2636.986) (-2645.099) [-2645.362] -- 0:03:07 114000 -- (-2648.412) (-2639.888) [-2638.868] (-2641.525) * (-2642.015) [-2634.118] (-2643.292) (-2648.657) -- 0:03:06 114500 -- (-2649.906) (-2640.639) (-2639.137) [-2639.255] * (-2638.394) (-2636.391) [-2635.935] (-2646.172) -- 0:03:05 115000 -- (-2650.416) (-2640.771) (-2638.042) [-2637.258] * (-2644.985) [-2637.017] (-2644.211) (-2638.593) -- 0:03:04 Average standard deviation of split frequencies: 0.002032 115500 -- [-2643.445] (-2637.382) (-2638.104) (-2637.104) * (-2649.798) (-2637.764) [-2644.050] (-2642.540) -- 0:03:03 116000 -- (-2641.345) (-2637.841) (-2643.492) [-2634.926] * (-2640.400) (-2642.799) [-2636.550] (-2639.641) -- 0:03:02 116500 -- (-2639.605) (-2645.589) (-2638.079) [-2638.042] * (-2642.456) (-2640.093) [-2641.243] (-2641.876) -- 0:03:02 117000 -- [-2643.672] (-2656.845) (-2647.399) (-2646.858) * [-2640.478] (-2641.473) (-2641.672) (-2642.868) -- 0:03:01 117500 -- (-2645.400) (-2649.987) [-2643.181] (-2635.457) * (-2645.188) (-2641.687) (-2638.196) [-2641.023] -- 0:03:00 118000 -- [-2640.154] (-2646.121) (-2637.247) (-2641.507) * (-2648.076) [-2637.093] (-2642.806) (-2642.854) -- 0:03:06 118500 -- [-2640.349] (-2639.526) (-2639.629) (-2641.241) * (-2640.372) [-2636.988] (-2640.655) (-2638.703) -- 0:03:05 119000 -- (-2638.951) (-2639.253) [-2636.717] (-2639.530) * (-2652.233) (-2642.297) [-2642.534] (-2641.639) -- 0:03:05 119500 -- (-2645.350) [-2634.619] (-2638.584) (-2640.584) * (-2647.150) [-2639.286] (-2639.666) (-2640.562) -- 0:03:04 120000 -- [-2640.570] (-2640.888) (-2645.207) (-2635.114) * (-2639.615) (-2640.641) [-2636.086] (-2641.839) -- 0:03:03 Average standard deviation of split frequencies: 0.001953 120500 -- (-2644.213) (-2639.081) [-2634.825] (-2636.976) * (-2635.289) [-2638.011] (-2636.574) (-2635.159) -- 0:03:02 121000 -- (-2645.246) (-2643.016) (-2640.263) [-2639.115] * (-2635.985) [-2636.674] (-2646.446) (-2639.271) -- 0:03:01 121500 -- (-2635.657) [-2639.511] (-2638.490) (-2640.754) * (-2639.866) [-2642.811] (-2639.487) (-2637.638) -- 0:03:00 122000 -- (-2634.093) (-2643.213) (-2636.705) [-2638.708] * (-2640.189) (-2641.918) (-2637.355) [-2641.352] -- 0:02:59 122500 -- (-2636.019) (-2639.578) [-2639.234] (-2640.521) * (-2643.838) [-2642.721] (-2642.275) (-2644.936) -- 0:02:59 123000 -- (-2651.320) (-2643.167) [-2644.381] (-2642.146) * [-2639.451] (-2636.359) (-2638.707) (-2643.043) -- 0:03:05 123500 -- [-2637.490] (-2639.215) (-2639.499) (-2641.582) * (-2641.297) (-2639.924) [-2637.445] (-2639.979) -- 0:03:04 124000 -- [-2639.308] (-2640.359) (-2638.683) (-2644.696) * (-2635.968) (-2637.793) [-2641.498] (-2643.252) -- 0:03:03 124500 -- (-2640.311) (-2636.595) [-2635.786] (-2637.701) * [-2638.026] (-2639.712) (-2639.364) (-2642.743) -- 0:03:02 125000 -- (-2639.296) (-2639.239) [-2644.739] (-2639.921) * (-2643.965) (-2637.006) [-2636.947] (-2637.325) -- 0:03:02 Average standard deviation of split frequencies: 0.001871 125500 -- [-2639.500] (-2644.045) (-2643.655) (-2641.130) * (-2638.239) (-2645.893) [-2643.240] (-2644.245) -- 0:03:01 126000 -- [-2638.081] (-2645.087) (-2638.783) (-2650.325) * [-2642.727] (-2654.549) (-2655.306) (-2637.578) -- 0:03:00 126500 -- (-2641.768) (-2639.971) [-2634.803] (-2648.059) * [-2638.117] (-2648.464) (-2640.460) (-2639.222) -- 0:02:59 127000 -- (-2640.366) (-2637.388) [-2635.377] (-2638.209) * (-2637.655) (-2643.475) [-2639.559] (-2642.432) -- 0:02:58 127500 -- (-2633.854) (-2645.245) [-2641.428] (-2649.161) * [-2639.378] (-2642.326) (-2640.436) (-2647.428) -- 0:03:04 128000 -- [-2639.133] (-2644.400) (-2643.689) (-2647.308) * (-2635.328) (-2644.086) [-2642.422] (-2637.030) -- 0:03:03 128500 -- [-2632.814] (-2638.725) (-2648.350) (-2645.552) * (-2638.323) (-2638.318) (-2638.216) [-2638.447] -- 0:03:03 129000 -- (-2638.725) (-2640.735) (-2644.050) [-2635.531] * [-2638.560] (-2641.599) (-2639.599) (-2637.026) -- 0:03:02 129500 -- (-2645.931) (-2640.083) (-2641.624) [-2639.389] * (-2638.449) [-2643.375] (-2637.310) (-2643.176) -- 0:03:01 130000 -- (-2646.189) [-2639.402] (-2639.628) (-2641.669) * (-2641.538) (-2636.839) (-2634.403) [-2636.377] -- 0:03:00 Average standard deviation of split frequencies: 0.001804 130500 -- [-2640.041] (-2637.744) (-2640.764) (-2635.821) * (-2643.085) (-2635.885) [-2638.020] (-2637.981) -- 0:02:59 131000 -- (-2646.530) [-2636.654] (-2644.065) (-2635.697) * (-2633.264) [-2639.176] (-2639.496) (-2640.266) -- 0:02:59 131500 -- (-2648.333) (-2643.632) (-2651.918) [-2636.906] * [-2641.028] (-2643.842) (-2641.416) (-2643.600) -- 0:02:58 132000 -- (-2642.595) [-2635.919] (-2644.372) (-2639.501) * (-2644.725) (-2638.889) [-2638.967] (-2639.719) -- 0:02:57 132500 -- (-2637.483) (-2639.972) [-2644.364] (-2641.523) * (-2643.813) (-2647.825) [-2635.969] (-2645.852) -- 0:03:03 133000 -- [-2642.045] (-2641.571) (-2646.386) (-2646.213) * [-2638.773] (-2638.360) (-2646.299) (-2649.110) -- 0:03:02 133500 -- (-2642.325) (-2652.620) [-2636.781] (-2644.314) * (-2636.903) [-2643.405] (-2636.348) (-2636.543) -- 0:03:01 134000 -- (-2641.711) (-2643.353) [-2641.948] (-2644.222) * [-2642.147] (-2638.086) (-2636.647) (-2639.508) -- 0:03:00 134500 -- [-2641.423] (-2645.052) (-2639.372) (-2638.933) * [-2640.195] (-2638.317) (-2643.967) (-2641.219) -- 0:03:00 135000 -- [-2642.234] (-2645.268) (-2641.046) (-2646.152) * (-2636.739) (-2637.607) (-2646.652) [-2641.750] -- 0:02:59 Average standard deviation of split frequencies: 0.001733 135500 -- (-2642.726) [-2638.905] (-2641.837) (-2639.447) * (-2637.152) (-2644.880) [-2647.612] (-2642.823) -- 0:02:58 136000 -- (-2641.386) [-2643.828] (-2643.364) (-2646.459) * (-2635.980) [-2638.055] (-2647.399) (-2638.382) -- 0:02:57 136500 -- (-2639.191) [-2638.005] (-2639.729) (-2647.810) * (-2637.041) (-2640.192) [-2641.656] (-2643.849) -- 0:02:57 137000 -- [-2640.698] (-2639.505) (-2637.608) (-2642.862) * (-2641.184) (-2640.121) [-2639.547] (-2640.086) -- 0:03:02 137500 -- (-2641.419) (-2638.127) (-2638.891) [-2641.780] * [-2641.914] (-2644.203) (-2644.806) (-2637.651) -- 0:03:01 138000 -- (-2645.765) [-2639.005] (-2640.896) (-2639.707) * (-2646.216) (-2638.167) (-2646.504) [-2636.336] -- 0:03:01 138500 -- [-2637.140] (-2638.839) (-2640.553) (-2637.890) * [-2634.763] (-2643.424) (-2650.851) (-2636.100) -- 0:03:00 139000 -- [-2640.122] (-2639.209) (-2642.125) (-2638.074) * (-2641.301) (-2640.859) (-2640.205) [-2639.181] -- 0:02:59 139500 -- (-2647.174) [-2636.465] (-2636.723) (-2639.937) * (-2643.515) [-2641.326] (-2645.540) (-2641.538) -- 0:02:58 140000 -- (-2641.000) [-2640.975] (-2637.835) (-2634.283) * (-2638.421) [-2635.229] (-2638.952) (-2649.492) -- 0:02:58 Average standard deviation of split frequencies: 0.001676 140500 -- (-2640.945) (-2645.308) (-2641.756) [-2637.927] * [-2643.375] (-2639.119) (-2636.223) (-2640.845) -- 0:02:57 141000 -- (-2643.233) (-2639.408) (-2641.622) [-2638.726] * (-2639.467) (-2645.482) (-2637.568) [-2636.825] -- 0:02:56 141500 -- [-2641.219] (-2636.938) (-2641.730) (-2639.195) * (-2638.520) (-2638.130) (-2638.907) [-2635.142] -- 0:02:55 142000 -- (-2648.154) (-2638.892) [-2650.937] (-2638.154) * [-2642.753] (-2638.834) (-2646.622) (-2637.154) -- 0:03:01 142500 -- [-2643.039] (-2637.411) (-2646.755) (-2638.171) * [-2634.073] (-2635.795) (-2645.068) (-2643.496) -- 0:03:00 143000 -- (-2643.267) (-2647.237) [-2642.697] (-2641.406) * (-2642.971) [-2644.371] (-2642.233) (-2645.463) -- 0:02:59 143500 -- (-2644.562) (-2646.014) (-2638.781) [-2639.783] * (-2639.662) [-2639.651] (-2644.865) (-2649.382) -- 0:02:59 144000 -- (-2646.189) [-2641.638] (-2636.301) (-2643.430) * [-2638.303] (-2639.878) (-2645.013) (-2650.994) -- 0:02:58 144500 -- (-2652.471) [-2645.275] (-2641.118) (-2640.403) * (-2640.838) (-2644.104) (-2642.579) [-2648.266] -- 0:02:57 145000 -- (-2643.021) [-2641.692] (-2648.217) (-2640.547) * [-2649.618] (-2641.649) (-2639.587) (-2646.266) -- 0:02:56 Average standard deviation of split frequencies: 0.001614 145500 -- (-2642.004) (-2638.861) (-2646.330) [-2641.991] * (-2646.405) (-2644.269) [-2644.456] (-2642.498) -- 0:02:56 146000 -- (-2641.629) (-2644.098) (-2646.386) [-2636.365] * (-2651.282) (-2643.825) (-2640.590) [-2642.179] -- 0:02:55 146500 -- (-2645.051) [-2647.485] (-2640.871) (-2647.798) * (-2645.340) [-2637.057] (-2644.955) (-2644.608) -- 0:03:00 147000 -- (-2634.022) (-2643.638) [-2638.688] (-2642.006) * (-2640.175) [-2636.995] (-2641.433) (-2638.728) -- 0:02:59 147500 -- (-2642.769) [-2638.573] (-2645.330) (-2634.698) * (-2640.381) [-2647.997] (-2638.963) (-2642.705) -- 0:02:59 148000 -- (-2654.191) (-2641.599) (-2639.329) [-2640.148] * [-2637.811] (-2646.828) (-2640.761) (-2639.685) -- 0:02:58 148500 -- (-2657.787) (-2639.957) [-2638.190] (-2639.612) * [-2639.302] (-2645.187) (-2642.550) (-2644.610) -- 0:02:57 149000 -- [-2639.209] (-2637.170) (-2638.650) (-2637.478) * (-2646.539) [-2639.279] (-2636.458) (-2639.904) -- 0:02:57 149500 -- (-2640.396) (-2636.458) [-2637.276] (-2641.283) * [-2637.924] (-2640.080) (-2645.136) (-2639.706) -- 0:02:56 150000 -- (-2638.704) (-2638.902) (-2646.137) [-2642.244] * (-2644.388) [-2637.399] (-2639.087) (-2643.302) -- 0:02:55 Average standard deviation of split frequencies: 0.001564 150500 -- [-2637.224] (-2643.556) (-2642.817) (-2648.150) * (-2638.750) (-2646.910) (-2640.700) [-2634.577] -- 0:02:54 151000 -- [-2643.260] (-2636.431) (-2640.388) (-2642.443) * (-2636.927) (-2640.170) (-2646.869) [-2639.456] -- 0:02:54 151500 -- (-2641.725) (-2637.514) [-2640.085] (-2654.054) * (-2638.688) [-2639.044] (-2643.341) (-2647.341) -- 0:02:59 152000 -- (-2640.043) [-2640.583] (-2645.919) (-2645.416) * (-2638.524) (-2636.898) [-2640.590] (-2642.288) -- 0:02:58 152500 -- (-2637.387) (-2637.628) [-2635.715] (-2646.854) * (-2639.035) (-2634.879) [-2639.930] (-2643.375) -- 0:02:57 153000 -- (-2645.633) (-2637.821) (-2637.547) [-2642.602] * (-2634.126) [-2640.508] (-2638.419) (-2640.676) -- 0:02:57 153500 -- [-2636.565] (-2641.124) (-2641.083) (-2640.959) * (-2640.962) (-2653.297) (-2643.508) [-2638.975] -- 0:02:56 154000 -- (-2638.505) [-2635.680] (-2639.281) (-2643.446) * (-2636.401) (-2637.633) (-2640.483) [-2640.479] -- 0:02:55 154500 -- (-2644.099) [-2641.777] (-2648.613) (-2641.114) * (-2647.127) (-2642.842) (-2636.433) [-2638.511] -- 0:02:55 155000 -- (-2639.401) [-2638.403] (-2646.891) (-2642.806) * (-2642.540) (-2646.163) [-2639.824] (-2642.289) -- 0:02:54 Average standard deviation of split frequencies: 0.001511 155500 -- (-2640.679) [-2638.779] (-2641.011) (-2639.660) * [-2637.300] (-2635.863) (-2638.038) (-2633.076) -- 0:02:53 156000 -- (-2639.041) (-2644.736) [-2634.641] (-2637.642) * (-2642.631) (-2642.512) (-2644.526) [-2636.282] -- 0:02:58 156500 -- (-2641.314) (-2642.488) (-2640.933) [-2644.352] * (-2639.368) (-2650.268) [-2642.464] (-2638.983) -- 0:02:57 157000 -- [-2636.312] (-2637.396) (-2637.036) (-2639.907) * (-2639.666) (-2642.329) (-2642.642) [-2638.645] -- 0:02:57 157500 -- (-2641.858) (-2639.390) [-2638.444] (-2636.527) * (-2642.904) (-2644.101) (-2645.339) [-2637.582] -- 0:02:56 158000 -- (-2637.377) [-2640.143] (-2638.171) (-2637.923) * (-2638.504) (-2644.517) [-2637.122] (-2645.021) -- 0:02:55 158500 -- (-2640.613) (-2639.299) (-2640.804) [-2644.222] * (-2636.095) [-2638.267] (-2640.577) (-2640.620) -- 0:02:55 159000 -- [-2635.379] (-2635.803) (-2641.252) (-2641.074) * (-2641.104) [-2644.583] (-2637.876) (-2636.590) -- 0:02:54 159500 -- (-2640.137) [-2638.821] (-2642.944) (-2638.915) * [-2636.928] (-2638.575) (-2642.656) (-2632.028) -- 0:02:53 160000 -- (-2639.502) (-2639.998) [-2640.775] (-2637.377) * (-2643.220) (-2637.070) [-2641.269] (-2636.266) -- 0:02:53 Average standard deviation of split frequencies: 0.001467 160500 -- (-2644.529) [-2635.061] (-2648.545) (-2638.519) * (-2642.543) (-2641.529) [-2634.361] (-2640.155) -- 0:02:52 161000 -- (-2638.790) [-2639.234] (-2644.346) (-2637.063) * (-2637.739) (-2640.803) [-2634.547] (-2644.647) -- 0:02:57 161500 -- (-2639.361) (-2637.810) (-2644.303) [-2644.217] * (-2639.266) (-2638.939) [-2635.031] (-2649.800) -- 0:02:56 162000 -- (-2640.689) (-2642.465) (-2640.154) [-2644.187] * [-2636.008] (-2635.281) (-2646.854) (-2641.038) -- 0:02:55 162500 -- (-2636.855) (-2647.470) [-2640.527] (-2639.880) * [-2637.885] (-2647.189) (-2641.924) (-2644.683) -- 0:02:55 163000 -- [-2639.117] (-2643.897) (-2648.152) (-2639.374) * (-2647.124) [-2634.890] (-2638.117) (-2646.444) -- 0:02:54 163500 -- [-2642.507] (-2642.432) (-2654.135) (-2642.757) * (-2641.348) (-2642.574) (-2639.647) [-2637.793] -- 0:02:53 164000 -- (-2639.758) (-2641.487) (-2642.081) [-2642.406] * (-2644.694) (-2642.181) [-2640.494] (-2649.808) -- 0:02:53 164500 -- [-2641.217] (-2640.017) (-2648.166) (-2644.986) * [-2639.678] (-2642.006) (-2637.502) (-2640.332) -- 0:02:52 165000 -- (-2658.525) [-2637.622] (-2652.718) (-2638.539) * (-2639.616) [-2635.761] (-2636.824) (-2643.787) -- 0:02:52 Average standard deviation of split frequencies: 0.001420 165500 -- (-2641.660) (-2641.262) (-2635.236) [-2638.571] * (-2641.419) [-2635.513] (-2641.468) (-2637.102) -- 0:02:51 166000 -- [-2643.414] (-2635.513) (-2638.807) (-2642.370) * [-2642.359] (-2635.955) (-2638.488) (-2642.833) -- 0:02:55 166500 -- (-2641.785) (-2639.560) [-2635.734] (-2641.299) * (-2643.389) (-2644.510) [-2642.752] (-2639.000) -- 0:02:55 167000 -- (-2643.632) (-2640.865) [-2647.893] (-2636.813) * (-2641.763) [-2642.929] (-2644.065) (-2641.281) -- 0:02:54 167500 -- (-2642.522) [-2637.193] (-2636.929) (-2643.368) * (-2639.279) (-2635.311) (-2642.066) [-2640.402] -- 0:02:53 168000 -- (-2640.582) [-2637.796] (-2645.981) (-2638.611) * (-2647.234) [-2635.835] (-2645.060) (-2639.809) -- 0:02:53 168500 -- (-2639.131) (-2648.211) (-2642.871) [-2637.828] * (-2639.291) [-2641.039] (-2648.264) (-2638.935) -- 0:02:52 169000 -- (-2641.912) (-2635.787) [-2641.976] (-2639.953) * (-2647.311) (-2643.093) [-2639.640] (-2641.681) -- 0:02:52 169500 -- (-2642.237) [-2638.867] (-2642.033) (-2644.386) * (-2640.338) (-2640.569) (-2636.945) [-2645.560] -- 0:02:51 170000 -- [-2632.931] (-2638.257) (-2641.987) (-2637.160) * [-2637.740] (-2642.677) (-2635.385) (-2644.216) -- 0:02:50 Average standard deviation of split frequencies: 0.001381 170500 -- (-2639.538) [-2644.139] (-2637.750) (-2642.746) * (-2640.452) [-2638.911] (-2639.461) (-2635.420) -- 0:02:55 171000 -- (-2640.323) (-2643.863) [-2642.796] (-2640.041) * [-2637.406] (-2646.706) (-2637.178) (-2640.974) -- 0:02:54 171500 -- (-2642.571) (-2648.616) (-2648.425) [-2640.641] * (-2640.094) (-2636.409) (-2640.965) [-2636.272] -- 0:02:53 172000 -- [-2638.266] (-2640.810) (-2647.892) (-2638.756) * (-2644.134) (-2647.308) (-2641.351) [-2638.861] -- 0:02:53 172500 -- (-2641.457) [-2638.719] (-2646.913) (-2639.881) * (-2641.196) (-2649.003) [-2637.232] (-2637.608) -- 0:02:52 173000 -- (-2637.176) [-2636.419] (-2643.953) (-2635.354) * [-2639.320] (-2636.807) (-2642.816) (-2641.060) -- 0:02:52 173500 -- [-2639.739] (-2636.433) (-2652.489) (-2640.965) * (-2649.074) (-2634.979) [-2639.393] (-2645.334) -- 0:02:51 174000 -- (-2640.913) (-2647.693) (-2648.452) [-2636.123] * (-2644.218) [-2641.922] (-2636.960) (-2640.705) -- 0:02:50 174500 -- (-2635.806) [-2636.962] (-2643.811) (-2634.183) * (-2639.393) [-2638.712] (-2650.098) (-2640.897) -- 0:02:50 175000 -- (-2640.914) (-2636.335) (-2644.356) [-2638.165] * (-2643.946) (-2639.048) (-2649.736) [-2637.164] -- 0:02:49 Average standard deviation of split frequencies: 0.001339 175500 -- (-2645.286) [-2638.180] (-2639.793) (-2641.543) * (-2640.341) (-2638.334) [-2646.038] (-2639.929) -- 0:02:53 176000 -- (-2654.524) [-2633.968] (-2646.166) (-2640.887) * (-2641.513) (-2641.088) (-2642.367) [-2643.245] -- 0:02:53 176500 -- [-2638.199] (-2637.074) (-2636.718) (-2646.563) * (-2638.192) [-2639.040] (-2644.185) (-2638.703) -- 0:02:52 177000 -- (-2636.834) (-2636.806) [-2640.317] (-2650.492) * [-2641.895] (-2641.113) (-2648.207) (-2646.919) -- 0:02:52 177500 -- (-2639.964) [-2639.842] (-2644.336) (-2640.612) * (-2636.392) (-2646.383) (-2644.489) [-2643.642] -- 0:02:51 178000 -- (-2642.874) (-2638.891) (-2649.846) [-2642.731] * [-2637.828] (-2638.088) (-2641.322) (-2638.993) -- 0:02:50 178500 -- (-2641.352) (-2638.305) (-2643.062) [-2639.160] * (-2633.211) [-2640.858] (-2637.475) (-2643.539) -- 0:02:50 179000 -- (-2646.307) [-2643.252] (-2645.340) (-2638.083) * (-2638.042) (-2641.769) [-2632.652] (-2645.941) -- 0:02:49 179500 -- (-2647.056) [-2639.915] (-2644.925) (-2645.958) * (-2641.778) (-2640.067) [-2643.381] (-2639.556) -- 0:02:49 180000 -- (-2637.525) (-2639.344) [-2637.595] (-2640.332) * (-2636.571) [-2644.718] (-2636.566) (-2644.375) -- 0:02:53 Average standard deviation of split frequencies: 0.001305 180500 -- (-2637.178) [-2635.716] (-2638.066) (-2637.981) * (-2650.566) (-2641.087) [-2636.631] (-2639.573) -- 0:02:52 181000 -- (-2639.317) [-2639.780] (-2637.095) (-2642.829) * (-2636.888) [-2645.067] (-2638.631) (-2646.304) -- 0:02:51 181500 -- (-2640.704) (-2637.253) (-2638.377) [-2635.736] * (-2646.441) [-2644.862] (-2637.193) (-2642.741) -- 0:02:51 182000 -- [-2640.501] (-2643.279) (-2654.186) (-2641.268) * (-2642.104) (-2641.867) (-2641.114) [-2640.682] -- 0:02:50 182500 -- (-2642.568) (-2642.725) [-2639.562] (-2638.117) * [-2636.224] (-2645.652) (-2636.732) (-2643.797) -- 0:02:50 183000 -- (-2646.921) (-2637.103) (-2645.573) [-2640.019] * (-2638.329) [-2639.575] (-2640.802) (-2644.440) -- 0:02:49 183500 -- (-2639.612) [-2637.538] (-2643.245) (-2635.108) * (-2635.303) [-2638.882] (-2637.833) (-2637.392) -- 0:02:49 184000 -- [-2642.016] (-2637.528) (-2641.053) (-2636.541) * [-2636.304] (-2645.898) (-2642.139) (-2647.470) -- 0:02:48 184500 -- (-2644.008) (-2643.262) (-2642.781) [-2634.456] * (-2640.365) [-2636.854] (-2637.739) (-2637.687) -- 0:02:47 185000 -- [-2645.642] (-2640.929) (-2643.693) (-2640.606) * [-2642.290] (-2644.797) (-2633.190) (-2643.032) -- 0:02:51 Average standard deviation of split frequencies: 0.001267 185500 -- [-2642.813] (-2637.664) (-2637.332) (-2636.141) * [-2643.468] (-2640.060) (-2643.227) (-2641.278) -- 0:02:51 186000 -- [-2636.140] (-2647.383) (-2644.664) (-2633.829) * [-2640.461] (-2639.997) (-2639.489) (-2650.880) -- 0:02:50 186500 -- (-2639.578) (-2643.790) (-2640.485) [-2642.123] * [-2638.502] (-2638.675) (-2636.838) (-2636.418) -- 0:02:50 187000 -- (-2640.871) [-2642.294] (-2638.905) (-2643.544) * [-2637.635] (-2638.693) (-2638.584) (-2637.780) -- 0:02:49 187500 -- (-2646.670) (-2645.209) [-2638.445] (-2636.482) * [-2644.220] (-2640.731) (-2645.279) (-2636.570) -- 0:02:49 188000 -- (-2646.872) [-2637.490] (-2643.882) (-2639.002) * (-2637.684) [-2648.053] (-2643.279) (-2644.096) -- 0:02:48 188500 -- (-2643.017) (-2640.069) (-2646.352) [-2640.354] * (-2634.566) (-2636.807) (-2636.502) [-2635.692] -- 0:02:47 189000 -- (-2646.099) (-2642.452) (-2638.061) [-2636.156] * [-2635.037] (-2636.847) (-2637.184) (-2639.413) -- 0:02:47 189500 -- [-2648.755] (-2645.264) (-2649.386) (-2636.927) * (-2644.585) (-2641.157) (-2642.577) [-2648.086] -- 0:02:51 190000 -- (-2637.359) (-2641.628) [-2639.604] (-2635.130) * (-2638.156) (-2634.622) [-2636.741] (-2644.775) -- 0:02:50 Average standard deviation of split frequencies: 0.001236 190500 -- (-2641.079) (-2641.643) [-2638.144] (-2638.070) * (-2641.181) [-2640.256] (-2639.134) (-2650.764) -- 0:02:49 191000 -- [-2637.919] (-2639.660) (-2642.021) (-2640.187) * [-2636.846] (-2641.368) (-2644.616) (-2643.590) -- 0:02:49 191500 -- [-2637.994] (-2640.959) (-2641.801) (-2641.723) * (-2636.959) (-2638.795) [-2642.854] (-2649.639) -- 0:02:48 192000 -- (-2644.848) [-2641.407] (-2642.003) (-2642.372) * (-2639.433) [-2642.285] (-2644.927) (-2642.380) -- 0:02:48 192500 -- (-2639.091) (-2642.716) (-2644.841) [-2640.058] * [-2641.064] (-2642.681) (-2640.465) (-2648.282) -- 0:02:47 193000 -- (-2643.692) (-2639.342) [-2642.931] (-2641.880) * (-2644.282) [-2643.400] (-2640.481) (-2638.568) -- 0:02:47 193500 -- (-2643.985) (-2637.660) [-2634.596] (-2643.512) * [-2636.683] (-2639.143) (-2647.820) (-2636.415) -- 0:02:46 194000 -- [-2638.091] (-2640.839) (-2639.087) (-2648.004) * [-2644.688] (-2638.694) (-2640.730) (-2635.169) -- 0:02:46 194500 -- (-2645.944) (-2637.733) (-2646.852) [-2636.839] * (-2638.283) (-2640.332) (-2643.634) [-2639.360] -- 0:02:49 195000 -- (-2647.077) (-2638.492) [-2640.437] (-2643.929) * (-2642.027) [-2640.247] (-2638.784) (-2642.183) -- 0:02:49 Average standard deviation of split frequencies: 0.001203 195500 -- (-2636.229) (-2638.545) [-2640.068] (-2643.385) * [-2638.539] (-2636.271) (-2640.716) (-2642.022) -- 0:02:48 196000 -- (-2638.923) (-2643.222) [-2637.475] (-2636.345) * (-2644.577) [-2640.523] (-2640.593) (-2641.486) -- 0:02:48 196500 -- (-2642.030) (-2641.323) [-2640.295] (-2636.867) * (-2635.719) (-2639.877) [-2644.134] (-2645.593) -- 0:02:47 197000 -- (-2648.963) [-2642.119] (-2645.697) (-2643.044) * [-2635.263] (-2637.016) (-2638.957) (-2639.601) -- 0:02:47 197500 -- (-2644.248) (-2642.507) (-2637.524) [-2643.608] * (-2637.313) (-2645.281) [-2639.330] (-2642.685) -- 0:02:46 198000 -- (-2637.147) (-2635.506) (-2645.345) [-2646.887] * (-2639.502) [-2644.108] (-2642.949) (-2643.470) -- 0:02:46 198500 -- (-2649.653) [-2640.341] (-2643.533) (-2643.609) * [-2638.436] (-2646.551) (-2644.190) (-2640.349) -- 0:02:45 199000 -- (-2648.439) (-2634.214) [-2649.099] (-2646.543) * (-2642.955) (-2642.092) (-2640.570) [-2642.945] -- 0:02:49 199500 -- (-2643.929) (-2640.933) (-2635.676) [-2639.447] * (-2642.073) [-2641.222] (-2637.127) (-2634.293) -- 0:02:48 200000 -- (-2644.461) [-2637.621] (-2639.966) (-2637.130) * (-2639.842) (-2647.529) [-2639.034] (-2637.687) -- 0:02:48 Average standard deviation of split frequencies: 0.001175 200500 -- (-2639.129) [-2640.151] (-2640.737) (-2639.709) * [-2637.598] (-2647.947) (-2642.622) (-2639.986) -- 0:02:47 201000 -- [-2634.814] (-2642.053) (-2637.807) (-2637.361) * (-2639.506) [-2637.333] (-2648.344) (-2636.330) -- 0:02:46 201500 -- [-2637.825] (-2641.906) (-2637.077) (-2641.972) * (-2642.747) [-2641.010] (-2647.472) (-2636.571) -- 0:02:46 202000 -- [-2643.123] (-2639.527) (-2643.432) (-2642.679) * (-2634.936) (-2645.877) (-2641.131) [-2638.003] -- 0:02:45 202500 -- (-2641.988) (-2642.800) (-2640.524) [-2644.566] * (-2637.708) (-2646.167) [-2640.742] (-2638.927) -- 0:02:45 203000 -- [-2642.237] (-2644.409) (-2641.507) (-2641.999) * (-2637.414) [-2644.211] (-2643.501) (-2643.146) -- 0:02:44 203500 -- (-2644.719) (-2636.962) (-2638.424) [-2638.674] * (-2642.192) (-2639.019) [-2641.180] (-2639.309) -- 0:02:44 204000 -- (-2644.959) [-2635.701] (-2639.255) (-2639.957) * (-2640.849) (-2636.579) (-2641.412) [-2636.006] -- 0:02:47 204500 -- (-2640.299) [-2638.036] (-2649.006) (-2638.387) * (-2642.181) (-2641.404) [-2637.293] (-2637.353) -- 0:02:47 205000 -- [-2637.447] (-2638.671) (-2637.889) (-2645.156) * (-2637.750) [-2643.312] (-2644.750) (-2636.420) -- 0:02:46 Average standard deviation of split frequencies: 0.001144 205500 -- (-2641.626) (-2644.648) [-2643.434] (-2642.405) * (-2641.537) (-2642.689) (-2646.819) [-2637.974] -- 0:02:46 206000 -- (-2639.941) [-2654.306] (-2643.104) (-2642.070) * (-2640.687) (-2638.292) [-2643.542] (-2646.820) -- 0:02:45 206500 -- (-2636.635) (-2640.729) (-2643.465) [-2637.739] * [-2634.311] (-2635.926) (-2632.870) (-2643.292) -- 0:02:45 207000 -- (-2645.304) (-2639.628) (-2641.612) [-2640.099] * (-2635.574) [-2643.096] (-2640.029) (-2637.710) -- 0:02:44 207500 -- (-2638.564) [-2636.851] (-2647.894) (-2638.197) * (-2641.580) (-2638.359) (-2641.331) [-2641.355] -- 0:02:44 208000 -- [-2642.512] (-2648.399) (-2639.279) (-2639.633) * [-2641.099] (-2643.452) (-2637.935) (-2637.796) -- 0:02:43 208500 -- [-2639.951] (-2642.435) (-2643.679) (-2643.894) * (-2641.778) (-2640.485) [-2637.277] (-2636.263) -- 0:02:47 209000 -- (-2640.195) [-2639.247] (-2647.040) (-2637.703) * (-2640.610) (-2643.518) [-2636.134] (-2649.242) -- 0:02:46 209500 -- (-2644.413) [-2637.649] (-2638.057) (-2634.663) * (-2642.243) [-2649.005] (-2638.202) (-2637.702) -- 0:02:46 210000 -- (-2644.018) [-2636.903] (-2639.313) (-2644.437) * [-2637.340] (-2646.709) (-2639.756) (-2642.467) -- 0:02:45 Average standard deviation of split frequencies: 0.001119 210500 -- [-2639.002] (-2640.529) (-2641.418) (-2640.533) * (-2640.331) [-2638.240] (-2643.642) (-2639.080) -- 0:02:45 211000 -- (-2635.855) [-2640.182] (-2645.094) (-2640.679) * (-2640.501) (-2637.794) [-2642.355] (-2645.505) -- 0:02:44 211500 -- (-2649.431) (-2641.839) (-2643.761) [-2637.589] * (-2636.757) (-2643.690) (-2637.776) [-2638.230] -- 0:02:44 212000 -- (-2643.635) (-2643.228) (-2638.472) [-2635.171] * [-2642.433] (-2637.492) (-2638.829) (-2638.693) -- 0:02:43 212500 -- [-2639.482] (-2646.297) (-2648.027) (-2638.906) * (-2636.754) (-2642.743) (-2637.787) [-2635.306] -- 0:02:43 213000 -- (-2642.820) [-2642.578] (-2640.235) (-2650.483) * (-2637.291) (-2634.406) (-2640.474) [-2636.796] -- 0:02:42 213500 -- [-2637.101] (-2641.538) (-2644.133) (-2639.339) * (-2645.460) (-2635.982) (-2640.932) [-2638.402] -- 0:02:45 214000 -- [-2637.681] (-2646.189) (-2636.778) (-2640.883) * (-2636.008) (-2639.391) (-2640.480) [-2637.749] -- 0:02:45 214500 -- [-2641.001] (-2637.561) (-2641.757) (-2636.665) * (-2637.070) (-2637.173) (-2638.573) [-2641.604] -- 0:02:44 215000 -- (-2638.449) (-2642.602) (-2645.554) [-2636.201] * (-2636.785) (-2641.764) [-2635.244] (-2640.423) -- 0:02:44 Average standard deviation of split frequencies: 0.001091 215500 -- (-2641.617) (-2635.729) (-2641.752) [-2637.720] * (-2636.308) (-2647.130) [-2637.357] (-2650.291) -- 0:02:43 216000 -- (-2636.572) (-2642.403) [-2646.754] (-2643.415) * [-2639.411] (-2642.292) (-2636.328) (-2637.949) -- 0:02:43 216500 -- (-2643.262) (-2635.920) (-2635.563) [-2639.145] * [-2638.296] (-2643.795) (-2636.821) (-2638.483) -- 0:02:42 217000 -- [-2643.405] (-2639.475) (-2639.972) (-2636.503) * [-2641.575] (-2649.166) (-2636.808) (-2640.678) -- 0:02:42 217500 -- (-2642.904) (-2641.746) [-2635.328] (-2640.814) * (-2648.476) (-2649.928) (-2640.014) [-2635.075] -- 0:02:41 218000 -- (-2645.175) (-2638.336) [-2639.505] (-2636.911) * (-2640.304) (-2641.561) [-2634.397] (-2642.160) -- 0:02:41 218500 -- (-2638.565) (-2635.081) [-2636.134] (-2639.901) * (-2639.965) (-2642.476) [-2637.629] (-2635.261) -- 0:02:44 219000 -- [-2643.244] (-2638.122) (-2641.431) (-2639.841) * (-2642.514) (-2638.418) [-2633.144] (-2640.719) -- 0:02:44 219500 -- (-2636.810) [-2642.920] (-2645.643) (-2644.404) * (-2642.100) [-2637.715] (-2638.546) (-2640.890) -- 0:02:43 220000 -- [-2648.557] (-2639.690) (-2637.174) (-2649.929) * (-2637.702) (-2636.794) [-2635.813] (-2644.382) -- 0:02:43 Average standard deviation of split frequencies: 0.001068 220500 -- (-2639.476) (-2642.029) (-2647.407) [-2636.252] * [-2641.722] (-2636.715) (-2636.438) (-2641.923) -- 0:02:42 221000 -- (-2638.120) [-2635.137] (-2642.060) (-2640.629) * (-2640.026) (-2640.027) [-2637.067] (-2638.971) -- 0:02:42 221500 -- [-2638.245] (-2642.716) (-2641.648) (-2636.200) * (-2640.790) (-2637.587) [-2635.228] (-2643.289) -- 0:02:41 222000 -- (-2637.455) [-2641.012] (-2643.968) (-2641.343) * (-2641.608) (-2640.103) (-2639.455) [-2641.906] -- 0:02:41 222500 -- (-2637.384) (-2637.935) (-2636.569) [-2636.792] * [-2636.682] (-2636.108) (-2638.014) (-2643.929) -- 0:02:40 223000 -- (-2640.935) [-2639.416] (-2643.331) (-2645.893) * (-2639.528) (-2637.044) [-2641.259] (-2646.614) -- 0:02:43 223500 -- (-2645.223) [-2634.921] (-2642.537) (-2645.905) * [-2641.769] (-2635.556) (-2642.103) (-2648.549) -- 0:02:43 224000 -- (-2642.152) (-2635.609) [-2645.235] (-2639.595) * (-2635.800) (-2639.609) (-2635.809) [-2637.278] -- 0:02:42 224500 -- (-2646.415) (-2645.828) (-2642.207) [-2640.931] * (-2643.091) (-2640.424) (-2645.133) [-2637.835] -- 0:02:42 225000 -- (-2635.418) (-2640.522) [-2640.075] (-2648.231) * [-2642.637] (-2638.353) (-2640.025) (-2640.682) -- 0:02:41 Average standard deviation of split frequencies: 0.001043 225500 -- (-2637.185) (-2645.456) [-2642.199] (-2643.569) * [-2639.850] (-2639.233) (-2636.714) (-2642.376) -- 0:02:41 226000 -- (-2639.239) (-2642.020) (-2647.941) [-2637.222] * (-2639.141) (-2648.100) (-2638.268) [-2644.274] -- 0:02:40 226500 -- [-2641.384] (-2637.865) (-2641.383) (-2635.526) * (-2644.408) (-2646.958) [-2642.931] (-2637.247) -- 0:02:40 227000 -- (-2641.300) (-2643.769) (-2639.148) [-2636.058] * [-2647.936] (-2645.378) (-2640.824) (-2641.906) -- 0:02:40 227500 -- (-2637.199) (-2643.808) [-2636.988] (-2641.350) * (-2641.333) (-2640.478) (-2634.394) [-2641.176] -- 0:02:39 228000 -- (-2637.575) (-2639.569) [-2637.864] (-2640.059) * (-2646.501) (-2644.610) (-2641.816) [-2638.560] -- 0:02:42 228500 -- (-2638.252) (-2646.736) (-2641.083) [-2636.457] * [-2645.910] (-2643.881) (-2643.958) (-2643.347) -- 0:02:42 229000 -- (-2639.638) (-2641.603) [-2637.407] (-2642.018) * [-2644.240] (-2642.637) (-2645.035) (-2639.082) -- 0:02:41 229500 -- (-2643.620) (-2638.620) (-2635.032) [-2644.090] * (-2643.524) (-2643.310) (-2641.422) [-2639.135] -- 0:02:41 230000 -- (-2641.557) (-2638.239) [-2644.181] (-2640.272) * (-2643.672) (-2643.277) (-2639.137) [-2642.289] -- 0:02:40 Average standard deviation of split frequencies: 0.001022 230500 -- (-2644.814) (-2638.516) (-2643.272) [-2639.904] * (-2652.338) (-2641.883) [-2634.889] (-2645.819) -- 0:02:40 231000 -- (-2640.845) (-2637.066) [-2640.836] (-2641.338) * (-2650.688) (-2634.742) [-2639.759] (-2644.756) -- 0:02:39 231500 -- (-2639.871) (-2641.338) (-2639.142) [-2634.428] * (-2643.933) (-2639.083) (-2641.852) [-2638.327] -- 0:02:39 232000 -- (-2640.204) (-2640.830) (-2639.509) [-2634.806] * [-2641.745] (-2638.128) (-2634.761) (-2644.899) -- 0:02:38 232500 -- (-2642.387) (-2640.149) [-2639.703] (-2641.907) * (-2638.239) [-2638.558] (-2636.205) (-2644.850) -- 0:02:38 233000 -- (-2650.417) (-2637.727) (-2637.658) [-2638.775] * [-2639.127] (-2644.764) (-2641.537) (-2641.897) -- 0:02:41 233500 -- (-2652.385) [-2639.323] (-2648.531) (-2639.638) * (-2636.629) [-2642.647] (-2638.761) (-2637.680) -- 0:02:40 234000 -- (-2648.344) (-2640.670) (-2639.073) [-2645.386] * (-2641.601) (-2639.844) (-2639.543) [-2639.719] -- 0:02:40 234500 -- (-2644.014) (-2638.711) (-2644.567) [-2642.795] * (-2641.673) [-2646.928] (-2642.244) (-2642.051) -- 0:02:39 235000 -- [-2641.397] (-2648.232) (-2638.193) (-2640.601) * (-2639.316) [-2637.704] (-2640.318) (-2638.043) -- 0:02:39 Average standard deviation of split frequencies: 0.000999 235500 -- (-2647.860) (-2643.180) [-2637.150] (-2640.352) * (-2640.740) (-2642.699) [-2633.012] (-2642.998) -- 0:02:39 236000 -- (-2643.089) (-2639.431) (-2645.522) [-2636.403] * (-2640.914) [-2638.757] (-2640.187) (-2635.845) -- 0:02:38 236500 -- (-2647.772) (-2647.359) [-2638.267] (-2635.223) * (-2640.134) [-2642.970] (-2638.701) (-2637.217) -- 0:02:38 237000 -- [-2637.173] (-2646.214) (-2637.378) (-2642.686) * (-2639.293) [-2639.020] (-2640.442) (-2646.929) -- 0:02:37 237500 -- (-2642.953) (-2642.487) (-2640.113) [-2638.974] * (-2637.992) [-2637.788] (-2640.148) (-2640.591) -- 0:02:40 238000 -- (-2647.174) [-2639.850] (-2644.382) (-2645.117) * (-2642.185) [-2640.335] (-2640.350) (-2643.076) -- 0:02:40 238500 -- (-2643.200) (-2642.355) [-2639.230] (-2643.105) * (-2640.155) (-2640.349) (-2640.119) [-2635.496] -- 0:02:39 239000 -- (-2639.286) [-2636.574] (-2635.861) (-2640.042) * (-2639.172) [-2640.303] (-2636.112) (-2642.685) -- 0:02:39 239500 -- (-2641.929) (-2644.264) [-2637.073] (-2653.209) * (-2639.592) (-2640.631) [-2643.699] (-2641.597) -- 0:02:38 240000 -- (-2642.697) [-2637.746] (-2639.819) (-2650.307) * (-2638.369) (-2636.989) (-2650.328) [-2640.711] -- 0:02:38 Average standard deviation of split frequencies: 0.000979 240500 -- (-2641.752) [-2638.328] (-2639.176) (-2642.491) * (-2640.282) [-2643.568] (-2647.213) (-2642.017) -- 0:02:37 241000 -- (-2642.836) (-2635.760) (-2641.840) [-2641.107] * (-2637.925) [-2646.684] (-2641.050) (-2640.623) -- 0:02:37 241500 -- (-2635.868) (-2640.019) [-2637.227] (-2643.801) * [-2637.118] (-2645.466) (-2642.061) (-2636.894) -- 0:02:37 242000 -- [-2642.102] (-2639.246) (-2643.005) (-2644.755) * (-2640.292) (-2641.689) [-2640.851] (-2636.248) -- 0:02:36 242500 -- (-2644.443) (-2639.973) [-2640.044] (-2644.863) * [-2635.683] (-2639.728) (-2637.563) (-2640.813) -- 0:02:39 243000 -- (-2638.163) [-2638.343] (-2638.411) (-2641.513) * (-2636.459) [-2635.072] (-2653.115) (-2641.078) -- 0:02:38 243500 -- [-2635.376] (-2645.403) (-2652.532) (-2641.411) * [-2634.854] (-2642.055) (-2646.039) (-2638.226) -- 0:02:38 244000 -- (-2638.140) [-2639.445] (-2640.335) (-2637.746) * [-2642.332] (-2638.989) (-2645.691) (-2639.328) -- 0:02:38 244500 -- (-2640.160) (-2639.858) [-2634.021] (-2640.622) * (-2639.142) (-2639.971) (-2635.647) [-2636.018] -- 0:02:37 245000 -- (-2638.107) (-2640.309) [-2638.499] (-2644.827) * (-2642.340) (-2638.958) (-2640.687) [-2638.446] -- 0:02:37 Average standard deviation of split frequencies: 0.000958 245500 -- [-2640.359] (-2641.073) (-2634.649) (-2645.173) * (-2636.943) (-2644.886) (-2638.657) [-2635.926] -- 0:02:36 246000 -- (-2638.352) (-2643.422) [-2637.377] (-2652.039) * (-2637.771) (-2639.876) (-2643.126) [-2638.941] -- 0:02:36 246500 -- (-2637.372) [-2640.269] (-2644.299) (-2638.916) * (-2634.347) [-2647.213] (-2641.091) (-2638.272) -- 0:02:35 247000 -- (-2632.728) (-2642.909) [-2639.323] (-2641.098) * (-2634.610) (-2645.707) (-2637.307) [-2638.806] -- 0:02:35 247500 -- (-2645.129) [-2639.220] (-2643.603) (-2646.207) * (-2635.675) (-2648.040) (-2639.283) [-2636.024] -- 0:02:38 248000 -- (-2647.909) [-2642.428] (-2645.854) (-2653.418) * [-2637.916] (-2640.363) (-2643.731) (-2639.785) -- 0:02:37 248500 -- [-2640.893] (-2636.853) (-2649.542) (-2642.078) * (-2635.658) [-2637.874] (-2648.479) (-2644.796) -- 0:02:37 249000 -- (-2638.273) [-2640.644] (-2641.238) (-2642.304) * [-2637.559] (-2641.371) (-2640.581) (-2638.846) -- 0:02:36 249500 -- (-2638.228) (-2638.676) (-2640.885) [-2634.945] * (-2633.169) (-2637.263) (-2637.866) [-2637.541] -- 0:02:36 250000 -- (-2651.647) (-2645.925) [-2638.224] (-2638.600) * (-2639.102) (-2641.027) [-2640.569] (-2639.406) -- 0:02:36 Average standard deviation of split frequencies: 0.000000 250500 -- (-2643.249) (-2645.614) (-2638.707) [-2642.990] * (-2639.922) [-2640.525] (-2642.100) (-2638.642) -- 0:02:35 251000 -- (-2634.399) [-2652.298] (-2639.273) (-2643.215) * (-2641.302) (-2649.904) [-2642.633] (-2640.965) -- 0:02:35 251500 -- (-2639.579) [-2635.403] (-2638.914) (-2635.964) * (-2635.503) (-2639.604) (-2641.578) [-2639.664] -- 0:02:34 252000 -- [-2639.595] (-2635.322) (-2636.820) (-2642.729) * [-2639.233] (-2646.323) (-2639.293) (-2643.952) -- 0:02:37 252500 -- [-2638.100] (-2637.458) (-2632.523) (-2643.471) * [-2642.091] (-2642.312) (-2638.701) (-2641.585) -- 0:02:36 253000 -- [-2637.039] (-2640.949) (-2635.183) (-2648.024) * [-2637.474] (-2646.444) (-2635.893) (-2643.591) -- 0:02:36 253500 -- (-2636.212) (-2643.447) [-2640.178] (-2644.659) * [-2637.337] (-2640.445) (-2636.988) (-2642.955) -- 0:02:36 254000 -- (-2640.647) (-2645.091) [-2635.923] (-2650.334) * (-2641.377) [-2640.618] (-2642.226) (-2636.572) -- 0:02:35 254500 -- [-2644.322] (-2642.354) (-2640.687) (-2643.458) * (-2638.861) (-2638.676) (-2636.765) [-2639.166] -- 0:02:35 255000 -- [-2639.848] (-2640.461) (-2642.238) (-2660.788) * (-2641.494) [-2639.743] (-2638.536) (-2636.475) -- 0:02:34 Average standard deviation of split frequencies: 0.000000 255500 -- (-2649.089) [-2639.388] (-2637.647) (-2641.142) * (-2641.955) (-2642.641) [-2634.406] (-2640.257) -- 0:02:34 256000 -- (-2644.103) (-2642.524) (-2640.896) [-2645.545] * (-2648.271) [-2639.110] (-2642.253) (-2636.868) -- 0:02:34 256500 -- [-2639.779] (-2640.778) (-2644.107) (-2643.552) * (-2642.324) (-2640.015) [-2633.467] (-2638.151) -- 0:02:33 257000 -- (-2636.446) (-2645.799) [-2638.745] (-2634.081) * (-2642.790) [-2640.521] (-2641.208) (-2644.800) -- 0:02:36 257500 -- (-2632.171) (-2640.848) [-2636.782] (-2639.621) * (-2645.463) (-2642.809) (-2639.549) [-2639.829] -- 0:02:35 258000 -- (-2638.910) (-2641.236) (-2638.609) [-2637.599] * (-2643.948) [-2639.073] (-2642.031) (-2639.192) -- 0:02:35 258500 -- (-2640.214) [-2638.437] (-2637.284) (-2633.468) * [-2639.333] (-2643.406) (-2644.974) (-2645.649) -- 0:02:34 259000 -- (-2640.126) (-2637.040) [-2639.050] (-2639.445) * (-2648.614) (-2644.919) [-2638.009] (-2644.333) -- 0:02:34 259500 -- (-2638.397) (-2638.927) [-2639.143] (-2640.258) * [-2639.921] (-2640.279) (-2639.640) (-2645.302) -- 0:02:34 260000 -- [-2643.419] (-2641.660) (-2648.327) (-2638.537) * (-2640.613) (-2647.892) [-2641.121] (-2636.728) -- 0:02:33 Average standard deviation of split frequencies: 0.000000 260500 -- (-2637.843) [-2642.583] (-2645.156) (-2635.049) * (-2640.633) (-2641.352) [-2639.056] (-2643.744) -- 0:02:33 261000 -- (-2640.851) [-2637.634] (-2637.276) (-2642.315) * (-2643.732) [-2647.047] (-2637.009) (-2646.562) -- 0:02:32 261500 -- [-2643.664] (-2644.146) (-2642.636) (-2640.733) * (-2644.660) (-2658.889) [-2637.240] (-2637.762) -- 0:02:32 262000 -- (-2644.208) (-2646.155) [-2643.516] (-2640.538) * (-2639.665) (-2650.337) (-2640.522) [-2642.894] -- 0:02:34 262500 -- (-2640.764) (-2639.579) [-2642.537] (-2639.835) * [-2634.722] (-2647.615) (-2645.402) (-2637.886) -- 0:02:34 263000 -- [-2637.676] (-2639.713) (-2644.359) (-2642.578) * (-2636.359) (-2647.152) (-2637.580) [-2638.889] -- 0:02:34 263500 -- (-2637.736) [-2633.472] (-2637.547) (-2639.062) * [-2642.646] (-2646.025) (-2637.207) (-2638.769) -- 0:02:33 264000 -- (-2638.811) [-2640.479] (-2633.079) (-2645.012) * (-2639.879) (-2644.756) [-2636.938] (-2646.227) -- 0:02:33 264500 -- (-2647.909) (-2642.328) (-2640.447) [-2642.959] * (-2643.498) [-2642.083] (-2640.601) (-2640.892) -- 0:02:32 265000 -- [-2640.906] (-2641.603) (-2636.978) (-2643.288) * (-2636.896) [-2654.531] (-2635.102) (-2641.779) -- 0:02:32 Average standard deviation of split frequencies: 0.000000 265500 -- (-2643.932) [-2641.143] (-2645.444) (-2639.637) * [-2641.156] (-2643.056) (-2649.409) (-2640.676) -- 0:02:32 266000 -- (-2643.239) (-2640.492) [-2643.597] (-2646.683) * (-2640.571) (-2641.612) (-2636.365) [-2638.035] -- 0:02:34 266500 -- [-2639.232] (-2636.336) (-2647.330) (-2642.984) * (-2641.813) [-2634.449] (-2642.044) (-2636.357) -- 0:02:34 267000 -- (-2638.297) [-2641.408] (-2645.352) (-2640.859) * [-2635.501] (-2640.282) (-2639.217) (-2635.843) -- 0:02:33 267500 -- (-2644.023) (-2642.345) [-2644.307] (-2644.334) * [-2635.189] (-2638.824) (-2640.035) (-2641.835) -- 0:02:33 268000 -- (-2642.747) (-2644.324) [-2640.654] (-2636.869) * (-2640.302) (-2637.487) (-2647.602) [-2638.689] -- 0:02:32 268500 -- (-2639.143) (-2650.793) (-2639.212) [-2642.752] * (-2643.382) (-2635.492) (-2636.684) [-2645.446] -- 0:02:32 269000 -- [-2639.694] (-2648.910) (-2639.879) (-2644.668) * [-2635.656] (-2638.456) (-2637.303) (-2636.828) -- 0:02:32 269500 -- (-2648.346) [-2641.564] (-2644.403) (-2641.896) * (-2642.929) [-2638.210] (-2638.163) (-2639.859) -- 0:02:31 270000 -- (-2634.243) (-2640.701) (-2637.225) [-2639.325] * [-2641.310] (-2647.613) (-2646.372) (-2637.304) -- 0:02:31 Average standard deviation of split frequencies: 0.000000 270500 -- (-2641.493) (-2644.997) (-2636.164) [-2641.657] * [-2636.125] (-2639.381) (-2647.488) (-2644.918) -- 0:02:31 271000 -- (-2648.624) (-2639.590) (-2652.256) [-2647.728] * (-2636.233) [-2643.417] (-2640.904) (-2641.216) -- 0:02:33 271500 -- [-2640.133] (-2642.484) (-2640.894) (-2646.603) * (-2637.181) [-2638.555] (-2639.963) (-2636.864) -- 0:02:32 272000 -- (-2638.367) [-2640.761] (-2639.852) (-2636.422) * (-2640.542) (-2643.149) (-2643.356) [-2637.279] -- 0:02:32 272500 -- (-2640.642) (-2641.164) [-2646.636] (-2646.296) * (-2642.203) (-2641.347) [-2641.368] (-2638.639) -- 0:02:32 273000 -- (-2642.849) [-2640.598] (-2639.278) (-2649.519) * (-2643.784) (-2636.378) (-2638.835) [-2634.705] -- 0:02:31 273500 -- (-2646.336) (-2647.309) [-2639.564] (-2640.124) * [-2637.568] (-2639.937) (-2643.428) (-2640.213) -- 0:02:31 274000 -- (-2645.365) (-2639.845) [-2638.691] (-2644.710) * (-2644.250) (-2638.643) (-2644.278) [-2634.122] -- 0:02:31 274500 -- (-2643.588) [-2636.124] (-2636.940) (-2655.224) * [-2640.946] (-2636.921) (-2643.025) (-2639.657) -- 0:02:30 275000 -- (-2641.166) (-2636.385) [-2639.267] (-2647.389) * (-2644.519) (-2642.902) [-2636.766] (-2637.608) -- 0:02:30 Average standard deviation of split frequencies: 0.000000 275500 -- (-2643.677) (-2638.679) [-2641.132] (-2642.284) * (-2639.671) [-2641.423] (-2634.396) (-2644.467) -- 0:02:32 276000 -- [-2646.107] (-2648.256) (-2643.659) (-2639.971) * (-2641.050) [-2638.601] (-2635.195) (-2642.843) -- 0:02:32 276500 -- (-2641.615) [-2640.218] (-2640.409) (-2640.260) * (-2639.775) (-2639.256) [-2640.754] (-2641.390) -- 0:02:31 277000 -- [-2643.070] (-2646.810) (-2634.621) (-2643.345) * [-2642.136] (-2633.979) (-2644.639) (-2644.070) -- 0:02:31 277500 -- (-2640.286) (-2648.686) [-2641.360] (-2636.812) * (-2637.766) [-2636.981] (-2648.606) (-2640.793) -- 0:02:31 278000 -- (-2639.024) (-2643.441) (-2638.938) [-2639.756] * [-2635.655] (-2643.844) (-2647.932) (-2637.021) -- 0:02:30 278500 -- (-2645.823) (-2640.818) [-2648.977] (-2633.392) * (-2639.762) (-2638.824) (-2648.037) [-2633.559] -- 0:02:30 279000 -- (-2648.069) (-2641.672) [-2640.283] (-2637.860) * (-2639.783) (-2641.655) (-2650.606) [-2642.518] -- 0:02:29 279500 -- (-2637.062) [-2635.162] (-2641.777) (-2636.990) * (-2636.840) (-2643.555) (-2646.948) [-2643.082] -- 0:02:29 280000 -- (-2640.363) [-2639.331] (-2636.971) (-2641.631) * [-2638.394] (-2643.223) (-2644.475) (-2645.473) -- 0:02:29 Average standard deviation of split frequencies: 0.000000 280500 -- (-2642.172) (-2635.709) (-2640.001) [-2640.465] * (-2644.102) (-2639.915) (-2638.469) [-2642.441] -- 0:02:31 281000 -- (-2653.626) (-2635.430) (-2636.333) [-2639.837] * (-2635.429) (-2636.703) (-2643.222) [-2643.049] -- 0:02:30 281500 -- (-2644.593) [-2638.223] (-2638.547) (-2642.765) * (-2641.805) (-2642.020) [-2638.601] (-2642.535) -- 0:02:30 282000 -- (-2638.068) (-2634.486) (-2642.375) [-2638.500] * (-2649.503) (-2644.189) (-2638.745) [-2636.031] -- 0:02:30 282500 -- (-2639.688) (-2647.181) (-2638.226) [-2636.989] * (-2641.867) [-2636.876] (-2637.051) (-2645.579) -- 0:02:29 283000 -- [-2639.587] (-2651.206) (-2641.524) (-2642.917) * (-2647.348) [-2637.380] (-2638.679) (-2639.505) -- 0:02:29 283500 -- [-2639.584] (-2637.699) (-2640.575) (-2641.087) * (-2644.940) (-2638.392) [-2635.682] (-2640.704) -- 0:02:29 284000 -- (-2636.652) (-2641.771) [-2638.766] (-2641.200) * (-2641.217) (-2640.430) (-2640.163) [-2640.574] -- 0:02:28 284500 -- (-2644.972) (-2640.036) [-2643.437] (-2637.275) * [-2642.499] (-2644.808) (-2636.289) (-2639.942) -- 0:02:28 285000 -- [-2634.710] (-2639.454) (-2639.180) (-2636.143) * (-2644.535) (-2637.407) (-2642.295) [-2635.345] -- 0:02:30 Average standard deviation of split frequencies: 0.000000 285500 -- (-2634.491) [-2639.002] (-2645.455) (-2639.184) * (-2645.292) (-2640.584) (-2644.440) [-2635.456] -- 0:02:30 286000 -- (-2640.349) [-2642.118] (-2643.729) (-2637.626) * (-2641.084) [-2642.519] (-2635.922) (-2646.546) -- 0:02:29 286500 -- [-2637.201] (-2638.545) (-2644.756) (-2645.589) * [-2636.840] (-2640.716) (-2637.315) (-2637.885) -- 0:02:29 287000 -- [-2639.020] (-2642.149) (-2640.031) (-2645.172) * (-2640.037) (-2641.213) (-2640.658) [-2640.278] -- 0:02:29 287500 -- (-2639.410) (-2643.927) [-2636.635] (-2642.405) * (-2640.680) [-2644.539] (-2647.034) (-2635.253) -- 0:02:28 288000 -- [-2640.372] (-2642.138) (-2638.601) (-2642.737) * [-2639.023] (-2640.413) (-2641.538) (-2641.321) -- 0:02:28 288500 -- (-2641.201) [-2637.421] (-2633.973) (-2645.693) * (-2647.864) [-2644.535] (-2652.689) (-2637.440) -- 0:02:27 289000 -- (-2649.130) (-2645.166) (-2639.696) [-2638.777] * [-2643.998] (-2638.585) (-2636.476) (-2636.058) -- 0:02:27 289500 -- (-2647.220) (-2641.782) [-2634.081] (-2641.301) * [-2637.535] (-2638.830) (-2641.690) (-2641.112) -- 0:02:29 290000 -- (-2641.050) (-2640.256) (-2641.391) [-2637.494] * [-2638.227] (-2637.558) (-2641.135) (-2639.503) -- 0:02:29 Average standard deviation of split frequencies: 0.000000 290500 -- (-2642.289) [-2637.589] (-2637.644) (-2639.818) * (-2640.927) (-2634.815) (-2641.097) [-2638.558] -- 0:02:28 291000 -- [-2639.312] (-2642.670) (-2637.391) (-2644.499) * (-2639.417) (-2635.729) [-2643.372] (-2643.003) -- 0:02:28 291500 -- [-2641.662] (-2642.507) (-2639.747) (-2651.488) * [-2638.614] (-2650.687) (-2637.452) (-2640.643) -- 0:02:28 292000 -- (-2635.665) (-2641.565) [-2644.471] (-2636.250) * [-2634.354] (-2643.021) (-2639.508) (-2642.770) -- 0:02:27 292500 -- (-2644.151) [-2642.465] (-2636.998) (-2644.209) * [-2638.853] (-2648.225) (-2634.445) (-2647.929) -- 0:02:27 293000 -- (-2639.171) (-2644.707) (-2642.045) [-2634.024] * (-2639.473) (-2644.671) [-2634.691] (-2641.288) -- 0:02:27 293500 -- [-2640.192] (-2650.813) (-2640.861) (-2638.308) * [-2638.737] (-2638.277) (-2638.743) (-2643.799) -- 0:02:26 294000 -- (-2640.535) (-2644.154) [-2644.596] (-2635.903) * (-2638.756) [-2635.707] (-2635.937) (-2646.537) -- 0:02:26 294500 -- (-2639.025) (-2643.045) [-2640.680] (-2640.217) * (-2640.604) [-2632.171] (-2643.104) (-2640.295) -- 0:02:28 295000 -- (-2640.568) [-2643.629] (-2646.395) (-2633.058) * [-2642.302] (-2641.891) (-2641.294) (-2641.206) -- 0:02:28 Average standard deviation of split frequencies: 0.000000 295500 -- (-2642.893) (-2637.100) (-2643.248) [-2641.774] * (-2644.542) (-2638.182) [-2638.356] (-2641.178) -- 0:02:27 296000 -- (-2637.397) (-2643.815) (-2634.554) [-2639.085] * [-2640.051] (-2638.257) (-2637.543) (-2641.636) -- 0:02:27 296500 -- [-2645.258] (-2640.723) (-2636.060) (-2646.606) * (-2637.783) [-2638.085] (-2638.239) (-2644.760) -- 0:02:27 297000 -- (-2642.043) [-2637.714] (-2635.127) (-2640.895) * (-2635.575) (-2639.486) (-2640.831) [-2639.287] -- 0:02:26 297500 -- (-2638.200) (-2635.644) [-2636.164] (-2643.899) * (-2636.062) (-2643.047) (-2640.413) [-2639.315] -- 0:02:26 298000 -- (-2641.544) (-2637.522) (-2642.795) [-2635.925] * (-2645.134) (-2636.381) (-2641.609) [-2640.780] -- 0:02:26 298500 -- (-2640.895) (-2635.430) [-2639.574] (-2641.288) * (-2644.694) [-2636.104] (-2640.989) (-2639.419) -- 0:02:25 299000 -- [-2637.252] (-2643.816) (-2636.908) (-2645.303) * (-2639.950) (-2644.020) (-2648.656) [-2641.330] -- 0:02:27 299500 -- (-2633.796) (-2642.786) [-2638.295] (-2641.187) * [-2636.156] (-2646.605) (-2645.062) (-2640.304) -- 0:02:27 300000 -- [-2636.369] (-2645.101) (-2641.421) (-2640.741) * (-2635.015) (-2641.198) (-2642.562) [-2639.552] -- 0:02:27 Average standard deviation of split frequencies: 0.000000 300500 -- (-2646.322) (-2639.444) [-2640.949] (-2640.659) * (-2638.739) (-2641.478) [-2640.631] (-2640.950) -- 0:02:26 301000 -- (-2642.961) (-2645.085) [-2639.051] (-2637.705) * [-2637.952] (-2638.068) (-2637.634) (-2646.248) -- 0:02:26 301500 -- (-2647.013) [-2640.731] (-2645.316) (-2646.298) * (-2639.665) (-2642.749) [-2635.817] (-2639.553) -- 0:02:25 302000 -- (-2638.801) [-2637.672] (-2639.592) (-2639.077) * [-2634.495] (-2639.912) (-2642.400) (-2639.247) -- 0:02:25 302500 -- (-2635.539) [-2641.729] (-2642.570) (-2633.917) * [-2639.437] (-2650.873) (-2640.179) (-2643.818) -- 0:02:25 303000 -- (-2640.267) [-2638.184] (-2641.885) (-2638.803) * (-2635.641) [-2639.384] (-2640.809) (-2634.472) -- 0:02:24 303500 -- (-2633.755) (-2634.647) (-2643.079) [-2648.468] * [-2639.208] (-2643.339) (-2642.130) (-2642.007) -- 0:02:24 304000 -- [-2639.326] (-2636.955) (-2637.242) (-2653.944) * (-2640.018) (-2641.646) (-2646.211) [-2636.670] -- 0:02:26 304500 -- (-2641.752) (-2646.101) (-2642.663) [-2638.344] * (-2638.875) [-2637.672] (-2643.186) (-2645.793) -- 0:02:26 305000 -- (-2642.645) [-2636.245] (-2638.835) (-2639.842) * (-2638.862) (-2642.611) (-2644.591) [-2641.261] -- 0:02:25 Average standard deviation of split frequencies: 0.000000 305500 -- (-2641.928) (-2645.369) [-2637.896] (-2642.194) * (-2639.881) [-2642.273] (-2642.000) (-2641.790) -- 0:02:25 306000 -- (-2642.862) (-2638.863) (-2642.068) [-2640.409] * (-2641.785) (-2643.032) [-2637.862] (-2639.989) -- 0:02:25 306500 -- (-2644.755) (-2642.598) (-2639.671) [-2646.795] * (-2636.881) (-2654.066) [-2637.957] (-2643.704) -- 0:02:24 307000 -- (-2641.614) (-2643.819) [-2645.399] (-2648.852) * (-2640.309) (-2642.930) (-2638.686) [-2643.589] -- 0:02:24 307500 -- (-2636.443) (-2642.642) [-2641.593] (-2640.164) * (-2639.247) (-2639.653) (-2636.376) [-2640.233] -- 0:02:24 308000 -- (-2643.625) [-2638.023] (-2642.362) (-2638.006) * (-2638.428) (-2642.897) [-2635.795] (-2640.137) -- 0:02:23 308500 -- (-2637.783) (-2638.194) (-2645.405) [-2636.110] * (-2640.512) (-2641.397) [-2636.182] (-2640.536) -- 0:02:25 309000 -- (-2638.049) (-2635.041) (-2643.860) [-2638.054] * (-2646.478) (-2642.526) [-2640.890] (-2645.157) -- 0:02:25 309500 -- [-2636.539] (-2641.153) (-2645.016) (-2639.961) * [-2633.131] (-2643.070) (-2634.442) (-2641.608) -- 0:02:25 310000 -- (-2636.762) (-2642.059) (-2643.697) [-2640.422] * [-2638.248] (-2636.515) (-2638.136) (-2643.826) -- 0:02:24 Average standard deviation of split frequencies: 0.000000 310500 -- (-2636.335) (-2644.099) (-2644.178) [-2638.234] * (-2648.074) (-2644.774) (-2639.772) [-2644.793] -- 0:02:24 311000 -- (-2645.776) (-2635.678) (-2641.340) [-2640.144] * [-2638.226] (-2642.968) (-2641.559) (-2641.824) -- 0:02:24 311500 -- (-2637.428) [-2641.279] (-2636.433) (-2647.037) * (-2638.252) [-2635.688] (-2644.290) (-2637.958) -- 0:02:23 312000 -- (-2636.896) (-2648.581) [-2635.925] (-2643.325) * (-2642.057) (-2635.773) (-2644.079) [-2639.787] -- 0:02:23 312500 -- (-2643.426) [-2642.011] (-2637.916) (-2638.341) * (-2643.679) (-2643.902) [-2643.507] (-2642.511) -- 0:02:23 313000 -- (-2646.900) (-2646.976) (-2643.638) [-2633.824] * (-2639.055) (-2635.317) (-2651.720) [-2639.520] -- 0:02:24 313500 -- (-2652.208) (-2640.541) [-2638.412] (-2638.048) * [-2639.303] (-2639.671) (-2654.187) (-2644.267) -- 0:02:24 314000 -- [-2641.190] (-2639.370) (-2640.035) (-2645.134) * (-2639.725) [-2642.525] (-2643.827) (-2639.099) -- 0:02:24 314500 -- [-2645.356] (-2638.780) (-2637.827) (-2643.257) * [-2637.351] (-2634.799) (-2639.420) (-2643.845) -- 0:02:23 315000 -- (-2647.473) (-2635.807) [-2634.748] (-2645.752) * [-2642.752] (-2643.987) (-2642.494) (-2640.111) -- 0:02:23 Average standard deviation of split frequencies: 0.000000 315500 -- [-2647.344] (-2641.510) (-2634.077) (-2645.134) * (-2646.396) (-2634.615) (-2646.212) [-2638.346] -- 0:02:23 316000 -- [-2640.142] (-2642.186) (-2636.640) (-2649.932) * (-2638.901) (-2637.462) [-2639.430] (-2635.839) -- 0:02:22 316500 -- [-2642.377] (-2637.291) (-2639.560) (-2638.003) * (-2638.254) [-2637.702] (-2644.500) (-2640.392) -- 0:02:22 317000 -- [-2642.664] (-2649.756) (-2642.854) (-2639.578) * (-2637.974) (-2639.260) (-2640.952) [-2645.691] -- 0:02:22 317500 -- (-2639.039) (-2639.735) [-2641.733] (-2639.987) * (-2643.055) (-2639.556) [-2638.668] (-2642.797) -- 0:02:21 318000 -- (-2640.074) (-2638.885) [-2644.590] (-2643.397) * (-2644.400) (-2637.280) [-2640.396] (-2640.856) -- 0:02:23 318500 -- (-2647.628) [-2636.344] (-2652.642) (-2637.033) * (-2641.149) [-2645.285] (-2641.766) (-2645.079) -- 0:02:23 319000 -- [-2641.551] (-2637.041) (-2641.315) (-2638.164) * (-2638.730) (-2639.356) (-2638.513) [-2635.778] -- 0:02:23 319500 -- [-2643.660] (-2638.856) (-2646.143) (-2644.625) * [-2640.200] (-2643.001) (-2638.621) (-2638.770) -- 0:02:22 320000 -- (-2637.717) (-2639.129) [-2641.933] (-2638.631) * (-2643.480) (-2642.110) [-2636.992] (-2640.241) -- 0:02:22 Average standard deviation of split frequencies: 0.000000 320500 -- [-2640.141] (-2641.680) (-2644.859) (-2635.749) * (-2640.451) (-2641.262) (-2640.729) [-2641.404] -- 0:02:22 321000 -- (-2642.655) (-2640.264) [-2641.197] (-2638.513) * (-2645.978) [-2637.552] (-2638.802) (-2641.788) -- 0:02:21 321500 -- (-2635.836) (-2635.471) (-2638.629) [-2637.296] * (-2634.783) (-2637.978) [-2638.598] (-2639.559) -- 0:02:21 322000 -- (-2634.572) (-2632.006) [-2640.358] (-2646.855) * (-2639.240) [-2639.137] (-2642.260) (-2642.742) -- 0:02:21 322500 -- (-2638.633) [-2637.413] (-2639.487) (-2651.189) * [-2636.893] (-2642.172) (-2644.914) (-2639.566) -- 0:02:22 323000 -- [-2636.891] (-2641.555) (-2636.093) (-2642.873) * [-2637.238] (-2637.556) (-2639.747) (-2640.429) -- 0:02:22 323500 -- (-2640.762) [-2639.560] (-2644.047) (-2635.664) * (-2639.762) (-2643.188) (-2644.295) [-2639.334] -- 0:02:22 324000 -- [-2645.699] (-2640.903) (-2639.844) (-2640.058) * (-2644.531) [-2638.183] (-2643.891) (-2640.571) -- 0:02:21 324500 -- [-2642.615] (-2639.803) (-2641.847) (-2639.247) * (-2635.874) (-2635.733) [-2639.601] (-2639.334) -- 0:02:21 325000 -- (-2640.810) (-2644.103) (-2639.956) [-2642.708] * (-2648.382) (-2643.664) [-2639.461] (-2645.404) -- 0:02:21 Average standard deviation of split frequencies: 0.000000 325500 -- (-2641.004) [-2639.085] (-2643.167) (-2639.295) * (-2639.959) (-2642.081) [-2638.335] (-2642.963) -- 0:02:20 326000 -- (-2641.234) [-2638.441] (-2638.990) (-2640.161) * (-2644.484) (-2644.602) (-2637.810) [-2638.181] -- 0:02:20 326500 -- (-2637.571) (-2632.499) [-2643.839] (-2642.049) * (-2636.265) (-2637.264) [-2637.063] (-2641.069) -- 0:02:20 327000 -- (-2645.042) (-2640.889) [-2641.909] (-2645.250) * (-2639.837) (-2641.120) (-2641.824) [-2639.597] -- 0:02:19 327500 -- [-2642.223] (-2645.031) (-2641.358) (-2644.925) * (-2641.622) (-2636.815) [-2642.530] (-2647.329) -- 0:02:21 328000 -- [-2640.191] (-2636.725) (-2644.584) (-2639.844) * (-2645.287) (-2641.628) (-2643.775) [-2641.522] -- 0:02:21 328500 -- [-2636.832] (-2640.029) (-2639.401) (-2643.800) * (-2639.964) (-2639.425) [-2635.239] (-2646.378) -- 0:02:21 329000 -- [-2636.935] (-2640.714) (-2644.270) (-2636.726) * (-2640.058) (-2642.929) (-2640.224) [-2643.728] -- 0:02:20 329500 -- (-2637.589) (-2654.572) [-2645.023] (-2643.219) * (-2638.065) (-2640.578) (-2644.972) [-2644.698] -- 0:02:20 330000 -- (-2636.105) [-2637.599] (-2640.664) (-2642.266) * (-2636.748) (-2638.485) (-2648.416) [-2638.847] -- 0:02:20 Average standard deviation of split frequencies: 0.000000 330500 -- (-2637.261) (-2640.272) (-2640.546) [-2637.816] * [-2642.614] (-2637.607) (-2639.350) (-2641.726) -- 0:02:19 331000 -- (-2643.821) [-2637.529] (-2635.612) (-2645.708) * (-2645.203) [-2634.772] (-2640.467) (-2639.828) -- 0:02:19 331500 -- (-2638.381) [-2641.382] (-2643.087) (-2636.428) * [-2640.228] (-2644.615) (-2641.709) (-2643.913) -- 0:02:19 332000 -- (-2646.693) [-2635.814] (-2638.517) (-2640.721) * (-2638.344) (-2645.434) (-2637.110) [-2634.833] -- 0:02:20 332500 -- (-2642.617) (-2641.802) (-2637.749) [-2646.117] * (-2639.457) [-2638.506] (-2645.561) (-2642.614) -- 0:02:20 333000 -- (-2641.587) [-2637.853] (-2642.371) (-2644.443) * (-2642.048) [-2638.291] (-2647.537) (-2639.399) -- 0:02:20 333500 -- (-2648.606) (-2636.905) (-2641.861) [-2642.955] * (-2638.804) (-2635.181) [-2639.236] (-2634.466) -- 0:02:19 334000 -- (-2655.465) [-2636.307] (-2640.351) (-2642.048) * (-2643.265) (-2639.027) (-2639.019) [-2638.677] -- 0:02:19 334500 -- (-2640.548) [-2644.526] (-2646.541) (-2641.422) * (-2653.358) [-2643.281] (-2643.344) (-2637.778) -- 0:02:19 335000 -- (-2640.449) (-2640.468) (-2637.298) [-2636.741] * [-2642.815] (-2635.934) (-2640.568) (-2641.021) -- 0:02:18 Average standard deviation of split frequencies: 0.000000 335500 -- (-2638.274) (-2636.869) (-2637.528) [-2638.160] * [-2636.408] (-2645.648) (-2644.628) (-2638.021) -- 0:02:18 336000 -- (-2642.548) [-2634.171] (-2645.534) (-2648.769) * (-2642.488) (-2642.541) [-2637.136] (-2649.532) -- 0:02:18 336500 -- (-2634.191) (-2640.998) [-2639.893] (-2643.236) * (-2634.735) (-2644.633) (-2640.377) [-2638.936] -- 0:02:19 337000 -- [-2637.228] (-2634.759) (-2640.274) (-2639.885) * (-2637.774) [-2644.317] (-2641.627) (-2639.915) -- 0:02:19 337500 -- (-2644.341) (-2643.429) [-2636.812] (-2642.234) * (-2640.745) (-2642.173) (-2635.984) [-2635.710] -- 0:02:19 338000 -- (-2636.806) (-2637.101) [-2636.428] (-2637.085) * (-2644.364) (-2640.946) (-2637.835) [-2637.059] -- 0:02:19 338500 -- (-2640.457) (-2636.716) [-2638.246] (-2641.097) * [-2635.447] (-2640.590) (-2636.751) (-2643.729) -- 0:02:18 339000 -- (-2642.077) (-2640.753) [-2636.462] (-2640.047) * [-2641.648] (-2639.872) (-2637.750) (-2648.058) -- 0:02:18 339500 -- [-2640.792] (-2641.678) (-2641.751) (-2638.342) * (-2644.741) (-2638.870) (-2642.554) [-2639.415] -- 0:02:18 340000 -- (-2641.404) [-2643.824] (-2638.810) (-2641.454) * [-2641.986] (-2638.707) (-2641.260) (-2646.226) -- 0:02:17 Average standard deviation of split frequencies: 0.000000 340500 -- (-2639.458) (-2643.232) (-2637.914) [-2635.722] * (-2648.065) [-2632.970] (-2648.362) (-2634.761) -- 0:02:17 341000 -- (-2642.126) [-2638.425] (-2639.408) (-2643.656) * (-2641.154) (-2635.982) (-2642.240) [-2641.349] -- 0:02:17 341500 -- [-2646.017] (-2638.469) (-2638.900) (-2635.621) * (-2640.551) (-2646.424) [-2640.137] (-2641.460) -- 0:02:18 342000 -- (-2639.321) (-2640.451) (-2638.274) [-2636.724] * (-2645.304) (-2642.948) (-2636.237) [-2644.499] -- 0:02:18 342500 -- (-2638.934) (-2639.938) (-2640.070) [-2636.328] * (-2639.687) [-2640.243] (-2639.960) (-2638.251) -- 0:02:18 343000 -- [-2638.247] (-2641.976) (-2642.198) (-2642.285) * (-2641.686) (-2634.480) [-2638.063] (-2639.557) -- 0:02:17 343500 -- (-2640.542) (-2642.925) [-2638.332] (-2642.670) * (-2652.272) [-2636.789] (-2641.355) (-2635.801) -- 0:02:17 344000 -- (-2641.218) [-2637.709] (-2640.721) (-2635.429) * (-2643.705) (-2645.163) (-2644.077) [-2653.283] -- 0:02:17 344500 -- (-2634.780) (-2636.024) (-2641.080) [-2637.227] * (-2640.553) (-2637.499) [-2633.752] (-2639.634) -- 0:02:16 345000 -- (-2641.978) [-2640.477] (-2644.531) (-2636.094) * (-2646.571) [-2639.018] (-2636.572) (-2641.325) -- 0:02:16 Average standard deviation of split frequencies: 0.000000 345500 -- [-2639.225] (-2641.989) (-2644.473) (-2642.358) * (-2643.032) (-2642.629) [-2636.048] (-2646.604) -- 0:02:16 346000 -- (-2645.088) (-2635.920) [-2635.425] (-2638.273) * (-2643.357) [-2637.831] (-2640.566) (-2642.687) -- 0:02:17 346500 -- (-2640.733) [-2638.900] (-2639.116) (-2638.674) * (-2634.500) (-2637.066) [-2636.131] (-2638.576) -- 0:02:17 347000 -- (-2637.665) (-2634.916) (-2646.216) [-2635.818] * (-2637.955) (-2637.195) (-2640.895) [-2638.593] -- 0:02:17 347500 -- (-2638.950) (-2636.849) [-2645.738] (-2650.587) * [-2638.002] (-2641.258) (-2641.644) (-2639.485) -- 0:02:17 348000 -- (-2635.920) (-2639.299) (-2638.163) [-2643.281] * (-2638.280) (-2645.270) (-2640.661) [-2640.868] -- 0:02:16 348500 -- (-2638.273) [-2636.865] (-2640.455) (-2640.294) * (-2640.605) (-2638.927) (-2638.944) [-2637.590] -- 0:02:16 349000 -- (-2641.855) [-2636.208] (-2634.812) (-2652.288) * (-2646.316) [-2638.488] (-2640.629) (-2634.598) -- 0:02:16 349500 -- [-2637.336] (-2634.653) (-2644.162) (-2642.746) * (-2642.502) [-2642.216] (-2640.906) (-2638.718) -- 0:02:15 350000 -- (-2643.179) (-2638.138) [-2636.068] (-2638.604) * (-2643.140) (-2645.306) (-2644.684) [-2639.718] -- 0:02:15 Average standard deviation of split frequencies: 0.000000 350500 -- (-2644.923) (-2633.164) (-2640.416) [-2647.928] * (-2645.051) (-2644.263) (-2642.204) [-2640.533] -- 0:02:15 351000 -- (-2650.941) [-2638.032] (-2650.655) (-2647.065) * (-2639.795) (-2644.965) [-2644.303] (-2643.994) -- 0:02:16 351500 -- (-2640.552) (-2640.250) [-2637.694] (-2644.625) * (-2639.635) (-2638.380) [-2637.277] (-2647.358) -- 0:02:16 352000 -- (-2639.005) (-2638.221) [-2636.521] (-2639.288) * (-2645.766) (-2640.776) (-2646.527) [-2645.030] -- 0:02:16 352500 -- (-2645.206) (-2641.633) (-2645.848) [-2640.775] * (-2648.756) (-2646.743) [-2640.787] (-2638.784) -- 0:02:15 353000 -- [-2643.121] (-2641.611) (-2637.531) (-2641.074) * (-2646.732) (-2641.574) (-2638.011) [-2637.436] -- 0:02:15 353500 -- (-2647.140) (-2635.755) [-2638.387] (-2638.919) * (-2635.794) (-2637.875) (-2639.304) [-2636.031] -- 0:02:15 354000 -- (-2644.240) (-2649.139) [-2636.467] (-2645.387) * [-2641.555] (-2641.271) (-2642.206) (-2637.760) -- 0:02:15 354500 -- (-2645.051) [-2641.305] (-2649.586) (-2640.438) * (-2639.944) (-2637.823) [-2638.064] (-2642.392) -- 0:02:14 355000 -- (-2638.013) (-2644.913) [-2636.311] (-2639.658) * (-2639.318) (-2640.827) (-2636.446) [-2639.523] -- 0:02:14 Average standard deviation of split frequencies: 0.000000 355500 -- (-2638.041) (-2643.373) [-2640.844] (-2637.399) * (-2645.492) (-2641.696) [-2639.604] (-2639.675) -- 0:02:15 356000 -- (-2640.280) (-2642.335) [-2641.685] (-2647.341) * [-2640.904] (-2645.835) (-2640.092) (-2637.585) -- 0:02:15 356500 -- [-2637.127] (-2647.791) (-2645.937) (-2636.308) * (-2636.276) (-2647.376) (-2640.015) [-2637.113] -- 0:02:15 357000 -- (-2645.897) [-2640.089] (-2642.560) (-2638.164) * (-2639.188) (-2642.309) (-2639.893) [-2643.863] -- 0:02:15 357500 -- (-2639.214) (-2641.859) (-2637.388) [-2638.347] * (-2642.649) (-2639.086) [-2650.938] (-2639.114) -- 0:02:14 358000 -- [-2641.025] (-2646.235) (-2636.081) (-2638.310) * (-2633.075) (-2637.461) [-2636.616] (-2639.140) -- 0:02:14 358500 -- (-2639.880) [-2639.784] (-2635.479) (-2637.733) * [-2634.458] (-2638.925) (-2639.976) (-2641.072) -- 0:02:14 359000 -- (-2641.963) [-2638.265] (-2639.687) (-2637.266) * (-2639.714) (-2640.293) [-2638.411] (-2642.948) -- 0:02:13 359500 -- (-2641.064) [-2636.057] (-2637.521) (-2644.054) * (-2637.993) (-2640.443) [-2636.063] (-2640.664) -- 0:02:13 360000 -- (-2636.558) (-2640.885) (-2644.972) [-2640.634] * [-2636.899] (-2640.803) (-2640.189) (-2640.757) -- 0:02:15 Average standard deviation of split frequencies: 0.000000 360500 -- [-2635.156] (-2645.441) (-2641.148) (-2640.400) * (-2646.832) (-2640.609) [-2638.239] (-2638.214) -- 0:02:14 361000 -- (-2637.660) (-2643.325) [-2640.933] (-2639.909) * (-2641.209) (-2639.101) [-2637.380] (-2644.003) -- 0:02:14 361500 -- (-2642.075) (-2647.090) (-2641.375) [-2639.517] * [-2640.282] (-2636.030) (-2646.813) (-2642.545) -- 0:02:14 362000 -- (-2634.345) (-2639.059) (-2641.777) [-2633.934] * (-2645.752) (-2641.162) [-2639.101] (-2647.070) -- 0:02:13 362500 -- [-2638.332] (-2634.747) (-2638.460) (-2645.683) * (-2636.425) (-2637.089) [-2639.232] (-2639.977) -- 0:02:13 363000 -- (-2635.673) [-2640.075] (-2645.208) (-2637.389) * (-2636.721) (-2643.907) [-2639.669] (-2641.598) -- 0:02:13 363500 -- (-2639.251) (-2644.671) (-2641.186) [-2640.764] * (-2641.956) (-2635.898) [-2638.664] (-2640.737) -- 0:02:13 364000 -- (-2640.393) [-2640.041] (-2647.331) (-2637.563) * [-2640.282] (-2643.714) (-2641.096) (-2642.456) -- 0:02:12 364500 -- (-2642.738) [-2638.522] (-2646.648) (-2644.780) * (-2637.036) [-2635.625] (-2640.099) (-2644.397) -- 0:02:12 365000 -- (-2641.963) (-2637.494) (-2646.712) [-2642.568] * (-2643.008) (-2643.910) [-2637.863] (-2645.234) -- 0:02:13 Average standard deviation of split frequencies: 0.000000 365500 -- (-2646.910) (-2639.853) [-2645.454] (-2639.075) * (-2641.638) [-2636.192] (-2640.444) (-2638.329) -- 0:02:13 366000 -- (-2639.415) (-2642.636) [-2640.620] (-2643.487) * [-2639.229] (-2642.675) (-2650.701) (-2641.952) -- 0:02:13 366500 -- (-2638.088) [-2638.282] (-2638.062) (-2643.024) * [-2635.068] (-2641.762) (-2650.064) (-2644.846) -- 0:02:13 367000 -- (-2636.580) [-2638.031] (-2642.413) (-2642.185) * (-2642.022) [-2640.548] (-2639.574) (-2642.450) -- 0:02:12 367500 -- [-2637.872] (-2638.003) (-2647.072) (-2642.661) * (-2641.484) (-2638.267) [-2639.703] (-2641.716) -- 0:02:12 368000 -- (-2640.098) (-2644.960) (-2640.267) [-2644.769] * (-2645.049) (-2637.868) [-2639.266] (-2640.187) -- 0:02:12 368500 -- (-2640.275) [-2646.831] (-2639.698) (-2640.291) * (-2640.583) (-2641.984) (-2639.198) [-2633.072] -- 0:02:11 369000 -- [-2638.095] (-2644.003) (-2640.414) (-2649.590) * [-2636.031] (-2639.994) (-2643.935) (-2636.254) -- 0:02:11 369500 -- [-2633.655] (-2636.766) (-2644.483) (-2648.156) * (-2639.355) [-2646.229] (-2639.315) (-2647.433) -- 0:02:11 370000 -- (-2636.957) (-2641.008) [-2638.917] (-2643.347) * (-2641.210) (-2644.751) [-2638.367] (-2641.053) -- 0:02:12 Average standard deviation of split frequencies: 0.000000 370500 -- (-2641.479) [-2637.946] (-2637.253) (-2643.409) * (-2637.672) (-2652.678) (-2633.800) [-2637.517] -- 0:02:12 371000 -- (-2642.562) (-2639.139) (-2644.209) [-2640.527] * [-2644.983] (-2636.131) (-2642.443) (-2642.489) -- 0:02:12 371500 -- (-2642.567) (-2638.752) (-2641.835) [-2638.597] * (-2645.131) [-2638.019] (-2644.375) (-2652.045) -- 0:02:11 372000 -- (-2641.030) [-2636.890] (-2642.744) (-2639.394) * (-2639.184) [-2636.817] (-2640.897) (-2646.367) -- 0:02:11 372500 -- (-2641.468) (-2638.872) (-2647.206) [-2638.518] * (-2639.684) (-2641.427) (-2649.851) [-2639.192] -- 0:02:11 373000 -- (-2645.022) (-2639.706) [-2644.032] (-2642.178) * (-2637.324) (-2639.667) (-2644.250) [-2636.574] -- 0:02:11 373500 -- (-2640.127) [-2638.359] (-2646.428) (-2648.540) * (-2641.525) (-2646.375) (-2640.813) [-2641.351] -- 0:02:10 374000 -- (-2650.007) (-2645.328) (-2646.236) [-2641.278] * (-2640.356) (-2642.437) [-2643.237] (-2638.065) -- 0:02:10 374500 -- (-2640.688) (-2641.217) [-2640.366] (-2648.225) * (-2639.655) (-2639.817) (-2641.026) [-2636.118] -- 0:02:11 375000 -- (-2641.341) (-2639.635) (-2647.188) [-2640.193] * (-2645.128) (-2639.826) [-2644.327] (-2636.702) -- 0:02:11 Average standard deviation of split frequencies: 0.000000 375500 -- (-2645.147) (-2640.774) (-2638.592) [-2644.993] * (-2643.004) (-2639.626) (-2637.662) [-2639.864] -- 0:02:11 376000 -- (-2640.155) (-2645.794) (-2643.271) [-2640.331] * (-2645.164) [-2637.736] (-2640.032) (-2646.912) -- 0:02:11 376500 -- (-2651.189) [-2643.562] (-2638.150) (-2643.731) * (-2638.555) (-2640.305) [-2638.037] (-2644.853) -- 0:02:10 377000 -- (-2641.382) (-2651.840) [-2638.202] (-2639.918) * (-2638.821) (-2644.255) (-2642.476) [-2642.408] -- 0:02:10 377500 -- (-2639.541) (-2642.006) [-2642.472] (-2636.293) * (-2638.041) [-2640.453] (-2641.136) (-2634.402) -- 0:02:10 378000 -- (-2637.608) (-2645.553) [-2641.088] (-2639.563) * (-2638.129) (-2644.952) (-2641.712) [-2641.711] -- 0:02:09 378500 -- (-2639.157) [-2638.493] (-2640.965) (-2639.480) * (-2636.623) [-2639.503] (-2642.718) (-2641.381) -- 0:02:09 379000 -- (-2641.738) (-2640.072) (-2639.602) [-2658.068] * (-2638.537) (-2639.493) (-2646.517) [-2644.220] -- 0:02:11 379500 -- (-2642.251) (-2639.515) (-2638.446) [-2637.277] * (-2637.742) [-2638.212] (-2642.830) (-2638.888) -- 0:02:10 380000 -- [-2634.668] (-2638.166) (-2648.489) (-2642.505) * [-2637.553] (-2650.752) (-2634.106) (-2636.929) -- 0:02:10 Average standard deviation of split frequencies: 0.000000 380500 -- [-2636.283] (-2640.949) (-2634.868) (-2640.227) * (-2637.489) (-2638.282) (-2637.667) [-2636.468] -- 0:02:10 381000 -- (-2634.233) (-2633.821) [-2643.729] (-2639.961) * (-2644.055) [-2641.845] (-2644.598) (-2635.598) -- 0:02:09 381500 -- (-2645.190) [-2634.427] (-2636.209) (-2638.009) * (-2641.252) (-2636.278) (-2640.498) [-2635.354] -- 0:02:09 382000 -- (-2642.909) (-2641.086) (-2638.669) [-2637.001] * [-2636.285] (-2641.239) (-2637.673) (-2639.443) -- 0:02:09 382500 -- (-2640.792) (-2641.811) (-2640.740) [-2635.222] * (-2640.838) (-2639.602) [-2641.900] (-2640.440) -- 0:02:09 383000 -- (-2642.724) [-2643.956] (-2639.901) (-2647.257) * (-2634.640) [-2641.927] (-2639.109) (-2643.436) -- 0:02:08 383500 -- [-2647.381] (-2643.049) (-2638.884) (-2636.906) * (-2644.137) (-2644.592) [-2640.024] (-2643.161) -- 0:02:08 384000 -- [-2636.797] (-2647.973) (-2642.817) (-2642.095) * [-2639.102] (-2642.437) (-2638.370) (-2638.424) -- 0:02:09 384500 -- (-2635.232) (-2648.465) (-2639.158) [-2636.033] * [-2638.419] (-2643.347) (-2636.656) (-2639.721) -- 0:02:09 385000 -- (-2638.557) (-2660.180) (-2641.749) [-2638.342] * [-2640.744] (-2641.404) (-2637.765) (-2642.452) -- 0:02:09 Average standard deviation of split frequencies: 0.000000 385500 -- (-2648.069) (-2649.849) [-2639.741] (-2640.413) * (-2639.665) (-2642.355) (-2639.074) [-2633.537] -- 0:02:09 386000 -- (-2633.825) (-2655.055) (-2640.648) [-2643.470] * (-2642.602) [-2636.184] (-2640.887) (-2640.484) -- 0:02:08 386500 -- (-2637.930) (-2643.108) [-2636.818] (-2644.855) * (-2642.204) (-2641.307) [-2639.346] (-2641.867) -- 0:02:08 387000 -- [-2643.183] (-2642.157) (-2641.058) (-2641.338) * (-2640.629) (-2642.144) (-2640.596) [-2637.809] -- 0:02:08 387500 -- [-2638.753] (-2657.374) (-2634.791) (-2647.248) * (-2642.621) (-2637.866) (-2645.989) [-2635.129] -- 0:02:08 388000 -- (-2642.348) (-2641.591) [-2643.682] (-2647.323) * [-2639.143] (-2649.385) (-2648.216) (-2640.718) -- 0:02:07 388500 -- [-2639.842] (-2643.196) (-2638.089) (-2644.223) * [-2635.396] (-2637.074) (-2639.073) (-2642.195) -- 0:02:09 389000 -- (-2639.020) (-2641.905) (-2642.277) [-2639.446] * [-2640.104] (-2646.524) (-2637.944) (-2637.371) -- 0:02:08 389500 -- (-2637.156) (-2646.221) (-2640.295) [-2648.504] * (-2633.918) (-2646.440) [-2634.595] (-2645.805) -- 0:02:08 390000 -- [-2639.697] (-2637.826) (-2642.618) (-2635.547) * [-2637.170] (-2645.552) (-2638.955) (-2637.030) -- 0:02:08 Average standard deviation of split frequencies: 0.000000 390500 -- [-2638.873] (-2638.984) (-2646.401) (-2644.090) * (-2637.999) (-2635.317) (-2637.831) [-2637.465] -- 0:02:07 391000 -- [-2641.692] (-2644.242) (-2638.318) (-2644.225) * [-2639.620] (-2637.232) (-2640.183) (-2646.732) -- 0:02:07 391500 -- (-2644.846) (-2646.129) (-2638.759) [-2633.970] * (-2638.412) (-2645.258) [-2638.629] (-2638.072) -- 0:02:07 392000 -- (-2639.543) [-2635.453] (-2644.115) (-2644.712) * [-2637.807] (-2648.857) (-2641.049) (-2640.697) -- 0:02:07 392500 -- (-2647.916) (-2639.609) (-2645.137) [-2636.604] * (-2641.060) (-2645.147) (-2635.859) [-2647.660] -- 0:02:06 393000 -- (-2641.476) [-2639.169] (-2636.785) (-2645.373) * [-2634.750] (-2640.115) (-2638.077) (-2640.922) -- 0:02:06 393500 -- [-2643.424] (-2645.088) (-2638.455) (-2642.715) * (-2640.827) [-2638.617] (-2640.968) (-2645.863) -- 0:02:07 394000 -- (-2643.209) (-2638.322) [-2640.921] (-2637.036) * (-2644.593) (-2638.950) (-2643.495) [-2638.543] -- 0:02:07 394500 -- (-2641.440) (-2652.390) (-2640.690) [-2639.648] * (-2643.424) (-2639.547) [-2644.738] (-2645.990) -- 0:02:07 395000 -- [-2641.848] (-2643.422) (-2640.826) (-2641.483) * (-2633.163) [-2641.554] (-2640.654) (-2643.021) -- 0:02:07 Average standard deviation of split frequencies: 0.000000 395500 -- [-2638.435] (-2647.989) (-2635.908) (-2643.179) * [-2637.530] (-2633.724) (-2636.936) (-2636.393) -- 0:02:06 396000 -- (-2634.884) (-2641.966) (-2642.004) [-2642.880] * (-2642.281) [-2643.559] (-2644.099) (-2637.405) -- 0:02:06 396500 -- [-2636.789] (-2638.431) (-2643.415) (-2641.207) * [-2635.474] (-2639.763) (-2636.593) (-2634.166) -- 0:02:06 397000 -- (-2637.337) (-2637.837) (-2643.838) [-2640.596] * [-2634.441] (-2641.559) (-2641.458) (-2636.174) -- 0:02:06 397500 -- (-2637.122) (-2637.290) (-2649.333) [-2643.788] * (-2643.036) (-2636.368) [-2636.270] (-2641.410) -- 0:02:05 398000 -- [-2640.258] (-2644.718) (-2645.652) (-2639.851) * (-2633.833) [-2638.992] (-2636.598) (-2645.495) -- 0:02:07 398500 -- (-2639.099) (-2641.335) [-2642.014] (-2642.473) * (-2636.760) (-2647.020) (-2638.624) [-2642.213] -- 0:02:06 399000 -- [-2639.020] (-2641.185) (-2639.865) (-2643.926) * (-2644.499) [-2636.512] (-2642.558) (-2642.652) -- 0:02:06 399500 -- (-2640.741) [-2638.304] (-2641.470) (-2641.020) * (-2642.801) [-2635.968] (-2642.673) (-2637.912) -- 0:02:06 400000 -- (-2640.848) (-2638.145) [-2633.754] (-2640.168) * [-2642.003] (-2642.772) (-2641.063) (-2635.945) -- 0:02:06 Average standard deviation of split frequencies: 0.000000 400500 -- (-2640.158) (-2634.966) [-2639.856] (-2640.575) * (-2646.867) (-2643.622) (-2648.894) [-2636.154] -- 0:02:05 401000 -- (-2641.190) [-2644.129] (-2644.667) (-2639.756) * [-2640.975] (-2645.364) (-2636.745) (-2640.982) -- 0:02:05 401500 -- [-2639.936] (-2636.345) (-2639.053) (-2642.892) * (-2642.505) [-2635.676] (-2641.554) (-2639.571) -- 0:02:05 402000 -- (-2641.336) (-2636.235) [-2638.908] (-2636.062) * (-2638.458) (-2638.708) (-2643.418) [-2640.571] -- 0:02:04 402500 -- (-2638.106) (-2640.314) (-2650.666) [-2637.465] * (-2643.526) [-2640.870] (-2642.238) (-2645.728) -- 0:02:04 403000 -- (-2637.101) (-2637.678) (-2656.780) [-2646.426] * (-2637.509) [-2643.044] (-2636.474) (-2646.729) -- 0:02:05 403500 -- [-2636.304] (-2638.771) (-2642.615) (-2652.889) * (-2637.124) (-2644.711) (-2640.833) [-2644.811] -- 0:02:05 404000 -- (-2642.835) [-2641.726] (-2642.957) (-2638.556) * (-2640.472) (-2647.373) [-2640.813] (-2639.488) -- 0:02:05 404500 -- (-2640.914) (-2643.899) (-2645.519) [-2641.071] * [-2643.720] (-2636.427) (-2640.217) (-2635.940) -- 0:02:05 405000 -- [-2640.100] (-2641.369) (-2639.854) (-2641.841) * (-2640.296) (-2634.647) [-2640.660] (-2638.325) -- 0:02:04 Average standard deviation of split frequencies: 0.000000 405500 -- (-2637.020) (-2644.912) [-2643.241] (-2644.948) * (-2636.661) (-2639.259) (-2641.606) [-2636.574] -- 0:02:04 406000 -- (-2635.133) (-2642.258) (-2644.060) [-2638.124] * (-2639.948) (-2648.823) (-2645.191) [-2633.475] -- 0:02:04 406500 -- (-2634.651) [-2634.748] (-2643.968) (-2644.715) * (-2642.669) (-2637.961) (-2647.158) [-2637.995] -- 0:02:04 407000 -- (-2638.185) [-2640.230] (-2641.098) (-2644.144) * (-2644.033) [-2635.502] (-2645.935) (-2637.298) -- 0:02:03 407500 -- (-2643.274) (-2638.645) [-2639.062] (-2637.838) * (-2641.331) [-2638.236] (-2644.286) (-2642.113) -- 0:02:05 408000 -- (-2645.923) (-2637.443) (-2642.742) [-2641.817] * (-2635.901) (-2641.476) (-2650.050) [-2640.976] -- 0:02:04 408500 -- [-2640.575] (-2640.772) (-2642.812) (-2643.989) * [-2641.550] (-2642.539) (-2645.288) (-2648.549) -- 0:02:04 409000 -- [-2641.184] (-2643.163) (-2637.666) (-2639.348) * (-2636.290) (-2640.352) [-2643.712] (-2640.917) -- 0:02:04 409500 -- (-2644.325) (-2639.193) [-2636.861] (-2651.267) * (-2643.429) (-2636.949) [-2635.871] (-2640.066) -- 0:02:04 410000 -- [-2642.601] (-2637.067) (-2637.919) (-2641.422) * (-2637.807) (-2640.739) [-2641.145] (-2646.532) -- 0:02:03 Average standard deviation of split frequencies: 0.000000 410500 -- (-2641.256) [-2636.431] (-2635.901) (-2639.914) * (-2638.616) (-2644.642) (-2639.492) [-2636.230] -- 0:02:03 411000 -- (-2637.298) (-2637.516) (-2637.828) [-2646.360] * (-2653.672) (-2640.398) (-2635.834) [-2637.288] -- 0:02:03 411500 -- (-2634.569) [-2639.107] (-2643.553) (-2640.509) * (-2636.830) (-2633.915) (-2640.842) [-2638.856] -- 0:02:02 412000 -- (-2636.852) (-2634.592) (-2637.202) [-2638.050] * (-2640.456) [-2638.455] (-2646.315) (-2635.294) -- 0:02:04 412500 -- [-2639.376] (-2640.531) (-2637.702) (-2645.049) * (-2642.320) [-2645.784] (-2636.946) (-2638.929) -- 0:02:03 413000 -- (-2638.196) (-2645.924) [-2639.600] (-2639.320) * [-2640.027] (-2638.567) (-2635.640) (-2636.728) -- 0:02:03 413500 -- [-2634.922] (-2643.134) (-2638.064) (-2635.869) * (-2641.215) (-2638.721) (-2637.998) [-2638.484] -- 0:02:03 414000 -- (-2634.083) (-2647.901) (-2643.208) [-2643.598] * (-2641.426) (-2637.643) (-2640.263) [-2642.857] -- 0:02:03 414500 -- (-2641.382) (-2640.383) [-2633.614] (-2639.739) * (-2643.058) [-2636.425] (-2637.117) (-2640.759) -- 0:02:02 415000 -- (-2639.813) (-2635.965) (-2641.220) [-2645.488] * (-2639.138) (-2641.106) [-2639.182] (-2642.153) -- 0:02:02 Average standard deviation of split frequencies: 0.000000 415500 -- (-2637.464) [-2636.245] (-2645.945) (-2644.820) * (-2638.899) [-2638.714] (-2636.929) (-2640.163) -- 0:02:02 416000 -- (-2640.769) (-2642.317) (-2646.333) [-2642.084] * (-2642.009) (-2639.268) (-2638.063) [-2640.378] -- 0:02:02 416500 -- (-2644.751) [-2640.407] (-2636.454) (-2640.581) * (-2639.543) [-2638.767] (-2636.261) (-2643.762) -- 0:02:01 417000 -- (-2640.509) [-2635.143] (-2638.167) (-2638.588) * [-2637.031] (-2645.326) (-2639.438) (-2636.304) -- 0:02:03 417500 -- (-2638.858) (-2638.192) [-2641.216] (-2636.624) * (-2641.476) (-2641.116) (-2644.850) [-2637.815] -- 0:02:02 418000 -- (-2640.582) (-2637.261) (-2638.187) [-2640.394] * (-2645.744) (-2637.107) (-2645.362) [-2639.861] -- 0:02:02 418500 -- (-2639.744) (-2637.062) [-2638.284] (-2636.294) * [-2642.019] (-2643.919) (-2638.847) (-2644.077) -- 0:02:02 419000 -- (-2637.915) (-2649.748) (-2633.806) [-2645.664] * (-2637.382) (-2635.126) [-2641.357] (-2639.147) -- 0:02:02 419500 -- (-2643.481) [-2643.773] (-2637.663) (-2643.146) * (-2644.993) (-2643.064) [-2640.073] (-2639.664) -- 0:02:01 420000 -- (-2641.234) (-2640.556) (-2643.674) [-2641.095] * (-2648.721) (-2637.778) [-2637.463] (-2639.792) -- 0:02:01 Average standard deviation of split frequencies: 0.000000 420500 -- (-2643.717) (-2639.519) (-2636.947) [-2640.638] * (-2642.640) [-2639.370] (-2641.551) (-2640.909) -- 0:02:01 421000 -- [-2648.401] (-2637.457) (-2641.753) (-2639.488) * [-2640.365] (-2647.221) (-2639.868) (-2645.526) -- 0:02:01 421500 -- (-2642.768) (-2639.023) [-2635.803] (-2637.940) * [-2641.795] (-2644.125) (-2638.704) (-2637.389) -- 0:02:02 422000 -- (-2633.977) (-2638.040) (-2637.646) [-2640.243] * [-2642.870] (-2647.282) (-2640.138) (-2637.947) -- 0:02:01 422500 -- (-2643.768) (-2643.857) (-2642.002) [-2637.443] * (-2640.792) (-2645.051) [-2636.481] (-2634.598) -- 0:02:01 423000 -- [-2646.418] (-2642.936) (-2641.146) (-2646.111) * (-2638.057) (-2643.203) (-2640.478) [-2638.922] -- 0:02:01 423500 -- [-2639.170] (-2638.084) (-2640.145) (-2645.895) * (-2635.463) (-2641.223) (-2641.936) [-2640.364] -- 0:02:01 424000 -- (-2641.210) [-2639.500] (-2641.311) (-2642.646) * (-2642.908) (-2636.556) [-2639.863] (-2639.535) -- 0:02:00 424500 -- [-2642.920] (-2645.736) (-2647.124) (-2646.063) * (-2633.986) (-2644.156) (-2644.247) [-2639.044] -- 0:02:00 425000 -- (-2640.865) [-2639.680] (-2638.539) (-2643.203) * (-2635.012) [-2644.967] (-2643.415) (-2643.651) -- 0:02:00 Average standard deviation of split frequencies: 0.000000 425500 -- (-2645.217) (-2641.202) [-2640.516] (-2645.012) * (-2641.915) [-2640.952] (-2644.573) (-2639.352) -- 0:02:00 426000 -- (-2636.163) [-2639.729] (-2647.437) (-2639.266) * (-2646.302) (-2638.443) [-2641.529] (-2640.752) -- 0:01:59 426500 -- (-2642.509) (-2638.655) (-2637.878) [-2643.464] * (-2638.597) (-2639.925) [-2641.111] (-2642.938) -- 0:02:01 427000 -- (-2641.866) [-2640.825] (-2638.637) (-2638.587) * [-2637.832] (-2641.530) (-2647.476) (-2647.261) -- 0:02:00 427500 -- [-2641.739] (-2641.589) (-2637.119) (-2641.009) * [-2636.881] (-2637.522) (-2641.089) (-2643.327) -- 0:02:00 428000 -- (-2641.195) [-2641.757] (-2643.140) (-2650.327) * (-2636.985) (-2640.272) (-2642.427) [-2638.593] -- 0:02:00 428500 -- (-2640.913) (-2649.494) [-2638.658] (-2637.546) * [-2633.463] (-2637.717) (-2637.215) (-2638.062) -- 0:02:00 429000 -- (-2637.111) (-2640.915) [-2637.542] (-2645.228) * (-2642.431) [-2638.929] (-2643.840) (-2643.112) -- 0:01:59 429500 -- (-2638.386) (-2640.941) [-2640.296] (-2639.787) * (-2638.313) [-2636.338] (-2637.550) (-2646.042) -- 0:01:59 430000 -- (-2639.119) (-2638.584) [-2649.658] (-2636.680) * (-2637.894) [-2634.519] (-2639.833) (-2639.842) -- 0:01:59 Average standard deviation of split frequencies: 0.000000 430500 -- [-2648.449] (-2634.759) (-2636.447) (-2641.191) * (-2644.042) (-2638.430) (-2636.747) [-2644.166] -- 0:01:59 431000 -- (-2643.753) (-2635.199) [-2637.954] (-2640.263) * (-2646.517) (-2636.615) (-2637.336) [-2640.850] -- 0:02:00 431500 -- (-2642.535) [-2636.657] (-2638.817) (-2639.397) * [-2640.316] (-2646.440) (-2640.478) (-2640.705) -- 0:01:59 432000 -- (-2640.357) [-2637.835] (-2639.335) (-2637.631) * (-2639.442) (-2642.461) [-2639.477] (-2638.892) -- 0:01:59 432500 -- (-2641.097) (-2634.800) [-2642.161] (-2640.582) * [-2636.727] (-2638.215) (-2638.128) (-2645.385) -- 0:01:59 433000 -- (-2636.693) (-2648.444) [-2647.083] (-2640.684) * (-2639.790) (-2635.577) [-2637.485] (-2641.951) -- 0:01:59 433500 -- (-2642.028) [-2638.454] (-2643.553) (-2639.184) * (-2638.355) [-2636.856] (-2645.349) (-2647.843) -- 0:01:58 434000 -- (-2639.423) (-2645.256) (-2643.002) [-2637.651] * (-2641.614) (-2634.869) [-2640.061] (-2641.068) -- 0:01:58 434500 -- (-2645.842) (-2640.005) [-2636.919] (-2643.131) * (-2644.430) (-2637.635) (-2643.995) [-2640.786] -- 0:01:58 435000 -- (-2637.035) (-2642.600) [-2639.666] (-2644.966) * (-2638.996) [-2639.080] (-2643.389) (-2642.733) -- 0:01:58 Average standard deviation of split frequencies: 0.000000 435500 -- (-2641.292) (-2639.769) (-2640.959) [-2642.459] * (-2639.531) [-2649.931] (-2640.651) (-2643.193) -- 0:01:57 436000 -- [-2644.781] (-2641.635) (-2647.752) (-2636.924) * [-2640.809] (-2646.537) (-2643.812) (-2640.001) -- 0:01:59 436500 -- (-2635.516) [-2640.756] (-2642.481) (-2642.641) * [-2637.772] (-2638.779) (-2639.300) (-2652.672) -- 0:01:58 437000 -- [-2641.935] (-2648.075) (-2635.533) (-2639.438) * (-2639.409) (-2639.566) [-2639.778] (-2649.931) -- 0:01:58 437500 -- [-2643.666] (-2644.906) (-2639.730) (-2641.729) * (-2643.900) (-2644.673) (-2643.231) [-2641.278] -- 0:01:58 438000 -- [-2638.039] (-2636.042) (-2640.183) (-2638.726) * [-2635.825] (-2636.998) (-2636.529) (-2641.868) -- 0:01:58 438500 -- [-2643.354] (-2641.540) (-2635.413) (-2642.859) * [-2642.017] (-2644.631) (-2642.187) (-2641.884) -- 0:01:57 439000 -- (-2639.953) [-2639.732] (-2639.283) (-2636.451) * (-2646.856) (-2637.679) [-2638.220] (-2640.574) -- 0:01:57 439500 -- (-2642.777) (-2636.914) [-2639.026] (-2637.722) * [-2638.210] (-2638.291) (-2643.259) (-2640.346) -- 0:01:57 440000 -- [-2638.078] (-2640.355) (-2643.910) (-2641.179) * (-2641.870) (-2637.550) [-2641.391] (-2639.346) -- 0:01:57 Average standard deviation of split frequencies: 0.000000 440500 -- [-2639.130] (-2639.020) (-2639.993) (-2641.260) * (-2640.152) (-2633.735) [-2641.998] (-2642.126) -- 0:01:56 441000 -- (-2646.431) (-2645.433) [-2638.638] (-2638.423) * [-2643.630] (-2643.249) (-2646.010) (-2640.134) -- 0:01:57 441500 -- (-2637.255) (-2645.893) [-2638.400] (-2636.332) * (-2643.890) (-2641.143) [-2646.731] (-2639.184) -- 0:01:57 442000 -- (-2635.874) (-2644.749) [-2636.625] (-2643.207) * [-2642.525] (-2639.894) (-2641.801) (-2642.253) -- 0:01:57 442500 -- [-2637.425] (-2637.923) (-2635.694) (-2647.702) * (-2639.550) (-2635.681) (-2642.253) [-2639.727] -- 0:01:57 443000 -- (-2636.415) (-2637.542) (-2639.754) [-2639.039] * (-2638.638) (-2642.061) (-2640.413) [-2643.030] -- 0:01:56 443500 -- (-2638.682) (-2641.570) [-2638.910] (-2639.670) * (-2640.818) (-2649.827) [-2636.430] (-2642.009) -- 0:01:56 444000 -- (-2637.398) (-2641.219) [-2640.790] (-2639.742) * (-2637.282) (-2637.504) [-2642.760] (-2642.532) -- 0:01:56 444500 -- (-2634.472) (-2646.193) (-2644.625) [-2639.168] * [-2641.751] (-2640.669) (-2640.472) (-2635.814) -- 0:01:56 445000 -- [-2639.100] (-2639.278) (-2638.619) (-2640.265) * (-2652.941) (-2638.259) (-2650.889) [-2639.087] -- 0:01:55 Average standard deviation of split frequencies: 0.000000 445500 -- (-2640.276) (-2639.296) [-2641.172] (-2643.505) * [-2641.836] (-2644.644) (-2648.265) (-2644.659) -- 0:01:56 446000 -- (-2636.565) [-2638.695] (-2638.311) (-2641.500) * (-2640.040) [-2642.522] (-2647.550) (-2642.850) -- 0:01:56 446500 -- [-2636.678] (-2640.430) (-2642.158) (-2638.059) * (-2636.703) (-2638.559) [-2641.493] (-2637.370) -- 0:01:56 447000 -- (-2639.786) (-2643.936) (-2643.678) [-2644.337] * [-2637.934] (-2639.852) (-2643.080) (-2641.532) -- 0:01:56 447500 -- (-2644.566) [-2640.253] (-2639.482) (-2641.077) * (-2642.840) (-2641.229) (-2640.344) [-2640.253] -- 0:01:56 448000 -- (-2645.699) (-2635.923) (-2641.284) [-2639.309] * (-2644.541) (-2637.867) (-2641.211) [-2643.319] -- 0:01:55 448500 -- [-2639.113] (-2646.460) (-2644.593) (-2640.865) * (-2636.407) (-2641.975) (-2641.018) [-2638.816] -- 0:01:55 449000 -- [-2640.553] (-2641.406) (-2640.307) (-2635.935) * (-2642.708) (-2641.616) (-2643.800) [-2639.863] -- 0:01:55 449500 -- [-2637.735] (-2644.807) (-2639.650) (-2648.750) * (-2638.830) (-2639.003) [-2640.957] (-2636.917) -- 0:01:55 450000 -- (-2637.442) [-2639.247] (-2641.976) (-2639.192) * [-2642.898] (-2636.777) (-2643.895) (-2646.357) -- 0:01:54 Average standard deviation of split frequencies: 0.000000 450500 -- (-2640.055) (-2642.607) (-2643.627) [-2638.534] * (-2636.145) (-2641.699) (-2655.256) [-2639.470] -- 0:01:55 451000 -- (-2641.864) (-2637.581) (-2637.737) [-2641.706] * (-2640.753) (-2639.234) [-2642.275] (-2649.174) -- 0:01:55 451500 -- [-2644.378] (-2639.854) (-2645.551) (-2638.300) * (-2642.648) (-2639.623) [-2636.532] (-2646.098) -- 0:01:55 452000 -- (-2635.129) [-2638.101] (-2633.028) (-2640.535) * (-2643.266) [-2643.172] (-2644.882) (-2642.215) -- 0:01:55 452500 -- (-2641.665) (-2648.360) [-2640.143] (-2635.469) * (-2638.429) [-2636.124] (-2639.162) (-2649.507) -- 0:01:54 453000 -- (-2642.329) (-2636.384) (-2636.811) [-2639.088] * (-2639.654) [-2635.857] (-2643.069) (-2646.989) -- 0:01:54 453500 -- (-2649.979) (-2637.179) [-2635.917] (-2643.241) * [-2637.314] (-2639.849) (-2641.685) (-2644.144) -- 0:01:54 454000 -- (-2642.131) (-2641.652) (-2640.265) [-2636.118] * (-2643.214) (-2635.157) [-2637.306] (-2641.491) -- 0:01:54 454500 -- (-2637.775) (-2646.985) [-2638.282] (-2635.920) * [-2639.015] (-2640.004) (-2637.062) (-2645.743) -- 0:01:54 455000 -- [-2637.905] (-2647.231) (-2642.234) (-2640.835) * [-2642.562] (-2641.938) (-2639.776) (-2646.809) -- 0:01:54 Average standard deviation of split frequencies: 0.000000 455500 -- [-2641.875] (-2648.825) (-2636.623) (-2641.496) * (-2635.918) (-2641.427) [-2638.611] (-2642.857) -- 0:01:54 456000 -- (-2646.304) (-2642.258) (-2637.941) [-2638.620] * (-2640.871) [-2637.606] (-2641.898) (-2643.273) -- 0:01:54 456500 -- (-2639.738) (-2638.439) [-2636.931] (-2639.741) * [-2635.697] (-2640.508) (-2646.589) (-2639.867) -- 0:01:54 457000 -- (-2642.047) (-2641.054) [-2642.759] (-2641.929) * (-2642.690) (-2641.327) [-2645.890] (-2643.675) -- 0:01:54 457500 -- (-2646.136) (-2637.113) (-2640.021) [-2633.905] * (-2636.278) (-2639.735) [-2640.801] (-2636.493) -- 0:01:53 458000 -- (-2643.041) (-2643.777) (-2646.277) [-2638.396] * [-2637.971] (-2638.592) (-2644.400) (-2640.365) -- 0:01:53 458500 -- (-2638.694) (-2642.598) (-2644.342) [-2639.363] * [-2636.194] (-2636.718) (-2644.846) (-2648.566) -- 0:01:53 459000 -- (-2641.117) (-2637.998) [-2637.180] (-2633.760) * [-2638.316] (-2640.022) (-2644.708) (-2642.078) -- 0:01:53 459500 -- [-2642.404] (-2639.125) (-2642.118) (-2641.537) * (-2647.329) [-2634.645] (-2641.954) (-2641.351) -- 0:01:52 460000 -- (-2642.264) [-2632.530] (-2640.235) (-2642.132) * (-2648.199) [-2639.500] (-2632.633) (-2640.494) -- 0:01:53 Average standard deviation of split frequencies: 0.000000 460500 -- (-2639.754) (-2638.884) [-2639.603] (-2643.276) * (-2653.414) (-2641.555) (-2635.829) [-2639.826] -- 0:01:53 461000 -- (-2643.076) (-2640.296) [-2632.605] (-2644.272) * (-2651.377) (-2643.293) [-2639.368] (-2638.712) -- 0:01:53 461500 -- (-2642.389) (-2642.586) [-2637.744] (-2642.574) * (-2642.018) (-2637.725) [-2634.495] (-2638.095) -- 0:01:53 462000 -- [-2641.179] (-2641.858) (-2639.720) (-2638.864) * (-2641.139) (-2641.879) [-2636.613] (-2639.851) -- 0:01:52 462500 -- [-2638.784] (-2634.789) (-2635.267) (-2643.543) * (-2643.324) [-2643.646] (-2635.162) (-2636.276) -- 0:01:52 463000 -- [-2640.996] (-2637.045) (-2639.820) (-2646.266) * (-2647.921) (-2643.577) (-2638.766) [-2639.827] -- 0:01:52 463500 -- (-2640.327) (-2643.099) (-2642.264) [-2645.599] * (-2642.904) (-2648.662) (-2645.375) [-2642.624] -- 0:01:52 464000 -- (-2636.689) [-2646.029] (-2644.197) (-2642.729) * (-2642.478) (-2648.222) [-2640.859] (-2642.218) -- 0:01:52 464500 -- [-2635.645] (-2645.339) (-2640.802) (-2638.946) * [-2638.493] (-2645.739) (-2645.861) (-2637.477) -- 0:01:51 465000 -- (-2637.051) (-2639.255) (-2641.071) [-2640.204] * (-2638.019) (-2643.796) (-2638.914) [-2636.690] -- 0:01:52 Average standard deviation of split frequencies: 0.000000 465500 -- (-2636.837) (-2643.618) (-2637.975) [-2639.143] * (-2637.858) (-2636.322) (-2636.219) [-2643.584] -- 0:01:52 466000 -- (-2637.446) (-2641.215) (-2642.735) [-2637.344] * [-2639.916] (-2642.833) (-2637.641) (-2644.936) -- 0:01:52 466500 -- (-2635.749) (-2637.352) [-2641.769] (-2639.625) * (-2639.512) [-2635.585] (-2634.447) (-2642.933) -- 0:01:52 467000 -- [-2637.939] (-2645.790) (-2638.257) (-2641.112) * (-2639.639) (-2641.530) (-2640.737) [-2635.377] -- 0:01:51 467500 -- [-2638.763] (-2644.858) (-2637.584) (-2640.944) * (-2634.479) (-2637.068) [-2636.213] (-2639.716) -- 0:01:51 468000 -- [-2640.846] (-2639.872) (-2639.344) (-2638.979) * (-2635.467) [-2638.529] (-2639.422) (-2640.104) -- 0:01:51 468500 -- (-2642.088) [-2639.707] (-2642.961) (-2639.835) * (-2639.345) [-2639.242] (-2642.926) (-2643.115) -- 0:01:51 469000 -- [-2651.237] (-2635.737) (-2639.928) (-2645.090) * (-2637.366) [-2638.636] (-2640.770) (-2643.329) -- 0:01:50 469500 -- (-2643.953) (-2640.325) (-2638.852) [-2645.296] * [-2636.736] (-2637.345) (-2643.511) (-2636.444) -- 0:01:51 470000 -- (-2649.548) [-2639.655] (-2637.217) (-2645.823) * [-2636.961] (-2643.355) (-2635.255) (-2640.563) -- 0:01:51 Average standard deviation of split frequencies: 0.000000 470500 -- (-2650.997) [-2640.399] (-2633.935) (-2639.828) * [-2638.899] (-2647.250) (-2638.496) (-2638.697) -- 0:01:51 471000 -- (-2645.829) (-2639.198) [-2636.092] (-2639.299) * (-2640.420) (-2646.605) [-2637.306] (-2639.125) -- 0:01:51 471500 -- (-2638.955) (-2636.585) (-2637.208) [-2640.408] * (-2637.255) (-2640.582) (-2634.728) [-2644.249] -- 0:01:50 472000 -- [-2641.151] (-2641.223) (-2639.719) (-2638.952) * (-2646.419) [-2643.850] (-2642.639) (-2640.693) -- 0:01:50 472500 -- (-2641.470) (-2644.401) (-2638.261) [-2639.429] * (-2634.972) [-2637.106] (-2643.598) (-2640.183) -- 0:01:50 473000 -- (-2645.045) [-2644.287] (-2637.744) (-2634.956) * (-2638.486) (-2640.649) (-2641.287) [-2640.513] -- 0:01:50 473500 -- [-2644.317] (-2647.077) (-2642.855) (-2644.095) * [-2638.010] (-2640.158) (-2636.843) (-2637.337) -- 0:01:50 474000 -- (-2639.103) (-2638.197) [-2638.643] (-2639.031) * (-2640.881) (-2639.819) (-2637.901) [-2634.937] -- 0:01:49 474500 -- (-2643.398) (-2637.437) (-2641.395) [-2642.623] * [-2642.209] (-2639.193) (-2642.297) (-2636.629) -- 0:01:50 475000 -- [-2639.132] (-2645.729) (-2640.864) (-2634.730) * (-2637.300) [-2637.867] (-2653.779) (-2639.109) -- 0:01:50 Average standard deviation of split frequencies: 0.000000 475500 -- (-2643.073) (-2644.884) [-2636.523] (-2643.476) * (-2637.917) (-2636.483) (-2643.712) [-2640.808] -- 0:01:50 476000 -- (-2642.538) (-2640.165) [-2644.423] (-2639.067) * [-2637.378] (-2641.175) (-2646.232) (-2640.672) -- 0:01:50 476500 -- (-2636.876) (-2636.269) [-2639.624] (-2642.047) * (-2648.586) (-2647.049) [-2644.051] (-2643.017) -- 0:01:49 477000 -- [-2633.629] (-2639.668) (-2648.234) (-2646.342) * (-2640.068) [-2638.396] (-2638.565) (-2638.603) -- 0:01:49 477500 -- (-2640.656) (-2644.147) [-2647.917] (-2641.021) * (-2638.134) [-2637.132] (-2640.022) (-2641.182) -- 0:01:49 478000 -- (-2641.839) (-2640.621) [-2636.675] (-2634.889) * [-2640.960] (-2642.332) (-2639.438) (-2641.811) -- 0:01:49 478500 -- (-2638.921) (-2641.906) [-2636.065] (-2643.110) * (-2641.500) [-2639.488] (-2644.249) (-2642.605) -- 0:01:48 479000 -- (-2645.155) (-2643.197) (-2645.567) [-2639.194] * (-2641.671) (-2646.305) [-2642.495] (-2644.193) -- 0:01:49 479500 -- (-2646.519) [-2644.828] (-2645.794) (-2642.955) * [-2636.921] (-2642.806) (-2637.493) (-2648.162) -- 0:01:49 480000 -- (-2639.214) [-2636.885] (-2646.200) (-2640.281) * (-2638.059) [-2638.330] (-2641.167) (-2640.473) -- 0:01:49 Average standard deviation of split frequencies: 0.000000 480500 -- (-2640.309) (-2638.316) [-2642.199] (-2644.781) * (-2640.414) [-2640.200] (-2638.119) (-2641.489) -- 0:01:49 481000 -- [-2634.696] (-2635.591) (-2646.888) (-2640.547) * (-2642.062) [-2642.995] (-2635.373) (-2641.225) -- 0:01:48 481500 -- [-2636.131] (-2640.941) (-2643.026) (-2642.908) * (-2640.647) (-2643.574) (-2645.393) [-2636.807] -- 0:01:48 482000 -- [-2642.092] (-2636.478) (-2647.133) (-2644.819) * [-2639.897] (-2648.266) (-2641.717) (-2650.959) -- 0:01:48 482500 -- (-2635.917) [-2635.511] (-2643.159) (-2648.462) * (-2636.390) [-2639.389] (-2638.309) (-2639.232) -- 0:01:48 483000 -- [-2638.681] (-2638.022) (-2642.061) (-2640.537) * (-2640.523) (-2636.450) [-2636.923] (-2639.700) -- 0:01:48 483500 -- (-2639.889) (-2646.886) [-2638.029] (-2641.950) * (-2640.920) [-2639.042] (-2640.240) (-2637.333) -- 0:01:47 484000 -- (-2639.572) (-2645.848) [-2641.569] (-2646.968) * (-2643.926) [-2635.358] (-2637.946) (-2644.637) -- 0:01:48 484500 -- (-2641.632) (-2644.897) [-2638.995] (-2655.140) * [-2634.344] (-2639.213) (-2652.903) (-2638.871) -- 0:01:48 485000 -- (-2642.710) (-2642.106) [-2642.823] (-2641.142) * (-2640.463) (-2644.455) (-2637.667) [-2636.364] -- 0:01:48 Average standard deviation of split frequencies: 0.000000 485500 -- (-2642.191) (-2640.769) [-2640.089] (-2650.140) * (-2642.495) [-2648.528] (-2646.935) (-2641.648) -- 0:01:48 486000 -- (-2639.455) [-2635.939] (-2647.466) (-2638.623) * [-2641.602] (-2642.961) (-2650.298) (-2638.737) -- 0:01:47 486500 -- (-2642.589) (-2641.209) (-2642.358) [-2643.650] * (-2637.274) (-2643.369) [-2643.683] (-2644.186) -- 0:01:47 487000 -- (-2636.779) [-2645.374] (-2639.727) (-2642.627) * (-2637.204) (-2639.048) (-2652.633) [-2644.996] -- 0:01:47 487500 -- (-2636.894) (-2649.082) [-2639.016] (-2639.184) * (-2645.790) (-2636.929) [-2653.991] (-2650.598) -- 0:01:47 488000 -- (-2641.918) (-2641.010) (-2638.755) [-2641.803] * (-2637.636) [-2638.747] (-2642.222) (-2650.969) -- 0:01:47 488500 -- [-2640.976] (-2642.760) (-2637.325) (-2644.742) * (-2638.868) [-2639.683] (-2639.273) (-2645.077) -- 0:01:47 489000 -- (-2643.132) [-2638.641] (-2636.609) (-2646.724) * (-2640.599) (-2640.195) (-2640.556) [-2642.537] -- 0:01:47 489500 -- [-2639.408] (-2640.833) (-2641.046) (-2641.711) * (-2640.878) [-2639.771] (-2646.165) (-2639.774) -- 0:01:47 490000 -- (-2637.796) (-2640.166) (-2641.424) [-2646.197] * (-2640.628) (-2639.125) (-2643.242) [-2644.639] -- 0:01:47 Average standard deviation of split frequencies: 0.000000 490500 -- (-2638.106) (-2642.187) [-2638.857] (-2639.614) * (-2640.022) [-2636.191] (-2644.040) (-2642.610) -- 0:01:46 491000 -- (-2638.118) (-2643.836) (-2642.889) [-2637.668] * (-2637.524) (-2641.565) [-2640.083] (-2638.212) -- 0:01:46 491500 -- (-2642.655) (-2636.958) [-2643.205] (-2639.164) * [-2641.489] (-2638.899) (-2637.827) (-2650.658) -- 0:01:46 492000 -- (-2649.765) [-2634.912] (-2643.106) (-2640.649) * [-2638.441] (-2651.210) (-2635.039) (-2639.780) -- 0:01:46 492500 -- (-2642.845) (-2638.088) (-2642.872) [-2641.415] * (-2642.442) (-2644.508) (-2635.248) [-2637.965] -- 0:01:46 493000 -- [-2648.301] (-2637.910) (-2640.348) (-2638.607) * (-2640.583) (-2637.669) [-2636.807] (-2639.945) -- 0:01:45 493500 -- (-2643.029) [-2640.736] (-2638.937) (-2639.627) * (-2636.289) (-2639.125) [-2637.983] (-2639.045) -- 0:01:46 494000 -- (-2642.245) [-2644.071] (-2644.812) (-2641.467) * (-2637.367) (-2639.626) [-2640.068] (-2642.045) -- 0:01:46 494500 -- (-2639.515) [-2645.489] (-2640.576) (-2637.183) * (-2640.304) [-2639.598] (-2641.960) (-2640.915) -- 0:01:46 495000 -- [-2637.325] (-2649.932) (-2641.514) (-2637.630) * (-2644.349) (-2638.051) [-2638.698] (-2643.986) -- 0:01:46 Average standard deviation of split frequencies: 0.000000 495500 -- (-2637.592) (-2646.798) [-2641.014] (-2646.589) * (-2633.759) [-2639.899] (-2641.617) (-2641.314) -- 0:01:45 496000 -- (-2639.567) (-2642.085) [-2641.121] (-2636.456) * [-2642.369] (-2642.716) (-2649.325) (-2644.723) -- 0:01:45 496500 -- (-2641.426) (-2640.568) (-2648.676) [-2635.102] * (-2641.791) (-2647.931) [-2634.951] (-2644.958) -- 0:01:45 497000 -- (-2641.016) (-2645.399) [-2640.687] (-2634.923) * (-2645.591) [-2648.773] (-2635.791) (-2637.732) -- 0:01:45 497500 -- [-2640.720] (-2643.686) (-2647.349) (-2638.421) * (-2636.928) (-2643.652) [-2638.990] (-2643.371) -- 0:01:45 498000 -- [-2638.235] (-2640.933) (-2636.972) (-2642.178) * [-2636.704] (-2645.180) (-2641.073) (-2641.708) -- 0:01:44 498500 -- (-2642.346) (-2638.129) (-2640.943) [-2645.299] * (-2633.232) [-2640.933] (-2644.354) (-2641.539) -- 0:01:45 499000 -- [-2643.852] (-2647.606) (-2637.656) (-2638.815) * (-2637.006) [-2636.530] (-2640.068) (-2640.485) -- 0:01:45 499500 -- (-2640.573) (-2646.876) (-2638.934) [-2644.739] * (-2640.422) (-2642.940) [-2641.891] (-2638.500) -- 0:01:45 500000 -- [-2642.086] (-2636.433) (-2637.550) (-2639.354) * (-2644.970) (-2639.720) (-2641.956) [-2639.219] -- 0:01:45 Average standard deviation of split frequencies: 0.000000 500500 -- [-2640.546] (-2640.071) (-2642.297) (-2638.700) * (-2640.468) (-2634.686) [-2638.782] (-2641.635) -- 0:01:44 501000 -- (-2640.810) (-2642.937) [-2639.897] (-2640.754) * (-2640.208) [-2639.300] (-2638.624) (-2641.583) -- 0:01:44 501500 -- [-2638.451] (-2643.767) (-2644.174) (-2634.680) * [-2640.138] (-2639.356) (-2639.928) (-2639.527) -- 0:01:44 502000 -- (-2637.630) (-2637.764) (-2639.873) [-2638.054] * (-2638.674) [-2637.707] (-2640.228) (-2641.113) -- 0:01:44 502500 -- (-2640.930) (-2647.137) (-2645.304) [-2635.287] * (-2639.637) (-2640.791) (-2644.326) [-2639.951] -- 0:01:43 503000 -- (-2639.496) (-2638.213) (-2643.989) [-2635.095] * (-2644.477) (-2639.467) [-2642.680] (-2640.013) -- 0:01:44 503500 -- (-2641.224) (-2635.599) (-2640.948) [-2637.452] * [-2642.066] (-2646.792) (-2632.796) (-2643.954) -- 0:01:44 504000 -- (-2643.015) (-2642.232) (-2646.697) [-2638.162] * (-2639.077) (-2646.219) [-2641.313] (-2638.829) -- 0:01:44 504500 -- (-2641.077) (-2636.863) (-2652.298) [-2638.085] * (-2639.309) [-2634.859] (-2645.450) (-2638.729) -- 0:01:44 505000 -- [-2638.447] (-2640.139) (-2646.673) (-2646.662) * (-2640.441) [-2643.409] (-2638.168) (-2639.580) -- 0:01:43 Average standard deviation of split frequencies: 0.000000 505500 -- [-2638.060] (-2640.551) (-2643.640) (-2637.622) * (-2648.362) (-2639.934) [-2634.338] (-2640.211) -- 0:01:43 506000 -- (-2641.345) (-2646.428) (-2637.231) [-2636.887] * [-2639.675] (-2637.531) (-2639.252) (-2645.537) -- 0:01:43 506500 -- (-2648.405) (-2636.350) (-2641.955) [-2641.413] * (-2637.170) [-2636.991] (-2638.486) (-2636.212) -- 0:01:43 507000 -- (-2647.424) [-2642.412] (-2646.004) (-2646.306) * (-2640.442) [-2636.809] (-2642.663) (-2635.403) -- 0:01:43 507500 -- [-2638.930] (-2640.925) (-2637.786) (-2637.461) * (-2641.918) (-2637.634) [-2637.243] (-2638.941) -- 0:01:42 508000 -- (-2638.253) (-2636.685) [-2638.295] (-2640.715) * (-2647.617) (-2639.629) (-2637.856) [-2637.997] -- 0:01:43 508500 -- [-2638.773] (-2651.754) (-2645.841) (-2634.918) * [-2645.038] (-2645.680) (-2640.257) (-2636.028) -- 0:01:43 509000 -- (-2635.571) (-2639.599) [-2643.255] (-2638.973) * (-2656.459) (-2639.752) (-2637.715) [-2640.168] -- 0:01:43 509500 -- (-2637.941) (-2642.523) (-2643.192) [-2634.981] * (-2637.367) (-2638.630) (-2638.085) [-2640.053] -- 0:01:43 510000 -- (-2638.904) (-2644.454) [-2644.713] (-2643.733) * (-2635.104) (-2640.777) [-2638.886] (-2641.064) -- 0:01:42 Average standard deviation of split frequencies: 0.000000 510500 -- [-2640.422] (-2646.714) (-2646.363) (-2648.664) * [-2641.095] (-2641.982) (-2642.461) (-2644.538) -- 0:01:42 511000 -- (-2635.392) (-2639.393) (-2647.044) [-2638.763] * (-2641.229) (-2638.897) [-2637.765] (-2639.124) -- 0:01:42 511500 -- (-2638.766) (-2640.193) (-2643.002) [-2641.770] * [-2639.513] (-2635.583) (-2636.740) (-2640.540) -- 0:01:42 512000 -- [-2638.862] (-2644.823) (-2644.694) (-2638.933) * [-2644.377] (-2647.607) (-2639.195) (-2642.465) -- 0:01:41 512500 -- (-2640.567) (-2640.263) (-2643.311) [-2638.016] * (-2640.011) (-2641.952) (-2641.477) [-2646.489] -- 0:01:41 513000 -- (-2640.530) (-2635.943) (-2635.763) [-2644.025] * (-2638.385) (-2637.814) [-2645.760] (-2638.857) -- 0:01:42 513500 -- (-2646.145) [-2639.999] (-2643.239) (-2642.204) * (-2639.833) (-2643.256) [-2643.392] (-2640.795) -- 0:01:42 514000 -- (-2641.802) (-2646.353) (-2642.608) [-2636.506] * (-2644.416) (-2638.544) [-2635.487] (-2642.805) -- 0:01:42 514500 -- [-2639.435] (-2641.288) (-2642.200) (-2642.370) * [-2637.376] (-2645.150) (-2640.705) (-2636.717) -- 0:01:41 515000 -- [-2640.679] (-2645.544) (-2640.949) (-2647.454) * (-2639.722) (-2645.219) (-2639.723) [-2640.231] -- 0:01:41 Average standard deviation of split frequencies: 0.000000 515500 -- (-2642.294) (-2639.475) [-2635.303] (-2641.088) * (-2640.627) (-2641.095) (-2636.037) [-2636.909] -- 0:01:41 516000 -- (-2642.961) (-2638.395) (-2640.133) [-2639.602] * [-2638.977] (-2641.185) (-2636.815) (-2638.149) -- 0:01:41 516500 -- (-2646.462) (-2639.958) [-2638.058] (-2641.948) * [-2641.939] (-2638.465) (-2644.671) (-2635.071) -- 0:01:41 517000 -- [-2643.063] (-2639.824) (-2641.594) (-2634.326) * (-2645.911) (-2643.507) [-2641.355] (-2637.430) -- 0:01:40 517500 -- (-2642.309) (-2637.202) [-2645.631] (-2640.734) * (-2647.688) (-2635.161) [-2635.540] (-2639.972) -- 0:01:41 518000 -- [-2640.852] (-2642.787) (-2645.440) (-2639.912) * [-2641.445] (-2643.281) (-2640.389) (-2641.573) -- 0:01:41 518500 -- (-2637.915) (-2636.883) (-2638.792) [-2640.070] * (-2643.700) [-2635.344] (-2642.762) (-2645.465) -- 0:01:41 519000 -- [-2638.639] (-2639.883) (-2642.066) (-2645.034) * (-2641.081) (-2640.499) [-2642.886] (-2642.203) -- 0:01:41 519500 -- (-2637.186) [-2637.666] (-2642.173) (-2643.500) * (-2643.676) [-2645.616] (-2642.667) (-2646.806) -- 0:01:40 520000 -- [-2639.889] (-2642.021) (-2636.633) (-2640.832) * (-2642.810) (-2644.319) [-2643.550] (-2650.682) -- 0:01:40 Average standard deviation of split frequencies: 0.000000 520500 -- [-2637.694] (-2642.598) (-2634.832) (-2641.589) * (-2645.063) [-2644.025] (-2647.340) (-2645.906) -- 0:01:40 521000 -- (-2636.365) (-2638.749) [-2637.730] (-2648.052) * [-2639.023] (-2639.949) (-2637.434) (-2642.542) -- 0:01:40 521500 -- (-2636.127) (-2644.070) [-2642.563] (-2645.188) * (-2639.808) [-2643.261] (-2636.256) (-2634.399) -- 0:01:40 522000 -- (-2636.152) (-2641.116) [-2641.518] (-2647.392) * (-2641.243) (-2637.051) (-2638.423) [-2642.096] -- 0:01:40 522500 -- (-2634.649) [-2638.878] (-2641.053) (-2647.485) * [-2637.574] (-2640.743) (-2640.150) (-2640.015) -- 0:01:40 523000 -- (-2638.562) (-2642.130) [-2637.041] (-2639.241) * (-2646.921) (-2640.859) [-2639.896] (-2639.151) -- 0:01:40 523500 -- [-2635.528] (-2641.992) (-2636.643) (-2644.020) * (-2645.149) [-2639.250] (-2639.946) (-2635.767) -- 0:01:40 524000 -- [-2638.788] (-2639.840) (-2637.220) (-2638.237) * (-2645.970) (-2641.255) [-2646.753] (-2640.201) -- 0:01:39 524500 -- [-2640.831] (-2650.278) (-2635.344) (-2636.773) * [-2637.415] (-2642.814) (-2636.638) (-2638.895) -- 0:01:39 525000 -- (-2639.122) [-2635.109] (-2642.239) (-2640.207) * (-2639.634) [-2637.339] (-2643.508) (-2642.998) -- 0:01:39 Average standard deviation of split frequencies: 0.000000 525500 -- (-2641.656) (-2643.940) (-2639.403) [-2636.915] * [-2641.227] (-2639.163) (-2638.763) (-2641.914) -- 0:01:39 526000 -- (-2637.150) (-2647.082) [-2639.090] (-2636.259) * (-2645.502) (-2640.498) (-2639.422) [-2637.895] -- 0:01:39 526500 -- (-2639.837) [-2637.242] (-2638.931) (-2635.607) * (-2641.401) (-2642.477) [-2638.210] (-2639.661) -- 0:01:38 527000 -- (-2638.108) (-2642.200) (-2643.131) [-2634.600] * (-2637.536) (-2636.098) [-2638.529] (-2643.162) -- 0:01:39 527500 -- (-2638.486) (-2639.668) (-2640.164) [-2638.119] * (-2637.428) (-2642.392) (-2638.660) [-2635.980] -- 0:01:39 528000 -- (-2636.430) [-2639.156] (-2637.885) (-2640.747) * (-2638.237) (-2640.152) [-2634.458] (-2633.577) -- 0:01:39 528500 -- [-2644.664] (-2642.381) (-2650.618) (-2638.138) * (-2639.719) [-2637.005] (-2641.085) (-2637.551) -- 0:01:39 529000 -- (-2642.454) (-2636.835) (-2646.168) [-2637.036] * (-2638.454) (-2637.125) [-2640.459] (-2644.607) -- 0:01:38 529500 -- (-2638.486) (-2633.973) (-2641.954) [-2642.487] * [-2641.771] (-2642.431) (-2637.316) (-2635.865) -- 0:01:38 530000 -- [-2641.094] (-2646.472) (-2641.409) (-2645.185) * (-2640.029) (-2639.459) [-2638.026] (-2637.363) -- 0:01:38 Average standard deviation of split frequencies: 0.000000 530500 -- (-2638.164) (-2637.652) [-2637.030] (-2644.572) * (-2641.803) [-2634.452] (-2639.406) (-2642.959) -- 0:01:38 531000 -- [-2639.006] (-2644.748) (-2643.032) (-2643.774) * (-2641.578) (-2639.284) (-2637.731) [-2636.860] -- 0:01:38 531500 -- (-2636.258) [-2640.689] (-2643.075) (-2640.292) * [-2640.152] (-2643.964) (-2643.255) (-2644.617) -- 0:01:38 532000 -- (-2636.853) [-2642.763] (-2645.905) (-2640.957) * (-2643.639) (-2643.404) (-2638.557) [-2643.663] -- 0:01:38 532500 -- (-2640.392) (-2640.030) (-2647.904) [-2640.328] * [-2638.356] (-2644.336) (-2639.388) (-2643.194) -- 0:01:38 533000 -- (-2640.393) [-2632.654] (-2640.696) (-2643.002) * [-2639.314] (-2641.725) (-2641.133) (-2642.417) -- 0:01:38 533500 -- (-2642.096) (-2646.551) [-2636.709] (-2641.142) * [-2637.834] (-2637.059) (-2640.078) (-2646.386) -- 0:01:37 534000 -- (-2647.882) [-2634.729] (-2639.544) (-2636.281) * (-2637.446) (-2636.915) [-2640.418] (-2641.938) -- 0:01:37 534500 -- (-2640.691) (-2635.861) [-2637.623] (-2641.704) * [-2636.514] (-2635.578) (-2640.583) (-2638.883) -- 0:01:37 535000 -- (-2646.678) (-2639.173) [-2640.302] (-2637.387) * (-2636.027) (-2641.568) (-2648.942) [-2643.205] -- 0:01:37 Average standard deviation of split frequencies: 0.000000 535500 -- (-2648.658) [-2635.104] (-2641.769) (-2643.675) * (-2639.084) (-2639.627) [-2648.568] (-2639.977) -- 0:01:37 536000 -- (-2644.952) [-2637.594] (-2647.414) (-2639.369) * [-2635.921] (-2642.443) (-2646.202) (-2645.322) -- 0:01:37 536500 -- (-2641.711) [-2636.291] (-2641.597) (-2635.556) * [-2638.875] (-2644.586) (-2639.782) (-2637.474) -- 0:01:37 537000 -- (-2640.194) [-2639.923] (-2648.698) (-2640.606) * (-2643.088) (-2635.064) (-2637.822) [-2643.892] -- 0:01:37 537500 -- (-2644.188) [-2636.925] (-2642.038) (-2637.503) * (-2645.421) (-2641.915) (-2640.731) [-2643.954] -- 0:01:37 538000 -- (-2643.983) (-2645.190) [-2639.520] (-2635.776) * [-2639.622] (-2650.626) (-2646.081) (-2641.295) -- 0:01:37 538500 -- (-2650.146) (-2641.383) (-2644.264) [-2635.410] * (-2642.545) [-2642.826] (-2641.064) (-2640.306) -- 0:01:36 539000 -- (-2638.937) (-2647.369) [-2642.305] (-2643.908) * [-2639.720] (-2637.975) (-2642.684) (-2637.908) -- 0:01:36 539500 -- [-2641.902] (-2651.951) (-2640.774) (-2645.411) * (-2640.891) (-2643.586) (-2641.229) [-2650.227] -- 0:01:36 540000 -- (-2645.231) [-2637.736] (-2642.338) (-2655.984) * [-2637.783] (-2640.872) (-2639.130) (-2640.599) -- 0:01:36 Average standard deviation of split frequencies: 0.000000 540500 -- [-2634.005] (-2652.946) (-2639.919) (-2645.679) * [-2636.017] (-2641.594) (-2641.214) (-2636.472) -- 0:01:36 541000 -- (-2638.201) [-2639.864] (-2639.268) (-2647.856) * (-2647.853) [-2637.111] (-2641.967) (-2635.031) -- 0:01:36 541500 -- (-2636.399) (-2645.215) [-2640.838] (-2640.489) * (-2638.402) (-2641.595) [-2640.129] (-2640.174) -- 0:01:36 542000 -- [-2636.596] (-2642.423) (-2640.961) (-2643.950) * (-2638.590) (-2634.759) (-2640.624) [-2636.253] -- 0:01:36 542500 -- (-2638.526) [-2640.447] (-2640.290) (-2659.623) * [-2633.199] (-2638.251) (-2642.356) (-2635.861) -- 0:01:36 543000 -- [-2640.899] (-2644.194) (-2640.734) (-2648.987) * (-2643.418) [-2636.389] (-2645.900) (-2637.529) -- 0:01:35 543500 -- (-2635.965) (-2647.152) [-2638.995] (-2645.594) * (-2641.776) (-2635.588) [-2637.104] (-2635.841) -- 0:01:35 544000 -- (-2646.295) (-2641.515) (-2642.334) [-2642.818] * [-2638.249] (-2640.547) (-2644.773) (-2645.206) -- 0:01:35 544500 -- [-2635.648] (-2642.020) (-2636.005) (-2643.876) * [-2636.090] (-2643.852) (-2637.974) (-2638.277) -- 0:01:35 545000 -- (-2645.196) [-2639.355] (-2643.149) (-2646.569) * (-2649.936) (-2641.306) [-2636.999] (-2646.974) -- 0:01:36 Average standard deviation of split frequencies: 0.000000 545500 -- (-2643.073) (-2642.142) (-2639.742) [-2637.280] * (-2646.069) (-2637.552) [-2643.185] (-2639.128) -- 0:01:35 546000 -- (-2640.382) (-2642.248) (-2639.603) [-2645.372] * [-2647.017] (-2648.781) (-2638.913) (-2637.355) -- 0:01:35 546500 -- (-2640.339) [-2640.706] (-2635.091) (-2638.359) * (-2635.962) [-2636.169] (-2646.788) (-2641.307) -- 0:01:35 547000 -- [-2636.825] (-2640.478) (-2646.638) (-2639.457) * (-2637.307) (-2641.538) [-2639.564] (-2640.219) -- 0:01:35 547500 -- (-2637.465) (-2640.245) (-2635.252) [-2638.754] * [-2638.849] (-2641.480) (-2640.341) (-2640.301) -- 0:01:35 548000 -- [-2638.940] (-2641.042) (-2644.679) (-2643.777) * [-2643.030] (-2649.666) (-2643.011) (-2648.447) -- 0:01:34 548500 -- (-2639.438) [-2641.031] (-2641.862) (-2639.389) * [-2649.234] (-2643.136) (-2646.489) (-2635.974) -- 0:01:34 549000 -- (-2635.234) (-2641.587) (-2638.690) [-2636.906] * [-2642.721] (-2641.618) (-2645.300) (-2637.501) -- 0:01:34 549500 -- (-2641.125) (-2648.592) (-2641.978) [-2641.294] * (-2637.466) (-2636.304) (-2640.202) [-2640.876] -- 0:01:34 550000 -- (-2640.159) (-2640.320) [-2637.758] (-2636.242) * (-2639.934) (-2640.725) (-2645.155) [-2640.712] -- 0:01:34 Average standard deviation of split frequencies: 0.000000 550500 -- (-2640.272) [-2637.182] (-2640.495) (-2646.131) * (-2632.415) (-2640.707) (-2637.187) [-2640.500] -- 0:01:34 551000 -- (-2639.323) (-2647.612) (-2637.780) [-2637.706] * (-2641.797) [-2643.833] (-2636.282) (-2645.266) -- 0:01:34 551500 -- (-2642.568) [-2646.030] (-2649.223) (-2639.649) * (-2638.934) [-2635.283] (-2644.340) (-2640.287) -- 0:01:34 552000 -- (-2636.026) (-2642.847) (-2641.973) [-2639.675] * [-2637.653] (-2640.420) (-2637.002) (-2641.544) -- 0:01:34 552500 -- (-2645.734) (-2637.161) [-2639.788] (-2640.782) * (-2642.669) (-2633.456) [-2640.804] (-2641.602) -- 0:01:33 553000 -- (-2641.368) (-2646.770) [-2638.015] (-2639.142) * (-2632.572) (-2633.371) [-2639.199] (-2643.755) -- 0:01:33 553500 -- (-2641.301) [-2635.527] (-2642.219) (-2636.391) * (-2635.524) [-2637.356] (-2637.023) (-2639.172) -- 0:01:33 554000 -- (-2636.357) [-2639.593] (-2638.021) (-2642.257) * (-2648.133) (-2647.019) [-2637.729] (-2640.612) -- 0:01:34 554500 -- (-2636.908) (-2641.215) (-2639.090) [-2642.133] * (-2639.530) (-2643.844) [-2642.354] (-2636.141) -- 0:01:34 555000 -- (-2641.462) (-2635.274) (-2633.617) [-2636.254] * (-2638.939) (-2640.652) [-2638.719] (-2638.959) -- 0:01:33 Average standard deviation of split frequencies: 0.000000 555500 -- (-2641.056) [-2641.376] (-2637.640) (-2642.102) * (-2635.628) [-2640.135] (-2639.486) (-2646.197) -- 0:01:33 556000 -- (-2639.950) (-2639.766) [-2640.538] (-2639.579) * (-2633.688) (-2640.288) (-2640.217) [-2636.407] -- 0:01:33 556500 -- (-2645.920) (-2643.803) (-2641.220) [-2640.808] * [-2634.927] (-2637.783) (-2639.221) (-2636.475) -- 0:01:33 557000 -- (-2636.374) (-2635.919) [-2638.554] (-2641.137) * (-2640.705) (-2636.144) (-2637.499) [-2634.866] -- 0:01:33 557500 -- (-2642.985) (-2639.023) [-2640.807] (-2635.297) * (-2647.810) (-2644.240) [-2641.658] (-2640.322) -- 0:01:32 558000 -- (-2647.738) [-2639.290] (-2643.737) (-2641.749) * (-2644.777) (-2641.297) (-2637.411) [-2637.085] -- 0:01:33 558500 -- (-2644.612) (-2639.486) (-2642.109) [-2638.057] * (-2642.546) [-2641.942] (-2638.952) (-2638.382) -- 0:01:33 559000 -- (-2642.650) (-2642.574) (-2642.387) [-2641.914] * [-2652.316] (-2640.293) (-2645.506) (-2639.493) -- 0:01:33 559500 -- [-2638.410] (-2636.686) (-2641.113) (-2648.435) * [-2640.617] (-2642.518) (-2644.733) (-2637.308) -- 0:01:32 560000 -- (-2640.631) [-2641.716] (-2643.255) (-2640.567) * (-2637.972) (-2648.982) [-2638.641] (-2643.763) -- 0:01:32 Average standard deviation of split frequencies: 0.000000 560500 -- [-2642.027] (-2644.058) (-2650.662) (-2635.065) * (-2634.515) (-2640.770) [-2639.839] (-2642.003) -- 0:01:32 561000 -- (-2639.428) (-2643.263) (-2643.752) [-2641.959] * [-2640.085] (-2647.304) (-2633.715) (-2652.147) -- 0:01:32 561500 -- (-2639.951) (-2646.997) (-2637.654) [-2640.504] * (-2637.540) (-2640.176) [-2642.847] (-2643.859) -- 0:01:32 562000 -- (-2638.809) (-2645.593) (-2647.041) [-2643.927] * (-2639.411) [-2636.864] (-2644.341) (-2638.941) -- 0:01:31 562500 -- (-2639.525) [-2640.100] (-2640.681) (-2645.246) * (-2637.848) (-2641.463) (-2641.165) [-2638.123] -- 0:01:31 563000 -- (-2645.638) [-2636.925] (-2642.451) (-2639.851) * (-2636.960) [-2641.824] (-2639.486) (-2640.344) -- 0:01:32 563500 -- (-2645.361) [-2633.319] (-2638.568) (-2642.567) * (-2634.745) (-2645.555) [-2644.938] (-2641.303) -- 0:01:32 564000 -- [-2642.843] (-2633.617) (-2636.064) (-2645.551) * (-2640.113) (-2640.702) (-2643.578) [-2640.493] -- 0:01:31 564500 -- (-2639.411) (-2634.912) (-2644.818) [-2647.806] * (-2639.362) [-2636.663] (-2642.849) (-2635.248) -- 0:01:31 565000 -- (-2637.347) (-2638.607) [-2641.008] (-2645.367) * (-2637.741) (-2641.745) [-2639.234] (-2641.887) -- 0:01:31 Average standard deviation of split frequencies: 0.000000 565500 -- (-2641.857) (-2640.164) (-2638.028) [-2638.541] * [-2640.431] (-2638.639) (-2648.127) (-2639.003) -- 0:01:31 566000 -- [-2640.849] (-2634.649) (-2638.389) (-2635.587) * (-2642.952) [-2635.672] (-2641.089) (-2639.064) -- 0:01:31 566500 -- (-2641.423) (-2643.370) (-2642.903) [-2635.137] * [-2639.700] (-2647.215) (-2643.964) (-2636.223) -- 0:01:31 567000 -- [-2636.979] (-2646.681) (-2638.900) (-2644.768) * [-2638.526] (-2638.002) (-2638.179) (-2639.685) -- 0:01:30 567500 -- (-2640.689) (-2642.089) [-2644.242] (-2639.105) * (-2637.176) [-2639.173] (-2638.076) (-2640.982) -- 0:01:30 568000 -- (-2639.487) (-2643.834) (-2638.086) [-2637.261] * [-2637.013] (-2641.082) (-2637.093) (-2641.097) -- 0:01:31 568500 -- (-2644.185) [-2641.661] (-2636.083) (-2641.543) * (-2639.961) [-2638.169] (-2643.690) (-2636.822) -- 0:01:31 569000 -- (-2647.075) [-2641.947] (-2639.604) (-2637.809) * (-2643.490) (-2637.208) [-2641.078] (-2649.769) -- 0:01:30 569500 -- (-2645.346) [-2640.063] (-2640.913) (-2652.609) * [-2640.100] (-2642.093) (-2648.021) (-2642.701) -- 0:01:30 570000 -- [-2641.902] (-2637.956) (-2640.624) (-2639.429) * (-2639.677) (-2638.648) [-2635.918] (-2640.746) -- 0:01:30 Average standard deviation of split frequencies: 0.000000 570500 -- [-2648.695] (-2637.282) (-2645.407) (-2642.545) * (-2644.902) (-2637.253) [-2639.600] (-2646.047) -- 0:01:30 571000 -- (-2642.645) (-2642.537) (-2640.119) [-2639.859] * [-2640.114] (-2641.424) (-2645.868) (-2638.112) -- 0:01:30 571500 -- (-2638.396) [-2638.792] (-2639.437) (-2636.273) * (-2639.757) (-2636.468) [-2640.299] (-2644.145) -- 0:01:29 572000 -- (-2636.485) (-2640.268) (-2635.979) [-2638.644] * [-2644.685] (-2637.099) (-2642.510) (-2639.504) -- 0:01:29 572500 -- (-2641.145) (-2640.964) (-2637.604) [-2638.844] * (-2641.642) [-2641.776] (-2636.622) (-2643.541) -- 0:01:30 573000 -- [-2639.455] (-2642.883) (-2635.553) (-2644.378) * (-2636.546) (-2635.929) [-2640.496] (-2646.321) -- 0:01:30 573500 -- (-2636.132) (-2644.774) [-2634.505] (-2642.331) * (-2642.490) (-2638.670) [-2643.941] (-2641.724) -- 0:01:29 574000 -- (-2639.438) [-2642.940] (-2636.662) (-2639.506) * [-2640.937] (-2643.400) (-2639.553) (-2641.690) -- 0:01:29 574500 -- (-2638.822) (-2638.133) [-2636.662] (-2641.903) * (-2640.131) (-2642.273) (-2639.000) [-2639.896] -- 0:01:29 575000 -- (-2645.295) (-2643.885) (-2641.082) [-2646.109] * [-2640.994] (-2639.102) (-2635.444) (-2640.552) -- 0:01:29 Average standard deviation of split frequencies: 0.000000 575500 -- [-2640.750] (-2644.391) (-2645.198) (-2644.508) * (-2647.432) (-2647.078) (-2637.644) [-2640.194] -- 0:01:29 576000 -- (-2648.686) (-2634.308) [-2642.571] (-2644.529) * (-2642.882) (-2648.008) [-2635.595] (-2634.859) -- 0:01:29 576500 -- [-2636.490] (-2637.981) (-2639.720) (-2640.705) * (-2643.554) (-2641.644) (-2639.180) [-2639.900] -- 0:01:29 577000 -- [-2642.110] (-2636.655) (-2650.388) (-2640.861) * (-2640.552) (-2640.329) [-2637.261] (-2642.433) -- 0:01:29 577500 -- (-2637.207) (-2637.575) (-2653.912) [-2638.838] * (-2637.396) (-2643.147) [-2636.554] (-2643.182) -- 0:01:29 578000 -- (-2639.421) [-2639.036] (-2649.272) (-2638.344) * (-2639.467) (-2648.774) (-2634.977) [-2641.497] -- 0:01:29 578500 -- (-2633.667) (-2638.698) [-2648.355] (-2637.579) * (-2639.157) (-2649.338) (-2639.433) [-2644.558] -- 0:01:28 579000 -- [-2641.055] (-2634.195) (-2643.278) (-2638.278) * (-2639.444) (-2646.627) [-2637.400] (-2633.508) -- 0:01:28 579500 -- (-2646.409) (-2645.548) [-2644.979] (-2647.661) * (-2644.029) (-2645.710) [-2638.217] (-2638.133) -- 0:01:28 580000 -- (-2638.674) [-2639.759] (-2645.621) (-2644.390) * (-2646.153) (-2644.644) [-2641.476] (-2644.599) -- 0:01:28 Average standard deviation of split frequencies: 0.000000 580500 -- [-2643.697] (-2645.166) (-2639.770) (-2644.839) * (-2640.210) (-2650.854) (-2641.463) [-2640.077] -- 0:01:28 581000 -- (-2649.170) (-2638.040) (-2636.479) [-2640.437] * [-2638.224] (-2642.557) (-2636.382) (-2640.601) -- 0:01:27 581500 -- (-2641.878) (-2642.424) [-2641.893] (-2639.134) * [-2640.135] (-2634.331) (-2639.873) (-2641.325) -- 0:01:28 582000 -- (-2645.897) [-2638.412] (-2641.819) (-2642.115) * (-2644.064) (-2636.109) (-2643.992) [-2640.275] -- 0:01:28 582500 -- (-2639.080) (-2637.445) (-2640.925) [-2640.800] * (-2643.647) (-2642.002) [-2640.242] (-2640.595) -- 0:01:28 583000 -- (-2646.083) (-2643.062) [-2638.617] (-2641.106) * (-2641.688) (-2638.932) [-2635.299] (-2638.810) -- 0:01:27 583500 -- (-2638.522) (-2639.086) [-2635.967] (-2643.800) * (-2648.027) [-2642.153] (-2636.301) (-2638.525) -- 0:01:27 584000 -- [-2636.569] (-2638.685) (-2643.065) (-2644.364) * (-2643.635) (-2649.844) (-2643.387) [-2636.801] -- 0:01:27 584500 -- (-2639.021) [-2635.167] (-2641.775) (-2635.755) * (-2641.132) (-2640.173) [-2640.435] (-2637.346) -- 0:01:27 585000 -- (-2641.598) (-2638.708) [-2639.595] (-2642.979) * [-2642.234] (-2639.102) (-2638.249) (-2638.666) -- 0:01:27 Average standard deviation of split frequencies: 0.000000 585500 -- (-2646.070) (-2638.869) (-2640.602) [-2647.021] * [-2640.951] (-2645.384) (-2643.199) (-2639.923) -- 0:01:27 586000 -- [-2638.986] (-2649.738) (-2645.432) (-2639.530) * (-2647.712) (-2642.983) [-2633.304] (-2644.038) -- 0:01:27 586500 -- (-2637.065) [-2637.066] (-2641.537) (-2637.380) * (-2643.127) (-2645.320) [-2642.645] (-2641.796) -- 0:01:27 587000 -- (-2644.946) (-2636.880) [-2633.410] (-2649.227) * (-2644.059) (-2645.625) [-2636.715] (-2640.522) -- 0:01:27 587500 -- (-2649.880) (-2649.148) [-2637.107] (-2649.314) * [-2638.425] (-2645.058) (-2644.659) (-2639.693) -- 0:01:27 588000 -- (-2648.673) (-2640.775) [-2635.787] (-2638.585) * [-2635.410] (-2642.630) (-2640.526) (-2651.829) -- 0:01:26 588500 -- (-2639.174) (-2644.492) [-2639.231] (-2639.222) * (-2638.431) (-2644.297) [-2637.864] (-2642.718) -- 0:01:26 589000 -- (-2641.240) (-2635.614) (-2639.013) [-2638.873] * [-2635.188] (-2638.274) (-2639.557) (-2641.381) -- 0:01:26 589500 -- (-2637.951) (-2641.004) [-2637.510] (-2638.084) * (-2640.820) [-2632.899] (-2638.801) (-2638.666) -- 0:01:26 590000 -- (-2640.729) (-2643.213) (-2638.196) [-2640.576] * (-2643.518) (-2642.610) (-2645.503) [-2637.694] -- 0:01:26 Average standard deviation of split frequencies: 0.000000 590500 -- (-2639.665) [-2639.838] (-2642.076) (-2638.874) * [-2642.217] (-2643.600) (-2644.357) (-2640.495) -- 0:01:25 591000 -- (-2642.489) [-2634.869] (-2641.072) (-2634.654) * (-2647.194) (-2638.039) (-2643.637) [-2639.422] -- 0:01:26 591500 -- (-2642.533) (-2637.987) (-2640.246) [-2638.066] * (-2640.907) (-2640.324) [-2654.219] (-2647.137) -- 0:01:26 592000 -- [-2639.890] (-2642.205) (-2639.317) (-2641.633) * [-2637.522] (-2642.321) (-2644.449) (-2640.319) -- 0:01:26 592500 -- [-2635.306] (-2638.905) (-2642.772) (-2635.455) * (-2640.532) [-2637.577] (-2644.516) (-2637.077) -- 0:01:25 593000 -- [-2634.325] (-2648.383) (-2648.044) (-2641.547) * (-2639.878) (-2638.705) (-2639.934) [-2636.861] -- 0:01:25 593500 -- [-2637.898] (-2638.591) (-2638.976) (-2639.837) * (-2640.710) [-2640.127] (-2640.299) (-2636.410) -- 0:01:25 594000 -- (-2642.197) [-2637.192] (-2640.133) (-2641.024) * (-2643.526) [-2638.127] (-2648.024) (-2640.638) -- 0:01:25 594500 -- (-2639.653) (-2644.679) [-2641.403] (-2645.898) * (-2644.544) (-2641.702) (-2641.887) [-2638.407] -- 0:01:25 595000 -- (-2642.612) (-2640.098) (-2637.454) [-2639.333] * [-2643.668] (-2637.975) (-2639.555) (-2636.592) -- 0:01:25 Average standard deviation of split frequencies: 0.000000 595500 -- [-2638.231] (-2641.560) (-2641.044) (-2637.570) * (-2643.207) [-2636.199] (-2638.588) (-2644.434) -- 0:01:25 596000 -- (-2641.040) (-2641.772) [-2639.039] (-2640.382) * (-2642.545) (-2634.918) [-2639.534] (-2642.737) -- 0:01:25 596500 -- (-2639.404) (-2636.684) [-2646.607] (-2639.982) * (-2641.592) (-2637.361) (-2642.472) [-2639.666] -- 0:01:25 597000 -- (-2640.181) (-2638.836) (-2644.959) [-2640.549] * (-2635.682) [-2642.560] (-2643.312) (-2643.384) -- 0:01:25 597500 -- (-2641.735) (-2638.519) (-2643.361) [-2640.535] * (-2643.684) (-2640.168) [-2647.465] (-2639.626) -- 0:01:24 598000 -- (-2640.322) (-2639.472) [-2640.540] (-2642.834) * (-2638.919) [-2635.965] (-2645.659) (-2640.488) -- 0:01:24 598500 -- (-2645.772) [-2633.947] (-2641.713) (-2639.452) * (-2643.111) (-2641.735) [-2654.035] (-2639.787) -- 0:01:24 599000 -- (-2650.118) (-2637.368) [-2646.770] (-2644.415) * (-2646.374) (-2641.535) (-2643.863) [-2636.142] -- 0:01:24 599500 -- [-2642.604] (-2635.264) (-2641.387) (-2644.950) * (-2640.154) (-2637.110) [-2643.543] (-2639.692) -- 0:01:24 600000 -- (-2638.994) (-2646.073) [-2638.607] (-2642.218) * (-2640.904) (-2635.999) (-2636.756) [-2636.484] -- 0:01:24 Average standard deviation of split frequencies: 0.000000 600500 -- [-2644.803] (-2639.484) (-2640.437) (-2641.864) * (-2643.345) (-2639.647) (-2641.387) [-2637.015] -- 0:01:24 601000 -- (-2645.662) (-2645.639) [-2638.481] (-2640.804) * (-2641.389) [-2640.632] (-2643.393) (-2637.144) -- 0:01:24 601500 -- (-2640.115) (-2639.871) (-2638.074) [-2636.751] * (-2644.584) [-2646.156] (-2645.594) (-2644.628) -- 0:01:24 602000 -- [-2644.420] (-2642.166) (-2634.600) (-2649.046) * [-2638.644] (-2643.356) (-2644.573) (-2644.101) -- 0:01:23 602500 -- (-2642.199) (-2643.812) [-2639.508] (-2648.135) * (-2640.679) (-2644.489) [-2639.093] (-2640.378) -- 0:01:23 603000 -- (-2637.992) (-2639.313) [-2642.809] (-2636.652) * (-2644.486) (-2639.841) (-2641.680) [-2638.318] -- 0:01:23 603500 -- [-2642.326] (-2635.548) (-2641.833) (-2635.952) * (-2638.985) (-2639.789) [-2638.651] (-2637.575) -- 0:01:23 604000 -- (-2642.173) (-2635.291) (-2643.442) [-2637.608] * (-2637.455) (-2641.270) [-2636.354] (-2646.364) -- 0:01:23 604500 -- [-2641.463] (-2645.108) (-2642.590) (-2642.543) * [-2640.772] (-2640.398) (-2636.030) (-2653.158) -- 0:01:23 605000 -- (-2640.498) (-2640.554) (-2643.145) [-2638.675] * [-2643.222] (-2641.577) (-2643.614) (-2638.894) -- 0:01:23 Average standard deviation of split frequencies: 0.000000 605500 -- (-2636.318) (-2639.765) [-2639.110] (-2631.822) * (-2637.452) (-2647.624) [-2637.472] (-2643.684) -- 0:01:23 606000 -- [-2642.116] (-2637.136) (-2637.478) (-2636.770) * (-2637.428) (-2649.729) [-2637.171] (-2642.972) -- 0:01:23 606500 -- (-2647.766) [-2639.464] (-2645.526) (-2634.542) * (-2646.239) (-2648.664) (-2642.004) [-2637.224] -- 0:01:23 607000 -- (-2644.618) (-2639.547) (-2640.509) [-2638.710] * (-2636.233) (-2649.944) (-2641.469) [-2638.959] -- 0:01:22 607500 -- [-2648.097] (-2643.807) (-2645.828) (-2633.502) * (-2644.163) (-2644.837) (-2636.360) [-2646.390] -- 0:01:22 608000 -- (-2638.920) (-2649.533) [-2641.905] (-2635.580) * [-2639.645] (-2650.608) (-2639.979) (-2649.034) -- 0:01:22 608500 -- (-2640.966) (-2636.451) (-2644.276) [-2639.836] * [-2641.462] (-2649.493) (-2639.913) (-2640.874) -- 0:01:22 609000 -- (-2639.426) (-2636.993) (-2639.872) [-2636.777] * (-2641.697) [-2637.401] (-2644.617) (-2646.651) -- 0:01:22 609500 -- (-2637.897) (-2646.896) [-2639.380] (-2638.770) * (-2642.006) (-2645.576) (-2643.463) [-2640.217] -- 0:01:22 610000 -- (-2637.135) (-2641.378) (-2640.650) [-2643.758] * (-2641.724) [-2643.573] (-2638.381) (-2642.713) -- 0:01:22 Average standard deviation of split frequencies: 0.000000 610500 -- (-2639.767) (-2640.150) (-2637.280) [-2639.226] * (-2649.382) (-2642.027) (-2647.646) [-2640.603] -- 0:01:22 611000 -- (-2637.750) (-2641.834) (-2643.763) [-2642.296] * (-2641.046) (-2646.287) (-2648.393) [-2641.512] -- 0:01:22 611500 -- (-2638.155) [-2636.117] (-2646.367) (-2637.609) * [-2642.271] (-2636.816) (-2634.994) (-2641.173) -- 0:01:21 612000 -- (-2639.266) [-2635.862] (-2640.663) (-2638.664) * (-2635.009) (-2640.292) [-2641.296] (-2639.126) -- 0:01:21 612500 -- (-2637.922) [-2644.138] (-2643.947) (-2645.774) * (-2640.212) (-2637.002) (-2639.612) [-2646.438] -- 0:01:21 613000 -- (-2641.898) [-2637.691] (-2641.900) (-2639.626) * (-2644.839) [-2642.167] (-2644.934) (-2646.481) -- 0:01:21 613500 -- [-2638.775] (-2644.815) (-2637.204) (-2639.262) * (-2643.936) [-2641.170] (-2649.768) (-2643.910) -- 0:01:21 614000 -- (-2639.637) (-2641.902) [-2645.090] (-2642.358) * (-2646.302) (-2643.356) (-2640.714) [-2642.088] -- 0:01:21 614500 -- (-2640.065) [-2638.634] (-2641.015) (-2635.884) * (-2647.674) (-2642.467) [-2641.370] (-2637.083) -- 0:01:21 615000 -- (-2641.380) (-2639.132) (-2649.557) [-2638.941] * (-2646.411) (-2640.010) (-2639.600) [-2639.528] -- 0:01:21 Average standard deviation of split frequencies: 0.000000 615500 -- (-2636.310) [-2637.919] (-2645.574) (-2645.639) * (-2644.767) [-2638.721] (-2645.759) (-2641.062) -- 0:01:21 616000 -- (-2646.078) (-2635.881) [-2635.970] (-2640.446) * [-2636.858] (-2642.494) (-2645.081) (-2639.796) -- 0:01:21 616500 -- (-2633.847) (-2639.342) (-2643.549) [-2641.661] * (-2646.275) [-2650.226] (-2644.220) (-2643.344) -- 0:01:20 617000 -- (-2637.102) (-2642.085) [-2639.964] (-2638.832) * [-2640.448] (-2641.071) (-2641.329) (-2645.045) -- 0:01:20 617500 -- (-2634.651) (-2647.288) (-2642.712) [-2639.474] * (-2645.238) (-2641.842) [-2636.303] (-2641.672) -- 0:01:20 618000 -- (-2640.252) (-2636.254) [-2643.198] (-2641.053) * (-2645.587) (-2641.145) (-2639.173) [-2647.655] -- 0:01:20 618500 -- (-2635.796) (-2642.950) [-2644.789] (-2641.876) * (-2640.102) (-2641.198) (-2644.082) [-2639.729] -- 0:01:20 619000 -- (-2644.488) (-2640.373) [-2640.663] (-2638.342) * (-2639.501) [-2639.754] (-2639.016) (-2642.813) -- 0:01:20 619500 -- (-2644.945) [-2636.873] (-2645.821) (-2643.826) * [-2638.219] (-2646.971) (-2639.181) (-2643.683) -- 0:01:20 620000 -- [-2640.203] (-2643.558) (-2643.359) (-2641.869) * (-2639.384) (-2644.882) [-2635.549] (-2641.443) -- 0:01:20 Average standard deviation of split frequencies: 0.000000 620500 -- (-2640.777) (-2642.543) [-2643.189] (-2635.329) * [-2643.368] (-2646.122) (-2642.593) (-2639.293) -- 0:01:20 621000 -- (-2634.864) (-2649.229) [-2650.358] (-2644.124) * (-2639.313) [-2636.460] (-2644.497) (-2637.615) -- 0:01:19 621500 -- [-2637.531] (-2644.978) (-2644.131) (-2636.229) * (-2645.499) (-2640.318) (-2640.608) [-2639.699] -- 0:01:19 622000 -- [-2635.425] (-2644.551) (-2646.745) (-2640.324) * [-2641.147] (-2640.428) (-2645.419) (-2647.218) -- 0:01:19 622500 -- (-2640.067) (-2641.049) (-2633.672) [-2640.824] * (-2641.472) (-2642.368) (-2642.051) [-2636.354] -- 0:01:19 623000 -- (-2639.987) (-2640.869) [-2641.604] (-2641.752) * (-2638.547) (-2640.207) (-2639.145) [-2639.542] -- 0:01:19 623500 -- (-2639.719) (-2636.032) (-2638.508) [-2637.555] * (-2636.803) [-2638.348] (-2635.666) (-2638.274) -- 0:01:19 624000 -- (-2643.121) (-2637.184) [-2638.563] (-2635.364) * (-2640.212) (-2642.469) [-2636.020] (-2642.319) -- 0:01:19 624500 -- (-2640.061) [-2636.771] (-2636.193) (-2636.602) * (-2638.072) (-2642.816) [-2637.813] (-2641.764) -- 0:01:19 625000 -- (-2642.364) [-2645.942] (-2644.109) (-2639.478) * (-2644.805) [-2640.803] (-2640.194) (-2640.873) -- 0:01:19 Average standard deviation of split frequencies: 0.000000 625500 -- (-2638.694) [-2634.364] (-2641.040) (-2636.460) * (-2641.176) (-2636.903) [-2644.379] (-2635.405) -- 0:01:19 626000 -- [-2634.875] (-2645.810) (-2640.792) (-2641.104) * [-2639.582] (-2639.014) (-2642.455) (-2639.209) -- 0:01:18 626500 -- [-2636.116] (-2644.453) (-2645.600) (-2643.833) * (-2644.303) [-2643.588] (-2643.634) (-2641.722) -- 0:01:18 627000 -- (-2639.295) [-2632.815] (-2642.303) (-2634.038) * (-2642.754) (-2640.265) (-2636.369) [-2644.338] -- 0:01:18 627500 -- [-2641.197] (-2640.705) (-2637.439) (-2644.154) * (-2642.031) [-2639.666] (-2649.048) (-2644.426) -- 0:01:18 628000 -- [-2636.953] (-2640.502) (-2637.245) (-2650.549) * [-2639.340] (-2647.818) (-2644.324) (-2639.217) -- 0:01:18 628500 -- [-2638.825] (-2639.628) (-2650.496) (-2652.334) * [-2641.104] (-2642.673) (-2642.631) (-2634.846) -- 0:01:18 629000 -- (-2637.956) (-2636.196) [-2636.147] (-2650.267) * [-2642.454] (-2637.585) (-2639.707) (-2639.348) -- 0:01:18 629500 -- (-2638.891) (-2639.733) [-2639.292] (-2644.226) * (-2644.053) (-2642.140) (-2638.533) [-2640.104] -- 0:01:18 630000 -- [-2637.524] (-2641.339) (-2634.667) (-2645.707) * [-2639.050] (-2647.058) (-2637.686) (-2642.180) -- 0:01:18 Average standard deviation of split frequencies: 0.000000 630500 -- (-2635.485) (-2641.590) [-2635.516] (-2643.565) * (-2649.096) [-2640.534] (-2639.221) (-2641.393) -- 0:01:17 631000 -- (-2645.589) (-2638.149) (-2641.459) [-2643.140] * (-2646.225) (-2638.896) (-2638.830) [-2640.499] -- 0:01:17 631500 -- (-2638.714) (-2636.883) (-2636.893) [-2640.304] * (-2654.537) (-2639.761) (-2644.772) [-2639.617] -- 0:01:17 632000 -- (-2643.379) (-2639.368) [-2641.348] (-2637.097) * (-2646.054) (-2641.925) (-2646.090) [-2636.372] -- 0:01:17 632500 -- (-2640.078) (-2641.799) (-2635.747) [-2642.534] * [-2634.405] (-2640.189) (-2648.516) (-2646.035) -- 0:01:17 633000 -- (-2641.564) (-2635.431) [-2638.145] (-2643.472) * [-2639.540] (-2642.966) (-2638.938) (-2639.661) -- 0:01:17 633500 -- (-2637.878) [-2642.778] (-2647.926) (-2635.730) * (-2635.215) [-2635.838] (-2638.986) (-2644.114) -- 0:01:17 634000 -- [-2642.613] (-2640.178) (-2647.295) (-2634.233) * (-2635.841) (-2639.127) [-2639.259] (-2636.738) -- 0:01:17 634500 -- (-2639.761) [-2639.728] (-2643.203) (-2637.953) * (-2636.779) [-2636.542] (-2641.010) (-2653.139) -- 0:01:17 635000 -- [-2639.237] (-2639.795) (-2645.157) (-2639.006) * (-2643.206) (-2636.999) (-2641.385) [-2636.131] -- 0:01:17 Average standard deviation of split frequencies: 0.000000 635500 -- (-2646.930) (-2641.176) (-2639.374) [-2636.461] * (-2647.922) (-2637.627) [-2643.348] (-2640.570) -- 0:01:16 636000 -- (-2646.542) (-2637.860) (-2646.277) [-2639.480] * (-2642.613) (-2638.417) (-2636.940) [-2640.161] -- 0:01:16 636500 -- (-2644.400) [-2635.100] (-2642.452) (-2640.322) * (-2632.832) (-2637.375) [-2641.738] (-2647.806) -- 0:01:16 637000 -- (-2644.633) (-2641.591) (-2639.691) [-2640.195] * (-2639.949) (-2637.661) [-2640.336] (-2642.773) -- 0:01:16 637500 -- (-2643.024) [-2641.568] (-2639.641) (-2640.291) * (-2643.424) (-2634.858) (-2643.011) [-2639.741] -- 0:01:16 638000 -- [-2638.936] (-2637.322) (-2642.520) (-2640.463) * [-2647.075] (-2639.092) (-2642.877) (-2644.554) -- 0:01:16 638500 -- (-2639.316) (-2638.519) (-2639.606) [-2648.814] * (-2642.972) (-2635.922) [-2635.488] (-2637.348) -- 0:01:16 639000 -- (-2641.987) [-2635.994] (-2639.103) (-2639.104) * (-2639.102) [-2638.676] (-2634.963) (-2642.480) -- 0:01:16 639500 -- (-2644.050) (-2636.013) [-2639.697] (-2636.939) * (-2638.330) (-2638.132) [-2639.753] (-2644.078) -- 0:01:16 640000 -- (-2638.608) [-2639.665] (-2639.230) (-2645.384) * [-2639.771] (-2635.700) (-2645.347) (-2650.031) -- 0:01:15 Average standard deviation of split frequencies: 0.000000 640500 -- [-2645.553] (-2639.991) (-2639.682) (-2643.440) * (-2641.459) [-2637.461] (-2647.756) (-2639.851) -- 0:01:15 641000 -- [-2639.464] (-2638.153) (-2638.652) (-2639.592) * (-2637.733) [-2636.177] (-2642.364) (-2638.350) -- 0:01:15 641500 -- (-2642.312) [-2638.522] (-2637.448) (-2644.297) * [-2644.735] (-2643.898) (-2639.813) (-2643.219) -- 0:01:15 642000 -- (-2643.042) (-2638.553) [-2637.826] (-2642.694) * (-2638.196) [-2640.504] (-2642.892) (-2639.341) -- 0:01:15 642500 -- [-2641.540] (-2646.371) (-2652.397) (-2645.202) * (-2638.141) (-2636.977) (-2648.570) [-2635.867] -- 0:01:15 643000 -- (-2637.861) (-2638.190) (-2636.927) [-2640.510] * [-2635.195] (-2636.813) (-2642.734) (-2641.851) -- 0:01:15 643500 -- (-2634.192) (-2646.056) [-2641.041] (-2637.111) * (-2642.400) [-2643.434] (-2643.824) (-2646.818) -- 0:01:15 644000 -- [-2639.536] (-2647.520) (-2636.663) (-2642.876) * (-2636.986) [-2641.356] (-2641.869) (-2637.021) -- 0:01:15 644500 -- [-2637.126] (-2651.594) (-2640.864) (-2647.764) * (-2635.291) [-2637.753] (-2647.101) (-2642.468) -- 0:01:15 645000 -- (-2639.126) (-2641.137) (-2640.396) [-2640.811] * [-2641.020] (-2638.774) (-2643.883) (-2638.521) -- 0:01:14 Average standard deviation of split frequencies: 0.000000 645500 -- (-2638.967) (-2636.272) (-2638.671) [-2633.570] * [-2638.294] (-2637.348) (-2638.385) (-2645.579) -- 0:01:14 646000 -- (-2638.137) (-2641.197) [-2643.177] (-2637.514) * (-2632.905) [-2638.916] (-2636.564) (-2645.943) -- 0:01:14 646500 -- (-2636.375) (-2637.608) (-2641.558) [-2635.448] * (-2642.521) (-2640.478) [-2637.808] (-2636.585) -- 0:01:14 647000 -- (-2636.927) (-2641.019) [-2642.503] (-2641.826) * (-2640.530) [-2638.228] (-2640.209) (-2644.686) -- 0:01:14 647500 -- (-2644.719) (-2641.377) (-2642.371) [-2642.606] * (-2645.519) [-2640.136] (-2646.047) (-2638.813) -- 0:01:14 648000 -- (-2638.874) [-2637.427] (-2643.163) (-2637.322) * (-2643.718) (-2642.730) [-2639.895] (-2637.696) -- 0:01:14 648500 -- (-2638.378) (-2638.959) (-2639.290) [-2642.477] * (-2637.979) (-2642.216) (-2642.715) [-2638.082] -- 0:01:14 649000 -- [-2636.346] (-2641.261) (-2640.102) (-2640.831) * [-2641.675] (-2644.227) (-2640.309) (-2640.842) -- 0:01:14 649500 -- (-2632.538) (-2650.821) [-2640.548] (-2640.058) * (-2638.204) [-2644.108] (-2640.073) (-2640.453) -- 0:01:13 650000 -- (-2638.320) (-2639.492) [-2636.417] (-2639.722) * [-2642.663] (-2642.903) (-2639.986) (-2637.289) -- 0:01:13 Average standard deviation of split frequencies: 0.000000 650500 -- (-2641.063) (-2642.975) [-2635.272] (-2636.121) * (-2643.262) (-2639.461) [-2639.432] (-2641.188) -- 0:01:13 651000 -- [-2636.824] (-2634.291) (-2635.739) (-2639.848) * (-2643.003) (-2650.815) (-2637.880) [-2636.820] -- 0:01:13 651500 -- (-2641.486) (-2639.496) [-2639.643] (-2636.672) * (-2644.059) (-2644.565) (-2642.118) [-2637.045] -- 0:01:13 652000 -- [-2642.334] (-2647.693) (-2642.679) (-2639.758) * (-2639.166) [-2643.033] (-2643.870) (-2634.789) -- 0:01:13 652500 -- (-2642.842) [-2642.600] (-2644.232) (-2644.156) * (-2642.892) (-2635.550) (-2641.423) [-2636.599] -- 0:01:13 653000 -- (-2636.831) (-2641.438) (-2639.907) [-2640.511] * (-2642.064) (-2638.607) [-2637.461] (-2640.253) -- 0:01:13 653500 -- [-2641.558] (-2641.757) (-2641.901) (-2645.173) * (-2639.545) [-2642.427] (-2640.719) (-2639.789) -- 0:01:13 654000 -- (-2643.675) (-2633.959) (-2660.754) [-2636.383] * [-2640.225] (-2633.780) (-2639.530) (-2643.212) -- 0:01:13 654500 -- (-2646.387) [-2637.282] (-2635.579) (-2640.780) * (-2648.682) [-2636.504] (-2642.928) (-2638.454) -- 0:01:12 655000 -- (-2638.027) (-2640.284) [-2640.431] (-2643.255) * (-2639.728) (-2637.555) (-2643.737) [-2639.078] -- 0:01:12 Average standard deviation of split frequencies: 0.000000 655500 -- (-2638.230) (-2643.506) (-2648.124) [-2640.831] * (-2646.203) (-2647.219) [-2636.846] (-2636.406) -- 0:01:12 656000 -- (-2640.196) (-2645.395) [-2639.507] (-2643.265) * (-2638.581) [-2636.962] (-2639.941) (-2645.088) -- 0:01:12 656500 -- (-2640.909) [-2635.628] (-2635.813) (-2635.751) * [-2638.578] (-2643.347) (-2634.558) (-2639.805) -- 0:01:12 657000 -- (-2635.115) [-2636.186] (-2642.177) (-2646.503) * [-2639.859] (-2641.493) (-2641.207) (-2651.748) -- 0:01:12 657500 -- (-2634.512) [-2640.527] (-2637.890) (-2634.044) * (-2635.674) [-2642.027] (-2642.790) (-2643.849) -- 0:01:12 658000 -- (-2636.895) (-2635.682) [-2636.713] (-2638.768) * (-2635.749) [-2644.015] (-2647.909) (-2637.660) -- 0:01:12 658500 -- [-2638.013] (-2636.873) (-2640.279) (-2636.209) * (-2640.915) (-2638.650) (-2642.792) [-2637.729] -- 0:01:12 659000 -- [-2639.187] (-2642.384) (-2639.869) (-2638.618) * (-2644.809) [-2639.557] (-2638.023) (-2636.386) -- 0:01:11 659500 -- (-2637.888) [-2646.270] (-2640.156) (-2639.499) * [-2642.778] (-2643.574) (-2641.559) (-2641.780) -- 0:01:11 660000 -- (-2637.375) (-2641.713) (-2638.183) [-2635.938] * (-2637.259) [-2636.809] (-2638.694) (-2642.155) -- 0:01:11 Average standard deviation of split frequencies: 0.000000 660500 -- [-2638.054] (-2633.274) (-2642.250) (-2641.302) * (-2646.404) (-2648.686) [-2638.047] (-2642.331) -- 0:01:11 661000 -- (-2645.472) (-2645.984) [-2637.893] (-2647.890) * [-2641.975] (-2646.753) (-2639.987) (-2646.126) -- 0:01:11 661500 -- (-2640.240) (-2645.004) [-2635.025] (-2639.272) * [-2641.469] (-2643.742) (-2638.160) (-2646.513) -- 0:01:11 662000 -- (-2637.462) [-2639.767] (-2637.583) (-2641.500) * (-2648.207) (-2640.889) [-2635.618] (-2641.234) -- 0:01:11 662500 -- (-2637.074) [-2638.032] (-2644.374) (-2641.623) * (-2644.463) (-2646.692) (-2645.890) [-2636.181] -- 0:01:11 663000 -- [-2637.610] (-2634.650) (-2646.216) (-2640.972) * [-2637.378] (-2642.132) (-2638.224) (-2638.550) -- 0:01:11 663500 -- (-2640.350) (-2640.019) [-2644.802] (-2643.858) * (-2641.808) (-2649.937) [-2635.713] (-2637.168) -- 0:01:11 664000 -- [-2634.826] (-2635.194) (-2639.194) (-2650.061) * [-2636.391] (-2646.794) (-2642.182) (-2637.504) -- 0:01:10 664500 -- (-2634.732) [-2637.853] (-2635.358) (-2644.932) * (-2636.285) (-2643.913) (-2643.197) [-2637.887] -- 0:01:10 665000 -- (-2643.392) [-2636.903] (-2638.673) (-2637.810) * [-2635.578] (-2640.510) (-2642.270) (-2641.079) -- 0:01:10 Average standard deviation of split frequencies: 0.000000 665500 -- [-2639.755] (-2640.993) (-2643.594) (-2637.857) * [-2638.602] (-2640.867) (-2640.216) (-2637.804) -- 0:01:10 666000 -- (-2642.091) [-2639.512] (-2637.992) (-2641.090) * [-2635.952] (-2642.377) (-2638.007) (-2645.135) -- 0:01:10 666500 -- (-2635.765) [-2634.994] (-2639.248) (-2648.639) * (-2638.678) (-2643.129) (-2642.539) [-2641.460] -- 0:01:10 667000 -- (-2643.002) [-2635.617] (-2638.257) (-2651.290) * (-2640.743) [-2642.743] (-2643.189) (-2642.544) -- 0:01:10 667500 -- [-2641.704] (-2642.020) (-2637.937) (-2639.992) * [-2638.229] (-2638.698) (-2639.233) (-2642.553) -- 0:01:10 668000 -- (-2642.610) [-2633.559] (-2643.043) (-2643.982) * (-2636.009) (-2639.934) (-2635.827) [-2636.806] -- 0:01:10 668500 -- (-2646.153) (-2640.716) (-2641.629) [-2641.948] * [-2636.874] (-2646.982) (-2637.705) (-2639.662) -- 0:01:09 669000 -- [-2640.096] (-2646.092) (-2644.792) (-2647.368) * (-2645.132) (-2644.968) [-2641.102] (-2635.799) -- 0:01:09 669500 -- (-2645.477) (-2640.075) (-2645.405) [-2648.152] * [-2636.879] (-2637.223) (-2640.128) (-2643.790) -- 0:01:09 670000 -- (-2642.656) (-2646.536) [-2639.282] (-2639.270) * (-2646.736) [-2641.043] (-2641.223) (-2637.694) -- 0:01:09 Average standard deviation of split frequencies: 0.000000 670500 -- (-2645.096) [-2637.133] (-2650.137) (-2640.724) * [-2637.544] (-2638.869) (-2641.108) (-2640.444) -- 0:01:09 671000 -- (-2635.199) (-2639.856) (-2638.488) [-2638.740] * (-2642.596) [-2636.846] (-2636.280) (-2637.867) -- 0:01:09 671500 -- (-2639.955) (-2646.289) [-2641.520] (-2638.856) * [-2635.623] (-2638.354) (-2640.326) (-2642.389) -- 0:01:09 672000 -- [-2635.837] (-2650.269) (-2648.165) (-2642.058) * (-2648.360) (-2638.419) [-2638.704] (-2638.637) -- 0:01:09 672500 -- (-2641.049) (-2639.385) [-2639.857] (-2642.414) * (-2639.264) (-2641.819) [-2637.615] (-2643.800) -- 0:01:09 673000 -- [-2634.002] (-2638.918) (-2644.955) (-2641.665) * (-2636.546) [-2641.963] (-2642.957) (-2639.405) -- 0:01:08 673500 -- (-2632.819) (-2642.327) [-2634.796] (-2642.955) * [-2636.147] (-2642.486) (-2638.437) (-2643.855) -- 0:01:08 674000 -- (-2637.512) (-2636.492) (-2638.265) [-2640.758] * [-2635.194] (-2640.931) (-2639.228) (-2634.462) -- 0:01:08 674500 -- [-2640.960] (-2635.268) (-2635.918) (-2639.150) * (-2649.908) [-2643.806] (-2640.933) (-2640.226) -- 0:01:08 675000 -- (-2642.668) (-2639.068) (-2634.300) [-2636.165] * (-2642.245) (-2642.602) (-2640.780) [-2644.068] -- 0:01:08 Average standard deviation of split frequencies: 0.000000 675500 -- [-2638.900] (-2637.677) (-2640.119) (-2633.898) * [-2637.592] (-2639.959) (-2637.702) (-2642.176) -- 0:01:08 676000 -- (-2639.736) (-2642.284) [-2636.516] (-2636.926) * [-2643.265] (-2645.604) (-2645.783) (-2642.240) -- 0:01:08 676500 -- (-2640.556) (-2642.450) [-2644.649] (-2638.201) * (-2651.579) [-2644.923] (-2638.215) (-2635.280) -- 0:01:08 677000 -- (-2643.632) [-2646.337] (-2639.158) (-2635.037) * (-2640.324) [-2640.390] (-2643.382) (-2640.783) -- 0:01:08 677500 -- (-2636.777) [-2635.261] (-2634.657) (-2640.908) * [-2636.069] (-2636.987) (-2637.989) (-2638.419) -- 0:01:08 678000 -- (-2643.659) (-2641.747) (-2637.320) [-2639.415] * (-2642.389) (-2639.099) (-2639.253) [-2638.719] -- 0:01:07 678500 -- (-2640.486) (-2635.221) [-2637.346] (-2645.709) * [-2634.769] (-2639.754) (-2644.912) (-2636.594) -- 0:01:07 679000 -- [-2639.294] (-2649.672) (-2637.983) (-2647.459) * (-2646.036) (-2640.317) (-2636.559) [-2634.326] -- 0:01:07 679500 -- (-2638.718) (-2649.483) (-2638.501) [-2642.620] * (-2638.725) (-2639.565) [-2639.981] (-2634.114) -- 0:01:07 680000 -- (-2636.839) (-2639.288) [-2642.833] (-2643.523) * (-2637.696) [-2639.040] (-2644.710) (-2637.225) -- 0:01:07 Average standard deviation of split frequencies: 0.000000 680500 -- (-2633.792) (-2637.621) [-2641.673] (-2646.856) * (-2638.266) (-2641.327) [-2644.569] (-2640.492) -- 0:01:07 681000 -- [-2643.430] (-2638.534) (-2645.826) (-2642.784) * (-2639.381) [-2640.170] (-2637.466) (-2644.663) -- 0:01:07 681500 -- (-2641.885) [-2636.050] (-2643.223) (-2648.770) * (-2643.116) (-2640.566) [-2641.237] (-2637.151) -- 0:01:07 682000 -- (-2647.442) (-2638.404) [-2638.850] (-2643.764) * (-2643.886) (-2640.109) (-2646.643) [-2640.064] -- 0:01:07 682500 -- (-2644.824) (-2641.908) [-2638.976] (-2638.629) * [-2643.941] (-2637.092) (-2646.906) (-2645.794) -- 0:01:06 683000 -- (-2635.147) (-2640.212) [-2641.513] (-2638.122) * (-2644.527) [-2637.393] (-2644.834) (-2642.019) -- 0:01:06 683500 -- (-2640.345) (-2637.775) [-2641.873] (-2640.814) * [-2638.303] (-2641.690) (-2651.369) (-2633.925) -- 0:01:06 684000 -- (-2650.476) [-2640.782] (-2638.528) (-2651.998) * [-2637.305] (-2647.219) (-2655.534) (-2638.325) -- 0:01:06 684500 -- (-2644.169) [-2638.097] (-2643.288) (-2641.211) * [-2636.266] (-2636.791) (-2644.559) (-2638.424) -- 0:01:06 685000 -- (-2642.111) (-2640.179) [-2640.188] (-2641.118) * (-2636.850) [-2637.614] (-2635.068) (-2640.887) -- 0:01:06 Average standard deviation of split frequencies: 0.000000 685500 -- [-2643.340] (-2651.036) (-2646.264) (-2648.268) * (-2637.594) (-2633.344) (-2643.134) [-2636.850] -- 0:01:06 686000 -- (-2641.428) [-2643.672] (-2637.994) (-2652.341) * (-2643.332) (-2637.338) [-2642.157] (-2643.040) -- 0:01:06 686500 -- (-2641.066) (-2648.188) [-2639.300] (-2645.685) * [-2639.657] (-2638.562) (-2639.649) (-2642.540) -- 0:01:06 687000 -- (-2639.450) [-2637.379] (-2636.520) (-2644.925) * (-2639.758) (-2638.293) [-2636.199] (-2639.973) -- 0:01:06 687500 -- [-2643.793] (-2636.156) (-2638.632) (-2638.815) * (-2635.937) (-2644.941) [-2640.450] (-2644.652) -- 0:01:05 688000 -- (-2644.221) (-2639.373) (-2641.255) [-2641.003] * (-2638.098) [-2638.399] (-2643.482) (-2647.514) -- 0:01:05 688500 -- (-2643.465) (-2643.772) [-2636.219] (-2645.967) * (-2644.086) (-2638.505) (-2641.843) [-2638.562] -- 0:01:05 689000 -- (-2636.366) (-2649.239) [-2637.935] (-2642.809) * (-2640.088) (-2637.659) (-2637.064) [-2639.306] -- 0:01:05 689500 -- [-2636.067] (-2642.375) (-2643.862) (-2648.952) * (-2641.086) [-2647.630] (-2643.499) (-2641.445) -- 0:01:05 690000 -- (-2645.029) (-2638.070) [-2637.873] (-2643.172) * (-2643.116) [-2644.646] (-2642.578) (-2636.988) -- 0:01:05 Average standard deviation of split frequencies: 0.000000 690500 -- (-2639.642) (-2638.451) [-2640.078] (-2641.820) * (-2638.705) (-2642.611) (-2651.460) [-2639.563] -- 0:01:05 691000 -- (-2639.668) (-2638.608) (-2642.126) [-2640.035] * [-2636.744] (-2641.277) (-2646.559) (-2637.452) -- 0:01:05 691500 -- (-2640.808) (-2644.004) (-2644.481) [-2638.196] * (-2637.821) [-2642.637] (-2636.699) (-2639.112) -- 0:01:05 692000 -- (-2646.355) (-2642.408) (-2643.591) [-2638.690] * (-2633.452) [-2638.488] (-2635.047) (-2636.884) -- 0:01:04 692500 -- (-2643.170) [-2646.780] (-2637.191) (-2639.588) * (-2650.018) (-2636.374) [-2638.619] (-2638.890) -- 0:01:04 693000 -- [-2639.467] (-2649.900) (-2639.995) (-2642.028) * (-2645.669) (-2643.254) [-2641.246] (-2641.504) -- 0:01:04 693500 -- (-2641.597) [-2646.505] (-2643.883) (-2643.893) * (-2639.129) (-2649.857) [-2636.672] (-2645.405) -- 0:01:04 694000 -- (-2637.885) (-2650.770) [-2639.769] (-2637.895) * [-2636.127] (-2643.846) (-2638.978) (-2636.209) -- 0:01:04 694500 -- (-2644.347) (-2642.114) (-2633.959) [-2636.654] * [-2633.339] (-2638.283) (-2641.285) (-2641.457) -- 0:01:04 695000 -- (-2643.071) [-2636.013] (-2638.257) (-2641.662) * (-2641.414) [-2635.323] (-2637.652) (-2641.492) -- 0:01:04 Average standard deviation of split frequencies: 0.000000 695500 -- [-2634.315] (-2638.018) (-2642.349) (-2640.606) * (-2646.350) [-2641.209] (-2642.926) (-2635.958) -- 0:01:04 696000 -- (-2637.598) (-2642.986) (-2647.232) [-2644.762] * (-2641.658) (-2641.224) (-2637.450) [-2641.469] -- 0:01:04 696500 -- (-2638.707) (-2639.948) (-2639.001) [-2636.569] * [-2641.728] (-2639.991) (-2636.497) (-2638.066) -- 0:01:04 697000 -- (-2639.733) (-2643.808) (-2641.799) [-2637.773] * (-2637.633) (-2639.149) (-2635.269) [-2633.351] -- 0:01:03 697500 -- (-2639.628) [-2634.820] (-2638.066) (-2637.143) * [-2635.841] (-2646.820) (-2644.642) (-2636.952) -- 0:01:03 698000 -- (-2634.482) (-2636.431) (-2640.536) [-2641.432] * (-2639.782) [-2641.675] (-2639.674) (-2639.416) -- 0:01:03 698500 -- (-2641.464) [-2642.745] (-2634.254) (-2642.631) * (-2635.825) (-2638.874) [-2641.335] (-2639.392) -- 0:01:03 699000 -- (-2645.153) (-2642.796) [-2638.145] (-2643.010) * (-2639.420) (-2658.023) (-2638.042) [-2639.497] -- 0:01:03 699500 -- [-2638.570] (-2640.402) (-2639.885) (-2644.373) * [-2637.499] (-2638.812) (-2638.596) (-2637.799) -- 0:01:03 700000 -- (-2641.515) [-2644.208] (-2637.134) (-2642.874) * [-2640.311] (-2641.192) (-2639.208) (-2644.047) -- 0:01:03 Average standard deviation of split frequencies: 0.000000 700500 -- (-2639.261) [-2636.118] (-2646.080) (-2644.756) * [-2640.478] (-2647.953) (-2638.759) (-2637.741) -- 0:01:03 701000 -- (-2651.229) (-2636.390) [-2640.924] (-2639.025) * (-2638.839) (-2645.039) [-2641.803] (-2646.627) -- 0:01:03 701500 -- (-2647.435) (-2643.773) [-2638.774] (-2645.387) * [-2637.081] (-2637.598) (-2636.276) (-2645.105) -- 0:01:02 702000 -- (-2648.050) (-2639.173) (-2637.097) [-2637.746] * (-2639.403) [-2640.374] (-2640.062) (-2637.143) -- 0:01:02 702500 -- (-2642.149) (-2645.614) (-2639.911) [-2638.095] * (-2639.487) (-2639.887) [-2638.239] (-2634.013) -- 0:01:02 703000 -- (-2648.205) (-2639.455) [-2635.032] (-2639.887) * (-2642.037) [-2641.103] (-2641.886) (-2641.128) -- 0:01:02 703500 -- (-2641.908) (-2635.459) [-2641.029] (-2644.511) * (-2639.312) (-2647.149) [-2638.910] (-2648.889) -- 0:01:02 704000 -- (-2633.630) [-2637.166] (-2644.714) (-2641.274) * [-2637.511] (-2642.433) (-2641.189) (-2641.781) -- 0:01:02 704500 -- (-2641.805) (-2641.275) [-2647.435] (-2637.791) * [-2636.300] (-2636.676) (-2634.243) (-2633.853) -- 0:01:02 705000 -- [-2640.330] (-2635.531) (-2642.788) (-2642.181) * (-2637.834) [-2639.087] (-2645.457) (-2640.775) -- 0:01:02 Average standard deviation of split frequencies: 0.000000 705500 -- (-2639.713) (-2640.469) (-2647.821) [-2643.595] * [-2635.483] (-2635.317) (-2644.654) (-2638.064) -- 0:01:02 706000 -- [-2640.768] (-2636.816) (-2643.087) (-2643.200) * (-2646.962) [-2639.205] (-2641.868) (-2646.167) -- 0:01:02 706500 -- [-2639.850] (-2638.993) (-2640.852) (-2635.068) * [-2636.383] (-2639.429) (-2643.119) (-2642.141) -- 0:01:01 707000 -- (-2638.971) (-2642.504) [-2637.094] (-2644.506) * (-2640.448) [-2641.870] (-2639.652) (-2650.204) -- 0:01:01 707500 -- (-2639.081) [-2646.005] (-2643.718) (-2644.603) * [-2645.485] (-2641.304) (-2635.914) (-2639.814) -- 0:01:01 708000 -- (-2644.472) (-2637.756) (-2641.241) [-2640.152] * (-2643.626) (-2643.736) [-2641.623] (-2647.332) -- 0:01:01 708500 -- (-2643.788) (-2635.500) (-2644.785) [-2641.960] * (-2644.672) [-2636.267] (-2643.288) (-2643.119) -- 0:01:01 709000 -- (-2643.984) (-2642.058) [-2639.373] (-2645.259) * [-2639.856] (-2636.456) (-2640.478) (-2638.468) -- 0:01:01 709500 -- (-2647.883) [-2646.260] (-2636.300) (-2639.623) * (-2640.036) (-2639.158) [-2639.057] (-2646.309) -- 0:01:01 710000 -- (-2642.336) [-2640.049] (-2637.467) (-2645.709) * [-2642.770] (-2636.308) (-2640.464) (-2642.325) -- 0:01:01 Average standard deviation of split frequencies: 0.000000 710500 -- (-2641.853) [-2642.127] (-2637.291) (-2638.507) * (-2639.658) [-2640.309] (-2635.960) (-2637.923) -- 0:01:01 711000 -- (-2642.407) [-2638.314] (-2643.599) (-2635.922) * (-2637.013) (-2639.407) [-2638.486] (-2638.743) -- 0:01:00 711500 -- (-2643.974) [-2640.616] (-2639.741) (-2644.486) * (-2645.175) (-2637.653) [-2646.741] (-2644.368) -- 0:01:00 712000 -- (-2642.810) (-2644.227) [-2646.366] (-2638.439) * (-2640.140) (-2638.634) [-2642.666] (-2641.848) -- 0:01:00 712500 -- (-2636.213) [-2639.718] (-2647.456) (-2645.047) * (-2637.931) (-2639.667) (-2640.374) [-2640.246] -- 0:01:00 713000 -- (-2647.777) (-2641.339) [-2638.707] (-2644.188) * [-2643.665] (-2643.506) (-2647.445) (-2643.064) -- 0:01:00 713500 -- [-2641.837] (-2639.891) (-2636.756) (-2638.268) * [-2639.582] (-2640.577) (-2660.821) (-2641.320) -- 0:01:00 714000 -- (-2640.985) (-2641.667) (-2642.001) [-2639.415] * (-2639.709) [-2642.352] (-2640.273) (-2645.739) -- 0:01:00 714500 -- (-2636.374) (-2638.833) [-2642.399] (-2642.189) * [-2638.461] (-2639.360) (-2641.290) (-2638.121) -- 0:01:00 715000 -- (-2638.633) (-2636.509) (-2644.317) [-2639.842] * [-2642.423] (-2647.155) (-2654.027) (-2643.053) -- 0:01:00 Average standard deviation of split frequencies: 0.000000 715500 -- (-2633.000) (-2638.786) (-2638.170) [-2639.693] * (-2641.099) (-2644.742) (-2641.063) [-2642.693] -- 0:01:00 716000 -- (-2643.857) [-2636.984] (-2644.131) (-2648.575) * (-2635.338) (-2644.314) (-2640.226) [-2637.357] -- 0:00:59 716500 -- [-2638.138] (-2637.025) (-2637.414) (-2641.261) * (-2633.064) (-2639.046) (-2637.101) [-2635.856] -- 0:00:59 717000 -- [-2639.540] (-2638.250) (-2641.643) (-2639.478) * (-2635.184) (-2644.706) (-2641.163) [-2637.556] -- 0:00:59 717500 -- (-2636.257) (-2635.529) (-2642.675) [-2640.496] * [-2636.274] (-2647.899) (-2649.209) (-2637.811) -- 0:00:59 718000 -- (-2650.105) [-2636.528] (-2644.853) (-2638.833) * (-2645.788) (-2641.044) [-2639.833] (-2637.471) -- 0:00:59 718500 -- (-2641.858) [-2640.092] (-2641.106) (-2635.797) * (-2636.663) (-2642.434) [-2640.550] (-2638.072) -- 0:00:59 719000 -- (-2639.248) (-2638.243) [-2639.720] (-2642.364) * (-2647.181) [-2640.065] (-2636.563) (-2643.568) -- 0:00:59 719500 -- (-2645.623) [-2632.603] (-2639.996) (-2635.206) * (-2638.212) (-2636.779) (-2636.244) [-2638.845] -- 0:00:59 720000 -- (-2643.681) (-2640.059) [-2636.040] (-2641.064) * (-2639.523) (-2639.608) (-2637.604) [-2637.855] -- 0:00:59 Average standard deviation of split frequencies: 0.000000 720500 -- (-2642.395) [-2641.163] (-2633.393) (-2643.239) * (-2642.091) [-2636.471] (-2640.599) (-2637.195) -- 0:00:58 721000 -- (-2648.433) [-2649.865] (-2641.957) (-2640.893) * (-2638.884) (-2641.177) [-2636.335] (-2646.020) -- 0:00:58 721500 -- (-2642.050) (-2647.071) [-2638.160] (-2642.850) * [-2637.188] (-2650.005) (-2638.362) (-2650.299) -- 0:00:58 722000 -- [-2637.836] (-2640.998) (-2636.183) (-2641.002) * (-2638.551) (-2647.327) [-2639.281] (-2641.290) -- 0:00:58 722500 -- (-2641.706) (-2641.439) (-2637.821) [-2641.018] * (-2641.656) (-2645.659) [-2635.342] (-2641.510) -- 0:00:58 723000 -- (-2638.399) (-2634.315) (-2638.889) [-2642.172] * [-2638.461] (-2637.598) (-2638.333) (-2645.405) -- 0:00:58 723500 -- (-2641.124) (-2638.637) [-2638.845] (-2641.767) * [-2644.127] (-2642.550) (-2638.563) (-2638.728) -- 0:00:58 724000 -- (-2637.202) (-2644.763) [-2642.426] (-2638.702) * (-2643.603) (-2636.909) [-2639.588] (-2634.532) -- 0:00:58 724500 -- [-2640.542] (-2638.976) (-2639.392) (-2643.900) * (-2641.326) [-2642.616] (-2639.531) (-2639.486) -- 0:00:58 725000 -- (-2640.145) [-2639.270] (-2637.634) (-2649.350) * (-2643.483) (-2638.933) (-2642.892) [-2634.074] -- 0:00:58 Average standard deviation of split frequencies: 0.000000 725500 -- (-2643.560) (-2642.009) (-2650.764) [-2637.400] * (-2642.076) [-2642.006] (-2644.735) (-2640.089) -- 0:00:57 726000 -- (-2641.147) (-2638.614) [-2638.119] (-2639.675) * (-2641.549) (-2647.157) (-2649.613) [-2642.460] -- 0:00:57 726500 -- (-2642.858) (-2637.893) (-2636.243) [-2640.239] * (-2642.280) [-2639.125] (-2635.928) (-2643.057) -- 0:00:57 727000 -- (-2638.874) [-2638.911] (-2638.278) (-2639.275) * [-2633.833] (-2639.808) (-2634.399) (-2643.436) -- 0:00:57 727500 -- (-2644.966) (-2639.782) (-2642.702) [-2644.715] * (-2638.954) (-2649.147) (-2644.240) [-2639.540] -- 0:00:57 728000 -- [-2642.644] (-2639.031) (-2642.042) (-2647.200) * (-2636.454) (-2641.521) (-2638.699) [-2643.273] -- 0:00:57 728500 -- (-2652.109) (-2639.490) (-2646.056) [-2639.144] * (-2641.032) (-2640.103) [-2634.922] (-2639.104) -- 0:00:57 729000 -- (-2640.305) (-2634.617) (-2640.166) [-2635.134] * (-2639.868) [-2639.299] (-2641.448) (-2643.466) -- 0:00:57 729500 -- (-2636.104) [-2635.886] (-2636.811) (-2637.123) * [-2640.202] (-2651.224) (-2637.388) (-2638.901) -- 0:00:57 730000 -- [-2637.656] (-2636.501) (-2636.213) (-2640.179) * (-2637.118) [-2642.916] (-2640.641) (-2642.414) -- 0:00:56 Average standard deviation of split frequencies: 0.000000 730500 -- (-2638.759) (-2640.709) (-2640.313) [-2639.483] * (-2637.196) [-2638.032] (-2649.277) (-2642.107) -- 0:00:56 731000 -- (-2638.855) (-2645.218) (-2642.794) [-2641.297] * [-2642.977] (-2639.616) (-2637.212) (-2637.510) -- 0:00:56 731500 -- (-2636.370) (-2645.059) [-2645.029] (-2642.428) * (-2649.508) [-2643.417] (-2640.746) (-2638.313) -- 0:00:56 732000 -- (-2640.967) (-2647.223) [-2640.014] (-2640.623) * (-2646.554) (-2641.149) (-2640.653) [-2636.067] -- 0:00:56 732500 -- (-2637.661) [-2643.785] (-2637.564) (-2642.244) * [-2646.042] (-2645.343) (-2641.459) (-2640.354) -- 0:00:56 733000 -- (-2645.285) [-2643.633] (-2637.699) (-2636.083) * (-2640.497) [-2642.419] (-2643.625) (-2637.751) -- 0:00:56 733500 -- (-2647.275) (-2647.328) (-2642.055) [-2639.900] * [-2641.352] (-2643.515) (-2639.701) (-2636.166) -- 0:00:56 734000 -- (-2635.934) (-2645.013) (-2636.390) [-2640.714] * (-2640.411) [-2642.195] (-2633.434) (-2638.368) -- 0:00:56 734500 -- (-2640.597) (-2633.486) (-2637.374) [-2639.028] * (-2641.925) (-2639.269) (-2638.066) [-2637.349] -- 0:00:56 735000 -- (-2637.951) (-2644.003) [-2636.015] (-2644.794) * [-2640.776] (-2637.037) (-2640.518) (-2643.599) -- 0:00:55 Average standard deviation of split frequencies: 0.000000 735500 -- [-2637.829] (-2635.373) (-2637.761) (-2634.683) * (-2641.616) [-2640.659] (-2639.871) (-2639.493) -- 0:00:55 736000 -- (-2635.180) (-2641.205) [-2640.314] (-2642.378) * (-2642.583) (-2644.211) (-2644.268) [-2646.007] -- 0:00:55 736500 -- (-2639.811) [-2639.591] (-2632.915) (-2642.689) * (-2644.241) (-2642.687) [-2639.010] (-2639.496) -- 0:00:55 737000 -- (-2645.768) (-2646.744) [-2641.258] (-2636.440) * (-2641.498) (-2639.176) (-2639.156) [-2638.288] -- 0:00:55 737500 -- [-2636.738] (-2641.243) (-2636.924) (-2646.717) * (-2636.456) (-2636.261) (-2638.837) [-2635.292] -- 0:00:55 738000 -- (-2632.757) [-2648.350] (-2646.518) (-2640.444) * (-2642.377) [-2642.286] (-2649.134) (-2636.395) -- 0:00:55 738500 -- (-2640.902) [-2638.798] (-2639.341) (-2641.652) * (-2646.390) (-2647.630) (-2641.865) [-2639.019] -- 0:00:55 739000 -- (-2637.803) (-2636.919) [-2637.327] (-2634.411) * (-2640.386) [-2642.717] (-2634.526) (-2643.921) -- 0:00:55 739500 -- (-2641.740) (-2638.717) (-2639.523) [-2635.509] * (-2644.432) [-2641.893] (-2638.758) (-2642.441) -- 0:00:54 740000 -- [-2642.513] (-2641.044) (-2644.358) (-2638.257) * [-2638.438] (-2640.156) (-2634.460) (-2640.685) -- 0:00:54 Average standard deviation of split frequencies: 0.000000 740500 -- (-2651.489) [-2641.649] (-2645.206) (-2642.962) * (-2636.238) [-2640.884] (-2642.022) (-2643.318) -- 0:00:54 741000 -- [-2636.941] (-2642.053) (-2643.578) (-2639.321) * [-2636.490] (-2633.400) (-2644.606) (-2635.692) -- 0:00:54 741500 -- (-2633.393) (-2645.914) [-2643.757] (-2645.073) * (-2644.077) [-2632.506] (-2643.487) (-2643.365) -- 0:00:54 742000 -- (-2634.903) (-2639.247) [-2637.586] (-2643.328) * (-2648.988) [-2640.937] (-2646.157) (-2639.557) -- 0:00:54 742500 -- (-2639.074) (-2637.180) [-2641.786] (-2644.797) * (-2643.775) (-2641.069) [-2641.165] (-2642.868) -- 0:00:54 743000 -- (-2644.774) (-2642.143) (-2640.475) [-2638.301] * (-2636.765) (-2633.582) (-2640.798) [-2644.699] -- 0:00:54 743500 -- (-2640.724) [-2645.197] (-2639.733) (-2656.211) * (-2645.134) [-2637.402] (-2635.418) (-2645.016) -- 0:00:54 744000 -- (-2647.004) (-2640.086) (-2635.772) [-2639.149] * (-2646.622) (-2638.694) (-2644.702) [-2647.579] -- 0:00:54 744500 -- [-2639.461] (-2640.868) (-2639.836) (-2651.116) * [-2638.352] (-2642.308) (-2640.658) (-2638.037) -- 0:00:53 745000 -- (-2645.210) [-2641.565] (-2645.806) (-2636.345) * (-2641.481) (-2642.189) [-2634.335] (-2639.946) -- 0:00:53 Average standard deviation of split frequencies: 0.000000 745500 -- (-2645.011) (-2641.531) (-2638.190) [-2633.896] * [-2638.401] (-2643.847) (-2639.125) (-2642.991) -- 0:00:53 746000 -- [-2643.046] (-2644.343) (-2645.824) (-2636.377) * [-2635.853] (-2643.477) (-2638.715) (-2640.557) -- 0:00:53 746500 -- [-2639.292] (-2648.177) (-2639.484) (-2638.752) * (-2640.707) (-2636.933) [-2639.449] (-2648.686) -- 0:00:53 747000 -- (-2643.036) (-2639.655) (-2639.359) [-2637.712] * (-2643.088) (-2633.370) (-2639.823) [-2641.471] -- 0:00:53 747500 -- (-2642.748) (-2643.932) [-2640.880] (-2636.846) * (-2648.068) (-2647.394) (-2637.036) [-2639.017] -- 0:00:53 748000 -- (-2639.048) [-2639.449] (-2639.816) (-2641.324) * (-2638.481) (-2640.004) (-2632.517) [-2639.687] -- 0:00:53 748500 -- (-2641.872) (-2640.657) [-2634.262] (-2637.682) * (-2640.849) (-2638.957) (-2634.497) [-2641.888] -- 0:00:53 749000 -- (-2643.571) (-2642.702) [-2635.059] (-2639.817) * [-2637.417] (-2637.447) (-2638.527) (-2637.753) -- 0:00:52 749500 -- [-2637.010] (-2643.441) (-2639.048) (-2640.308) * (-2636.844) (-2636.287) (-2641.662) [-2636.236] -- 0:00:52 750000 -- (-2643.332) (-2645.477) [-2637.327] (-2645.974) * (-2639.210) (-2640.264) (-2640.548) [-2634.520] -- 0:00:53 Average standard deviation of split frequencies: 0.000000 750500 -- (-2643.103) [-2640.378] (-2641.616) (-2636.457) * (-2637.738) (-2639.250) [-2640.246] (-2647.114) -- 0:00:52 751000 -- (-2641.622) (-2639.613) [-2639.640] (-2633.812) * (-2639.397) (-2641.613) [-2644.302] (-2639.938) -- 0:00:52 751500 -- (-2633.855) [-2648.192] (-2640.942) (-2635.434) * (-2644.076) (-2645.268) [-2642.978] (-2642.722) -- 0:00:52 752000 -- (-2641.427) [-2634.409] (-2635.102) (-2635.031) * (-2641.042) [-2639.725] (-2635.432) (-2637.567) -- 0:00:52 752500 -- (-2645.058) (-2642.107) (-2639.589) [-2646.549] * (-2636.462) (-2639.338) (-2650.802) [-2637.680] -- 0:00:52 753000 -- [-2639.885] (-2637.818) (-2640.045) (-2640.835) * [-2637.513] (-2639.531) (-2638.701) (-2638.289) -- 0:00:52 753500 -- (-2641.912) [-2639.104] (-2636.903) (-2646.044) * (-2639.691) (-2640.751) (-2636.871) [-2638.449] -- 0:00:52 754000 -- (-2636.146) [-2637.985] (-2637.765) (-2649.329) * (-2641.762) [-2642.104] (-2639.592) (-2654.248) -- 0:00:51 754500 -- (-2643.362) (-2639.204) (-2642.982) [-2642.269] * (-2640.031) [-2635.972] (-2640.995) (-2637.344) -- 0:00:51 755000 -- (-2640.186) (-2642.247) (-2638.192) [-2643.160] * (-2636.191) (-2640.970) (-2638.743) [-2637.509] -- 0:00:51 Average standard deviation of split frequencies: 0.000000 755500 -- (-2638.871) [-2642.719] (-2635.778) (-2643.972) * (-2642.087) [-2638.003] (-2643.910) (-2647.650) -- 0:00:51 756000 -- (-2643.579) (-2636.353) [-2637.026] (-2635.988) * (-2648.518) [-2640.306] (-2640.170) (-2643.140) -- 0:00:51 756500 -- [-2634.777] (-2639.071) (-2637.204) (-2639.103) * (-2639.153) [-2635.562] (-2641.233) (-2644.127) -- 0:00:51 757000 -- (-2637.226) (-2639.395) [-2638.111] (-2647.762) * [-2636.304] (-2640.344) (-2632.859) (-2643.375) -- 0:00:51 757500 -- (-2641.571) (-2644.627) [-2644.043] (-2644.259) * (-2640.142) [-2641.441] (-2642.430) (-2645.343) -- 0:00:51 758000 -- [-2636.105] (-2639.383) (-2638.649) (-2639.663) * (-2639.472) (-2646.016) [-2637.387] (-2643.448) -- 0:00:51 758500 -- (-2642.519) [-2637.690] (-2643.817) (-2638.480) * (-2640.729) (-2641.377) [-2638.625] (-2639.937) -- 0:00:50 759000 -- (-2638.851) (-2636.469) (-2638.326) [-2638.778] * [-2640.167] (-2639.666) (-2646.430) (-2641.887) -- 0:00:50 759500 -- [-2638.717] (-2646.533) (-2644.053) (-2638.582) * (-2637.902) (-2641.996) [-2650.001] (-2636.230) -- 0:00:50 760000 -- (-2637.189) (-2646.244) [-2638.784] (-2638.578) * (-2645.309) (-2639.205) (-2644.305) [-2634.926] -- 0:00:50 Average standard deviation of split frequencies: 0.000000 760500 -- (-2637.850) (-2638.019) (-2637.155) [-2645.626] * (-2637.283) [-2639.018] (-2634.160) (-2636.333) -- 0:00:50 761000 -- [-2634.860] (-2643.968) (-2637.295) (-2643.201) * (-2643.814) [-2637.181] (-2639.205) (-2636.550) -- 0:00:50 761500 -- (-2641.845) (-2638.908) (-2642.042) [-2639.324] * [-2635.505] (-2633.427) (-2644.367) (-2637.536) -- 0:00:50 762000 -- (-2646.762) (-2634.128) (-2640.153) [-2637.609] * (-2642.982) [-2634.686] (-2643.278) (-2647.227) -- 0:00:50 762500 -- [-2637.712] (-2638.635) (-2639.787) (-2634.169) * (-2636.391) [-2644.721] (-2636.471) (-2639.919) -- 0:00:50 763000 -- (-2638.963) (-2639.726) (-2640.062) [-2638.168] * [-2639.548] (-2639.690) (-2645.870) (-2641.168) -- 0:00:50 763500 -- (-2638.941) [-2646.777] (-2638.091) (-2647.473) * [-2634.305] (-2644.357) (-2644.691) (-2642.016) -- 0:00:49 764000 -- (-2636.607) (-2650.137) [-2638.125] (-2646.245) * [-2639.534] (-2640.619) (-2637.598) (-2637.835) -- 0:00:49 764500 -- (-2639.668) (-2651.339) [-2635.252] (-2644.962) * [-2638.726] (-2637.897) (-2643.013) (-2638.706) -- 0:00:49 765000 -- (-2638.090) [-2640.073] (-2637.632) (-2641.238) * (-2638.219) [-2640.195] (-2644.873) (-2635.921) -- 0:00:49 Average standard deviation of split frequencies: 0.000000 765500 -- (-2647.080) [-2642.132] (-2641.197) (-2643.171) * (-2642.116) (-2640.338) (-2642.652) [-2639.542] -- 0:00:49 766000 -- (-2639.944) (-2634.354) [-2638.692] (-2638.256) * (-2644.575) [-2643.235] (-2634.445) (-2642.326) -- 0:00:49 766500 -- (-2635.078) (-2641.660) [-2636.894] (-2640.063) * [-2642.444] (-2643.765) (-2641.398) (-2645.007) -- 0:00:49 767000 -- (-2639.237) (-2648.825) [-2644.241] (-2639.574) * [-2635.303] (-2641.413) (-2638.390) (-2639.816) -- 0:00:49 767500 -- (-2645.158) (-2646.467) [-2638.585] (-2637.895) * (-2640.098) (-2641.442) (-2640.900) [-2646.889] -- 0:00:49 768000 -- (-2645.821) (-2646.496) (-2642.272) [-2637.451] * (-2647.023) (-2643.815) [-2642.617] (-2640.271) -- 0:00:48 768500 -- (-2643.551) (-2643.286) [-2641.702] (-2636.134) * (-2643.513) (-2639.279) [-2645.279] (-2636.347) -- 0:00:48 769000 -- (-2638.755) (-2645.548) [-2642.975] (-2644.954) * (-2637.197) [-2638.743] (-2640.355) (-2645.665) -- 0:00:48 769500 -- (-2641.269) (-2642.396) (-2634.600) [-2641.394] * [-2640.562] (-2635.019) (-2647.308) (-2644.493) -- 0:00:48 770000 -- (-2647.387) (-2636.357) [-2637.417] (-2637.172) * (-2649.471) [-2640.709] (-2642.506) (-2649.661) -- 0:00:48 Average standard deviation of split frequencies: 0.000000 770500 -- (-2641.803) [-2638.406] (-2641.938) (-2639.145) * (-2646.404) (-2644.834) [-2643.065] (-2646.208) -- 0:00:48 771000 -- [-2643.483] (-2640.581) (-2640.913) (-2639.891) * (-2638.363) [-2635.851] (-2640.971) (-2642.027) -- 0:00:48 771500 -- (-2641.211) (-2643.167) (-2638.297) [-2640.163] * (-2642.982) (-2635.118) (-2637.514) [-2640.841] -- 0:00:48 772000 -- [-2639.693] (-2641.059) (-2638.082) (-2637.530) * (-2641.874) [-2636.147] (-2638.739) (-2642.220) -- 0:00:48 772500 -- (-2640.730) (-2647.935) [-2636.306] (-2645.278) * (-2641.265) (-2636.105) [-2638.457] (-2639.924) -- 0:00:48 773000 -- (-2637.462) (-2639.466) [-2643.706] (-2637.875) * (-2636.079) (-2635.087) [-2635.172] (-2637.045) -- 0:00:47 773500 -- (-2640.899) [-2638.139] (-2640.287) (-2646.828) * (-2642.281) [-2641.599] (-2644.372) (-2642.187) -- 0:00:48 774000 -- (-2638.236) (-2635.789) (-2638.829) [-2638.429] * (-2639.413) (-2646.157) [-2641.557] (-2633.603) -- 0:00:47 774500 -- [-2640.075] (-2635.198) (-2641.398) (-2639.487) * (-2641.331) (-2646.172) (-2639.756) [-2637.673] -- 0:00:47 775000 -- (-2647.625) [-2636.106] (-2641.784) (-2644.945) * (-2638.876) (-2642.529) [-2639.903] (-2642.456) -- 0:00:47 Average standard deviation of split frequencies: 0.000000 775500 -- (-2639.520) (-2643.321) (-2640.705) [-2645.432] * (-2638.159) (-2644.446) [-2645.198] (-2640.124) -- 0:00:47 776000 -- (-2642.574) (-2634.817) [-2639.506] (-2651.620) * (-2635.663) (-2642.017) (-2640.442) [-2639.921] -- 0:00:47 776500 -- (-2638.554) (-2644.505) [-2637.739] (-2639.936) * [-2637.336] (-2641.850) (-2639.577) (-2642.002) -- 0:00:47 777000 -- (-2641.052) (-2638.362) [-2641.994] (-2639.861) * [-2638.277] (-2643.076) (-2640.513) (-2645.224) -- 0:00:47 777500 -- (-2638.670) (-2645.313) (-2644.767) [-2640.784] * (-2635.601) (-2643.174) [-2640.416] (-2639.467) -- 0:00:46 778000 -- (-2639.142) (-2643.160) (-2642.438) [-2638.465] * (-2640.148) (-2636.826) [-2640.505] (-2641.402) -- 0:00:46 778500 -- (-2637.721) [-2639.128] (-2638.042) (-2638.435) * (-2638.729) (-2635.880) [-2645.735] (-2639.907) -- 0:00:46 779000 -- (-2641.705) (-2643.368) (-2639.377) [-2638.833] * (-2641.332) (-2638.959) (-2644.946) [-2643.575] -- 0:00:46 779500 -- (-2649.943) (-2641.495) [-2638.679] (-2638.181) * [-2637.451] (-2639.937) (-2640.786) (-2639.912) -- 0:00:46 780000 -- (-2641.570) (-2638.805) [-2637.278] (-2635.533) * (-2645.440) [-2648.213] (-2639.932) (-2641.786) -- 0:00:46 Average standard deviation of split frequencies: 0.000000 780500 -- [-2640.238] (-2640.745) (-2646.302) (-2644.638) * [-2639.473] (-2647.472) (-2641.189) (-2644.115) -- 0:00:46 781000 -- (-2642.383) (-2639.565) [-2643.672] (-2642.220) * (-2645.282) (-2647.130) [-2640.700] (-2637.898) -- 0:00:46 781500 -- (-2642.034) (-2644.480) (-2639.344) [-2643.978] * [-2636.950] (-2641.483) (-2640.288) (-2635.761) -- 0:00:46 782000 -- (-2640.367) (-2647.978) (-2639.747) [-2638.839] * [-2640.590] (-2637.236) (-2644.162) (-2650.066) -- 0:00:45 782500 -- [-2636.882] (-2648.733) (-2643.453) (-2639.983) * [-2639.140] (-2638.329) (-2637.730) (-2643.571) -- 0:00:45 783000 -- (-2642.302) (-2635.358) (-2640.043) [-2637.550] * (-2638.999) [-2642.960] (-2638.960) (-2645.795) -- 0:00:46 783500 -- (-2638.991) [-2648.600] (-2644.833) (-2645.233) * (-2638.067) (-2636.921) [-2646.495] (-2636.885) -- 0:00:45 784000 -- (-2636.907) (-2637.379) (-2640.097) [-2637.011] * (-2636.626) (-2644.838) (-2637.397) [-2639.470] -- 0:00:45 784500 -- (-2642.283) [-2644.876] (-2636.716) (-2639.940) * [-2641.608] (-2646.359) (-2640.147) (-2645.955) -- 0:00:45 785000 -- (-2637.249) [-2640.347] (-2645.335) (-2636.637) * (-2641.101) (-2642.909) [-2640.514] (-2642.944) -- 0:00:45 Average standard deviation of split frequencies: 0.000000 785500 -- [-2645.808] (-2646.128) (-2638.371) (-2638.329) * (-2641.604) [-2639.883] (-2638.662) (-2638.977) -- 0:00:45 786000 -- [-2637.636] (-2635.022) (-2639.402) (-2637.948) * (-2635.606) (-2637.809) (-2641.649) [-2643.029] -- 0:00:45 786500 -- (-2640.905) (-2638.113) [-2640.182] (-2641.329) * (-2638.889) (-2642.535) [-2643.512] (-2642.076) -- 0:00:45 787000 -- [-2643.526] (-2640.451) (-2641.289) (-2640.048) * (-2635.263) (-2643.270) [-2634.755] (-2644.642) -- 0:00:44 787500 -- (-2646.097) (-2639.403) [-2643.534] (-2635.974) * (-2645.700) (-2635.612) [-2632.840] (-2637.685) -- 0:00:44 788000 -- [-2639.313] (-2647.864) (-2650.234) (-2641.797) * (-2642.840) [-2639.551] (-2637.861) (-2640.283) -- 0:00:44 788500 -- (-2640.638) [-2639.859] (-2641.557) (-2638.819) * (-2644.025) [-2644.073] (-2639.051) (-2639.275) -- 0:00:44 789000 -- (-2636.640) (-2648.113) [-2640.311] (-2638.659) * [-2646.592] (-2645.200) (-2644.355) (-2642.221) -- 0:00:44 789500 -- (-2641.344) [-2639.638] (-2637.660) (-2636.658) * (-2656.638) [-2638.096] (-2644.028) (-2640.391) -- 0:00:44 790000 -- (-2639.280) [-2642.039] (-2639.636) (-2639.216) * [-2642.654] (-2638.178) (-2641.380) (-2643.852) -- 0:00:44 Average standard deviation of split frequencies: 0.000000 790500 -- (-2637.783) (-2638.955) (-2647.529) [-2636.404] * [-2646.140] (-2640.737) (-2635.888) (-2645.950) -- 0:00:44 791000 -- (-2638.556) [-2638.654] (-2644.695) (-2641.145) * (-2637.878) [-2640.480] (-2643.250) (-2636.004) -- 0:00:44 791500 -- (-2641.192) (-2638.836) (-2636.202) [-2636.391] * [-2643.808] (-2639.952) (-2639.319) (-2639.801) -- 0:00:43 792000 -- (-2639.225) (-2643.522) [-2640.384] (-2643.734) * (-2642.132) (-2641.328) [-2641.284] (-2638.814) -- 0:00:43 792500 -- (-2639.124) [-2645.028] (-2643.160) (-2646.192) * (-2640.750) (-2640.882) [-2649.139] (-2635.894) -- 0:00:43 793000 -- [-2641.013] (-2646.133) (-2643.400) (-2638.400) * (-2644.174) (-2643.769) (-2640.275) [-2638.980] -- 0:00:43 793500 -- (-2649.619) (-2645.236) [-2642.694] (-2640.792) * (-2638.600) (-2647.803) (-2640.599) [-2641.053] -- 0:00:43 794000 -- [-2635.780] (-2643.082) (-2648.934) (-2645.006) * (-2638.967) (-2642.315) (-2634.983) [-2638.191] -- 0:00:43 794500 -- [-2638.231] (-2640.251) (-2644.795) (-2642.903) * (-2639.170) (-2648.419) (-2645.316) [-2638.713] -- 0:00:43 795000 -- (-2638.524) (-2643.802) (-2645.159) [-2640.928] * (-2639.483) (-2644.497) (-2643.844) [-2637.876] -- 0:00:43 Average standard deviation of split frequencies: 0.000000 795500 -- [-2636.854] (-2636.221) (-2640.971) (-2643.871) * (-2643.072) (-2644.305) [-2636.947] (-2640.411) -- 0:00:43 796000 -- (-2634.365) (-2638.623) [-2637.349] (-2637.735) * [-2636.318] (-2644.297) (-2639.321) (-2638.605) -- 0:00:43 796500 -- (-2637.258) [-2642.105] (-2635.857) (-2639.521) * [-2644.442] (-2646.537) (-2646.640) (-2644.991) -- 0:00:42 797000 -- (-2641.148) (-2640.077) [-2640.850] (-2639.056) * (-2653.468) (-2640.464) [-2636.267] (-2633.732) -- 0:00:43 797500 -- (-2643.379) (-2639.825) (-2642.727) [-2639.323] * [-2650.926] (-2649.230) (-2639.246) (-2644.828) -- 0:00:42 798000 -- (-2642.693) [-2637.810] (-2645.773) (-2638.597) * (-2648.013) [-2637.991] (-2643.609) (-2637.711) -- 0:00:42 798500 -- (-2644.491) [-2640.474] (-2638.528) (-2647.943) * (-2640.520) (-2636.258) (-2635.704) [-2636.740] -- 0:00:42 799000 -- (-2635.777) (-2640.507) [-2637.567] (-2642.115) * [-2644.499] (-2643.279) (-2638.331) (-2639.928) -- 0:00:42 799500 -- (-2636.738) (-2638.712) [-2637.893] (-2640.421) * (-2643.044) [-2637.863] (-2639.507) (-2646.122) -- 0:00:42 800000 -- [-2634.741] (-2642.520) (-2642.690) (-2638.860) * (-2638.992) (-2645.491) [-2637.606] (-2643.745) -- 0:00:42 Average standard deviation of split frequencies: 0.000000 800500 -- (-2647.605) [-2639.347] (-2638.091) (-2643.521) * (-2636.624) (-2643.213) [-2636.830] (-2644.101) -- 0:00:42 801000 -- (-2640.658) [-2636.780] (-2643.310) (-2649.183) * [-2635.733] (-2641.611) (-2638.270) (-2637.498) -- 0:00:41 801500 -- [-2634.854] (-2634.146) (-2645.626) (-2645.687) * (-2644.309) (-2634.733) [-2637.129] (-2635.624) -- 0:00:41 802000 -- (-2637.207) [-2640.114] (-2641.259) (-2640.468) * (-2643.197) (-2642.285) (-2635.736) [-2636.256] -- 0:00:41 802500 -- [-2632.402] (-2639.450) (-2642.627) (-2635.716) * [-2635.534] (-2647.900) (-2641.069) (-2638.345) -- 0:00:41 803000 -- (-2639.248) (-2639.623) [-2637.975] (-2638.371) * (-2639.272) (-2637.803) (-2640.668) [-2641.239] -- 0:00:41 803500 -- [-2637.884] (-2635.246) (-2638.136) (-2638.691) * (-2635.220) (-2644.916) (-2639.312) [-2640.048] -- 0:00:41 804000 -- (-2647.066) [-2637.574] (-2646.893) (-2639.712) * (-2643.102) (-2640.957) [-2636.586] (-2633.781) -- 0:00:41 804500 -- (-2641.373) (-2641.563) (-2640.174) [-2639.037] * (-2651.348) [-2638.046] (-2639.242) (-2641.171) -- 0:00:41 805000 -- (-2642.505) (-2636.062) (-2651.786) [-2635.898] * (-2647.218) (-2640.779) [-2638.342] (-2639.510) -- 0:00:41 Average standard deviation of split frequencies: 0.000000 805500 -- (-2637.897) [-2641.545] (-2638.705) (-2633.003) * (-2649.237) [-2637.822] (-2646.688) (-2639.937) -- 0:00:41 806000 -- (-2641.830) [-2636.714] (-2646.874) (-2640.243) * (-2641.323) (-2638.190) (-2641.749) [-2637.942] -- 0:00:40 806500 -- (-2640.919) (-2642.591) (-2638.332) [-2639.594] * (-2649.166) (-2636.291) [-2641.152] (-2642.720) -- 0:00:41 807000 -- [-2645.673] (-2642.603) (-2647.380) (-2637.599) * (-2643.918) (-2641.177) (-2642.655) [-2640.592] -- 0:00:40 807500 -- [-2639.259] (-2643.454) (-2638.322) (-2637.391) * [-2637.855] (-2639.449) (-2644.719) (-2655.217) -- 0:00:40 808000 -- (-2636.508) (-2642.293) (-2651.178) [-2635.582] * (-2645.691) [-2642.610] (-2640.424) (-2640.771) -- 0:00:40 808500 -- [-2641.298] (-2642.396) (-2635.945) (-2639.731) * [-2643.233] (-2641.527) (-2637.238) (-2637.026) -- 0:00:40 809000 -- [-2635.447] (-2639.263) (-2635.156) (-2643.501) * (-2638.823) (-2639.679) (-2642.131) [-2639.130] -- 0:00:40 809500 -- (-2635.402) [-2641.952] (-2635.084) (-2649.711) * (-2645.772) (-2645.876) [-2642.241] (-2641.948) -- 0:00:40 810000 -- (-2640.976) [-2644.946] (-2640.080) (-2650.646) * (-2638.186) (-2649.875) (-2636.901) [-2640.077] -- 0:00:40 Average standard deviation of split frequencies: 0.000000 810500 -- (-2637.872) (-2636.109) (-2645.855) [-2641.414] * (-2642.024) (-2636.860) (-2634.811) [-2634.750] -- 0:00:39 811000 -- [-2635.958] (-2641.981) (-2643.400) (-2640.284) * (-2640.144) (-2638.092) [-2635.643] (-2640.476) -- 0:00:39 811500 -- [-2639.438] (-2641.835) (-2639.448) (-2638.544) * (-2649.202) [-2639.710] (-2636.670) (-2638.557) -- 0:00:39 812000 -- (-2638.230) (-2643.946) (-2644.189) [-2643.019] * (-2645.067) [-2640.098] (-2637.717) (-2638.204) -- 0:00:39 812500 -- (-2640.749) (-2641.100) [-2637.780] (-2634.871) * (-2639.923) [-2637.442] (-2642.329) (-2640.177) -- 0:00:39 813000 -- (-2639.607) (-2639.865) (-2636.872) [-2643.938] * (-2641.259) [-2650.724] (-2641.261) (-2637.608) -- 0:00:39 813500 -- (-2647.624) (-2637.764) (-2642.658) [-2642.919] * (-2642.549) (-2638.218) (-2646.864) [-2641.260] -- 0:00:39 814000 -- (-2644.143) [-2641.363] (-2641.050) (-2639.406) * (-2636.687) (-2640.811) [-2639.963] (-2643.691) -- 0:00:39 814500 -- (-2643.913) (-2633.106) [-2641.577] (-2638.997) * (-2641.977) (-2640.354) [-2641.062] (-2638.146) -- 0:00:39 815000 -- (-2647.228) [-2641.375] (-2642.848) (-2638.177) * (-2635.976) (-2638.041) (-2639.370) [-2641.478] -- 0:00:39 Average standard deviation of split frequencies: 0.000000 815500 -- (-2640.152) (-2639.337) (-2644.091) [-2637.422] * (-2636.217) (-2636.982) [-2638.999] (-2642.155) -- 0:00:38 816000 -- (-2639.117) (-2637.261) [-2640.168] (-2640.539) * [-2639.839] (-2638.696) (-2639.672) (-2640.198) -- 0:00:39 816500 -- (-2635.679) [-2639.032] (-2640.669) (-2640.160) * (-2641.861) (-2642.743) (-2636.941) [-2641.167] -- 0:00:38 817000 -- (-2642.840) (-2635.177) (-2644.850) [-2641.245] * [-2636.271] (-2645.963) (-2641.570) (-2638.652) -- 0:00:38 817500 -- (-2640.640) (-2643.981) (-2638.842) [-2640.573] * [-2636.389] (-2640.497) (-2640.566) (-2645.430) -- 0:00:38 818000 -- [-2642.306] (-2644.167) (-2640.776) (-2643.167) * (-2639.717) [-2643.068] (-2637.831) (-2650.427) -- 0:00:38 818500 -- (-2638.591) [-2639.100] (-2638.457) (-2648.667) * [-2636.203] (-2643.808) (-2639.545) (-2642.074) -- 0:00:38 819000 -- (-2649.666) (-2639.266) (-2634.583) [-2637.653] * [-2634.583] (-2646.215) (-2637.799) (-2638.476) -- 0:00:38 819500 -- (-2633.770) (-2637.348) [-2638.033] (-2637.412) * (-2639.454) (-2642.666) [-2639.044] (-2647.909) -- 0:00:38 820000 -- (-2641.123) [-2640.052] (-2646.217) (-2636.088) * (-2637.207) (-2646.856) [-2644.538] (-2645.199) -- 0:00:37 Average standard deviation of split frequencies: 0.000000 820500 -- [-2639.005] (-2644.963) (-2645.951) (-2637.866) * (-2638.534) (-2641.938) [-2638.650] (-2635.855) -- 0:00:38 821000 -- (-2637.376) [-2644.110] (-2652.026) (-2639.279) * (-2636.793) [-2637.874] (-2644.979) (-2640.113) -- 0:00:37 821500 -- [-2638.610] (-2640.162) (-2642.026) (-2655.798) * [-2634.753] (-2639.386) (-2644.043) (-2636.478) -- 0:00:37 822000 -- (-2637.507) (-2633.790) [-2641.632] (-2635.287) * (-2644.458) [-2644.822] (-2639.011) (-2646.275) -- 0:00:37 822500 -- [-2637.598] (-2636.042) (-2642.541) (-2632.536) * (-2638.024) [-2641.119] (-2643.900) (-2646.342) -- 0:00:37 823000 -- (-2643.574) (-2642.700) (-2648.144) [-2636.306] * (-2637.095) [-2640.047] (-2637.945) (-2638.170) -- 0:00:37 823500 -- (-2644.206) [-2637.135] (-2645.341) (-2634.153) * (-2642.021) (-2642.107) (-2638.892) [-2637.060] -- 0:00:37 824000 -- (-2638.430) (-2637.357) (-2645.815) [-2639.524] * (-2637.582) [-2636.735] (-2641.100) (-2638.525) -- 0:00:37 824500 -- (-2636.507) (-2650.262) [-2640.931] (-2640.847) * [-2635.840] (-2645.650) (-2640.008) (-2638.346) -- 0:00:37 825000 -- (-2636.672) (-2636.258) [-2641.888] (-2644.618) * (-2640.109) (-2642.087) [-2637.686] (-2637.518) -- 0:00:36 Average standard deviation of split frequencies: 0.000000 825500 -- (-2636.677) [-2641.716] (-2641.564) (-2635.969) * [-2637.732] (-2641.166) (-2640.396) (-2635.100) -- 0:00:36 826000 -- (-2638.641) [-2636.337] (-2639.842) (-2644.055) * (-2644.385) (-2638.080) [-2641.513] (-2633.962) -- 0:00:36 826500 -- (-2646.655) (-2635.430) [-2645.212] (-2644.766) * (-2640.594) [-2635.971] (-2639.299) (-2636.903) -- 0:00:36 827000 -- (-2642.051) (-2635.500) (-2633.059) [-2635.501] * (-2638.594) (-2635.272) (-2643.342) [-2642.555] -- 0:00:36 827500 -- (-2636.625) (-2643.872) [-2640.838] (-2639.635) * (-2636.844) (-2636.482) [-2637.158] (-2647.558) -- 0:00:36 828000 -- (-2641.940) [-2635.955] (-2643.526) (-2640.626) * (-2637.139) [-2637.979] (-2640.487) (-2636.118) -- 0:00:36 828500 -- (-2637.502) (-2640.050) (-2639.575) [-2638.744] * (-2638.576) [-2639.410] (-2641.404) (-2637.053) -- 0:00:36 829000 -- (-2639.979) [-2638.821] (-2642.111) (-2640.758) * [-2636.523] (-2645.300) (-2637.103) (-2636.903) -- 0:00:36 829500 -- (-2641.301) (-2634.584) [-2635.274] (-2639.312) * [-2637.918] (-2642.151) (-2633.997) (-2642.952) -- 0:00:35 830000 -- (-2640.617) (-2636.667) (-2636.864) [-2640.411] * [-2638.257] (-2650.163) (-2633.411) (-2641.048) -- 0:00:36 Average standard deviation of split frequencies: 0.000000 830500 -- (-2636.499) (-2644.862) [-2636.469] (-2635.547) * (-2639.520) (-2652.913) (-2645.556) [-2637.595] -- 0:00:35 831000 -- (-2641.561) (-2640.452) [-2640.980] (-2639.707) * [-2638.756] (-2648.302) (-2641.070) (-2639.200) -- 0:00:35 831500 -- [-2641.711] (-2638.416) (-2634.723) (-2642.149) * (-2637.469) (-2637.033) [-2642.152] (-2635.279) -- 0:00:35 832000 -- (-2648.625) [-2642.043] (-2638.880) (-2640.909) * (-2644.127) (-2637.608) (-2650.643) [-2639.119] -- 0:00:35 832500 -- (-2641.180) [-2635.483] (-2643.797) (-2637.912) * (-2644.456) (-2645.128) [-2649.513] (-2637.526) -- 0:00:35 833000 -- (-2640.585) (-2638.178) (-2648.495) [-2635.100] * (-2646.429) (-2639.415) [-2638.838] (-2634.768) -- 0:00:35 833500 -- (-2641.201) (-2638.882) (-2640.697) [-2638.037] * (-2641.956) (-2637.057) (-2645.101) [-2642.271] -- 0:00:35 834000 -- [-2636.536] (-2642.520) (-2637.440) (-2640.690) * (-2638.807) (-2644.489) [-2636.704] (-2643.194) -- 0:00:35 834500 -- (-2649.221) (-2634.629) [-2636.667] (-2638.961) * (-2643.672) (-2641.800) [-2639.167] (-2635.421) -- 0:00:34 835000 -- [-2644.469] (-2635.896) (-2638.345) (-2649.464) * (-2638.537) (-2638.707) (-2645.211) [-2639.551] -- 0:00:34 Average standard deviation of split frequencies: 0.000000 835500 -- [-2639.886] (-2639.609) (-2641.657) (-2643.946) * (-2639.417) (-2638.250) [-2641.803] (-2638.850) -- 0:00:34 836000 -- (-2636.797) [-2633.978] (-2643.331) (-2645.134) * (-2638.793) (-2643.799) (-2636.434) [-2636.303] -- 0:00:34 836500 -- (-2639.556) [-2644.288] (-2638.826) (-2642.214) * [-2639.658] (-2644.146) (-2641.947) (-2641.407) -- 0:00:34 837000 -- (-2637.927) [-2646.023] (-2643.309) (-2642.103) * (-2640.070) [-2638.017] (-2643.317) (-2641.651) -- 0:00:34 837500 -- (-2643.491) (-2642.601) (-2639.554) [-2637.616] * (-2643.501) (-2640.494) (-2644.425) [-2647.555] -- 0:00:34 838000 -- (-2638.520) [-2647.847] (-2641.907) (-2637.825) * (-2646.191) (-2641.205) [-2642.788] (-2645.096) -- 0:00:34 838500 -- [-2636.394] (-2642.013) (-2635.990) (-2640.903) * (-2636.953) (-2641.168) (-2639.359) [-2638.666] -- 0:00:34 839000 -- [-2638.401] (-2640.503) (-2636.406) (-2632.603) * [-2637.772] (-2634.747) (-2639.560) (-2640.217) -- 0:00:33 839500 -- (-2640.114) [-2640.526] (-2639.757) (-2640.554) * (-2642.860) (-2641.184) [-2638.575] (-2641.084) -- 0:00:34 840000 -- (-2635.253) (-2635.956) [-2644.095] (-2635.117) * (-2649.055) (-2641.626) (-2641.365) [-2648.162] -- 0:00:33 Average standard deviation of split frequencies: 0.000000 840500 -- (-2635.311) (-2638.422) (-2647.340) [-2634.934] * (-2638.981) (-2639.044) [-2640.435] (-2651.579) -- 0:00:33 841000 -- (-2638.055) (-2637.241) [-2646.080] (-2640.051) * [-2642.568] (-2641.169) (-2642.407) (-2645.893) -- 0:00:33 841500 -- [-2638.372] (-2636.677) (-2648.093) (-2639.857) * (-2638.338) (-2640.294) [-2634.798] (-2643.506) -- 0:00:33 842000 -- (-2637.344) (-2646.053) [-2645.495] (-2642.879) * (-2639.517) (-2642.962) [-2640.296] (-2638.792) -- 0:00:33 842500 -- (-2642.758) (-2638.715) [-2641.685] (-2647.981) * [-2638.457] (-2644.577) (-2642.966) (-2644.371) -- 0:00:33 843000 -- (-2645.388) [-2641.421] (-2640.841) (-2643.133) * [-2641.955] (-2639.675) (-2646.757) (-2639.879) -- 0:00:33 843500 -- [-2637.306] (-2637.193) (-2642.327) (-2642.515) * (-2646.305) (-2644.891) (-2646.313) [-2642.605] -- 0:00:33 844000 -- (-2637.741) [-2639.726] (-2636.987) (-2635.440) * [-2634.589] (-2642.537) (-2645.219) (-2640.424) -- 0:00:32 844500 -- (-2637.582) [-2633.824] (-2640.877) (-2641.998) * (-2647.102) (-2645.077) (-2637.099) [-2633.906] -- 0:00:32 845000 -- (-2642.054) [-2635.959] (-2636.565) (-2642.701) * [-2636.859] (-2642.695) (-2638.441) (-2640.960) -- 0:00:32 Average standard deviation of split frequencies: 0.000000 845500 -- [-2638.336] (-2638.738) (-2640.465) (-2640.217) * (-2638.735) (-2647.394) (-2638.019) [-2636.593] -- 0:00:32 846000 -- (-2639.959) (-2637.365) [-2640.332] (-2639.189) * (-2637.896) (-2643.546) (-2646.169) [-2637.266] -- 0:00:32 846500 -- (-2643.360) (-2636.811) [-2645.371] (-2637.807) * (-2643.740) (-2643.645) (-2635.850) [-2635.254] -- 0:00:32 847000 -- [-2643.213] (-2637.349) (-2637.445) (-2641.494) * (-2640.707) [-2644.653] (-2640.086) (-2637.750) -- 0:00:32 847500 -- (-2640.292) [-2641.783] (-2645.300) (-2644.722) * (-2640.268) (-2640.480) [-2635.936] (-2641.408) -- 0:00:32 848000 -- (-2641.999) (-2640.437) (-2641.112) [-2641.686] * (-2639.724) [-2637.812] (-2636.731) (-2634.482) -- 0:00:32 848500 -- (-2646.801) (-2639.093) [-2638.905] (-2641.128) * [-2639.206] (-2646.748) (-2644.455) (-2635.373) -- 0:00:31 849000 -- (-2641.158) (-2647.322) (-2641.256) [-2640.615] * (-2642.767) (-2641.100) (-2636.669) [-2640.809] -- 0:00:32 849500 -- (-2636.214) (-2643.919) (-2652.927) [-2646.015] * [-2638.307] (-2645.608) (-2637.289) (-2638.604) -- 0:00:31 850000 -- (-2647.244) (-2638.865) (-2645.118) [-2635.004] * [-2636.258] (-2648.919) (-2642.498) (-2644.463) -- 0:00:31 Average standard deviation of split frequencies: 0.000000 850500 -- (-2642.882) (-2639.709) (-2647.584) [-2635.816] * (-2640.978) (-2643.065) (-2643.248) [-2639.874] -- 0:00:31 851000 -- (-2644.496) [-2636.120] (-2644.447) (-2640.579) * (-2638.678) (-2641.559) [-2638.907] (-2644.845) -- 0:00:31 851500 -- (-2648.629) (-2639.749) [-2637.556] (-2638.278) * (-2642.269) (-2647.415) (-2645.067) [-2650.368] -- 0:00:31 852000 -- (-2643.748) [-2641.981] (-2639.118) (-2638.738) * (-2638.969) (-2639.702) [-2634.010] (-2643.082) -- 0:00:31 852500 -- [-2638.593] (-2643.294) (-2645.327) (-2638.528) * [-2636.893] (-2645.460) (-2643.913) (-2645.327) -- 0:00:31 853000 -- [-2645.319] (-2645.976) (-2641.732) (-2638.312) * (-2645.131) [-2643.269] (-2639.297) (-2643.245) -- 0:00:31 853500 -- (-2641.110) [-2646.727] (-2642.144) (-2636.689) * (-2641.712) (-2648.959) [-2637.668] (-2636.659) -- 0:00:30 854000 -- (-2636.957) [-2635.959] (-2648.389) (-2639.740) * (-2638.517) (-2640.423) (-2637.734) [-2641.569] -- 0:00:30 854500 -- (-2639.577) (-2637.648) [-2641.719] (-2640.781) * (-2639.665) (-2644.103) [-2634.682] (-2642.465) -- 0:00:30 855000 -- (-2639.489) [-2639.723] (-2648.812) (-2633.144) * (-2641.824) [-2639.816] (-2643.317) (-2635.137) -- 0:00:30 Average standard deviation of split frequencies: 0.000000 855500 -- [-2646.498] (-2637.238) (-2644.432) (-2638.057) * (-2647.249) (-2640.545) [-2637.460] (-2634.543) -- 0:00:30 856000 -- (-2633.460) (-2643.211) (-2643.484) [-2635.640] * (-2643.359) (-2647.835) (-2636.221) [-2636.113] -- 0:00:30 856500 -- [-2640.392] (-2643.874) (-2645.491) (-2643.154) * (-2641.816) [-2640.292] (-2647.018) (-2639.982) -- 0:00:30 857000 -- (-2639.107) (-2644.204) [-2644.834] (-2640.764) * (-2638.242) (-2645.649) (-2640.374) [-2638.031] -- 0:00:30 857500 -- [-2636.234] (-2642.582) (-2640.763) (-2636.984) * (-2638.901) (-2638.843) (-2637.212) [-2635.979] -- 0:00:30 858000 -- (-2639.294) (-2641.426) (-2639.227) [-2639.117] * (-2638.545) (-2645.110) [-2638.048] (-2640.364) -- 0:00:29 858500 -- [-2638.010] (-2641.038) (-2638.009) (-2644.771) * (-2644.813) (-2647.685) (-2640.822) [-2635.732] -- 0:00:29 859000 -- [-2635.663] (-2644.449) (-2636.705) (-2640.682) * (-2645.335) [-2641.398] (-2640.083) (-2642.571) -- 0:00:29 859500 -- [-2639.646] (-2639.574) (-2644.898) (-2642.927) * (-2649.520) (-2643.307) (-2640.635) [-2649.068] -- 0:00:29 860000 -- [-2642.344] (-2637.208) (-2647.617) (-2637.185) * (-2638.771) (-2642.626) (-2643.424) [-2646.685] -- 0:00:29 Average standard deviation of split frequencies: 0.000000 860500 -- (-2640.332) (-2642.705) [-2645.651] (-2643.156) * (-2636.834) (-2645.735) [-2640.778] (-2649.309) -- 0:00:29 861000 -- [-2636.353] (-2645.328) (-2639.485) (-2639.028) * (-2643.566) (-2647.297) [-2640.799] (-2645.515) -- 0:00:29 861500 -- [-2639.238] (-2642.240) (-2644.043) (-2644.777) * (-2633.505) (-2636.512) [-2642.536] (-2640.801) -- 0:00:29 862000 -- (-2636.081) (-2634.199) [-2639.206] (-2652.014) * (-2638.638) [-2635.353] (-2648.738) (-2640.180) -- 0:00:29 862500 -- [-2633.386] (-2638.386) (-2636.401) (-2640.849) * (-2641.009) [-2641.602] (-2639.740) (-2645.465) -- 0:00:29 863000 -- [-2640.650] (-2636.465) (-2642.094) (-2637.892) * [-2641.964] (-2652.512) (-2644.645) (-2634.127) -- 0:00:29 863500 -- (-2636.819) (-2635.329) (-2645.340) [-2641.368] * (-2643.946) [-2635.292] (-2637.725) (-2635.111) -- 0:00:28 864000 -- (-2639.477) (-2646.271) [-2648.308] (-2641.939) * (-2642.013) [-2639.369] (-2639.240) (-2647.676) -- 0:00:28 864500 -- [-2639.734] (-2640.172) (-2647.925) (-2639.920) * (-2644.558) (-2638.325) (-2639.253) [-2636.749] -- 0:00:28 865000 -- [-2636.520] (-2637.970) (-2635.925) (-2640.945) * (-2645.082) (-2640.724) [-2640.282] (-2640.325) -- 0:00:28 Average standard deviation of split frequencies: 0.000000 865500 -- (-2639.073) (-2636.636) [-2637.423] (-2639.100) * (-2642.147) (-2639.536) [-2635.572] (-2636.073) -- 0:00:28 866000 -- (-2636.825) [-2643.575] (-2634.991) (-2643.141) * (-2644.036) (-2640.409) [-2637.290] (-2643.735) -- 0:00:28 866500 -- (-2635.727) (-2639.166) (-2650.885) [-2638.534] * (-2636.897) [-2639.137] (-2644.027) (-2640.433) -- 0:00:28 867000 -- (-2646.111) [-2641.714] (-2645.536) (-2644.190) * (-2641.975) (-2641.349) [-2641.922] (-2641.934) -- 0:00:28 867500 -- (-2647.964) (-2645.911) (-2642.165) [-2637.252] * (-2641.066) (-2642.282) [-2639.758] (-2640.178) -- 0:00:27 868000 -- [-2637.466] (-2643.840) (-2637.853) (-2636.719) * (-2647.026) (-2640.128) [-2642.595] (-2638.873) -- 0:00:27 868500 -- (-2640.522) (-2637.786) [-2642.853] (-2645.545) * (-2638.156) [-2640.208] (-2640.795) (-2644.505) -- 0:00:27 869000 -- (-2637.242) (-2637.473) (-2641.364) [-2641.490] * [-2643.296] (-2644.959) (-2635.314) (-2636.309) -- 0:00:27 869500 -- [-2638.289] (-2639.081) (-2637.827) (-2654.391) * [-2636.742] (-2641.111) (-2647.618) (-2638.278) -- 0:00:27 870000 -- [-2635.563] (-2635.850) (-2645.517) (-2637.194) * (-2641.424) (-2637.987) (-2640.034) [-2636.627] -- 0:00:27 Average standard deviation of split frequencies: 0.000000 870500 -- (-2641.835) (-2640.789) [-2636.679] (-2642.394) * [-2638.165] (-2644.486) (-2644.146) (-2639.974) -- 0:00:27 871000 -- [-2634.287] (-2639.168) (-2636.831) (-2640.847) * (-2638.689) (-2641.612) [-2642.714] (-2639.217) -- 0:00:27 871500 -- (-2636.096) [-2633.730] (-2636.559) (-2644.402) * (-2644.582) (-2640.704) (-2648.732) [-2636.537] -- 0:00:27 872000 -- (-2634.951) (-2635.788) [-2634.584] (-2638.206) * [-2635.489] (-2646.287) (-2640.407) (-2638.085) -- 0:00:27 872500 -- (-2645.428) [-2636.018] (-2647.010) (-2640.867) * (-2640.393) (-2652.286) [-2639.871] (-2637.661) -- 0:00:27 873000 -- (-2645.517) (-2638.489) [-2638.649] (-2645.116) * [-2636.022] (-2647.605) (-2639.112) (-2638.802) -- 0:00:26 873500 -- (-2641.601) (-2644.400) (-2641.492) [-2637.802] * (-2639.408) (-2641.924) (-2644.994) [-2639.948] -- 0:00:26 874000 -- (-2640.505) (-2644.235) (-2643.168) [-2635.439] * [-2633.397] (-2638.390) (-2637.343) (-2638.393) -- 0:00:26 874500 -- (-2639.398) (-2640.314) [-2640.818] (-2638.621) * [-2642.270] (-2647.791) (-2641.258) (-2638.115) -- 0:00:26 875000 -- [-2640.057] (-2640.917) (-2640.376) (-2646.704) * (-2641.862) (-2638.488) (-2638.391) [-2637.646] -- 0:00:26 Average standard deviation of split frequencies: 0.000000 875500 -- (-2644.460) (-2639.711) (-2640.307) [-2635.196] * (-2638.746) (-2641.855) [-2649.116] (-2638.283) -- 0:00:26 876000 -- [-2645.401] (-2633.126) (-2637.578) (-2635.913) * [-2633.836] (-2635.405) (-2642.104) (-2637.743) -- 0:00:26 876500 -- (-2641.453) (-2640.379) [-2636.789] (-2638.012) * (-2642.039) [-2631.635] (-2643.247) (-2634.175) -- 0:00:26 877000 -- (-2644.261) [-2637.132] (-2652.441) (-2642.114) * (-2641.395) (-2633.794) (-2646.519) [-2637.796] -- 0:00:25 877500 -- (-2645.623) [-2637.794] (-2646.995) (-2646.542) * (-2643.546) (-2636.267) [-2639.073] (-2641.415) -- 0:00:25 878000 -- [-2636.782] (-2636.169) (-2642.319) (-2646.539) * (-2642.243) (-2644.859) (-2642.856) [-2636.443] -- 0:00:25 878500 -- (-2640.641) [-2641.696] (-2639.280) (-2644.804) * (-2639.732) (-2645.027) [-2636.905] (-2638.294) -- 0:00:25 879000 -- (-2637.366) (-2637.436) [-2636.836] (-2638.832) * (-2645.016) [-2637.727] (-2638.697) (-2639.459) -- 0:00:25 879500 -- (-2641.234) (-2638.936) [-2637.665] (-2639.500) * (-2639.918) (-2637.785) [-2640.142] (-2640.360) -- 0:00:25 880000 -- (-2638.027) [-2644.782] (-2643.724) (-2637.910) * [-2634.979] (-2642.658) (-2640.265) (-2640.289) -- 0:00:25 Average standard deviation of split frequencies: 0.000000 880500 -- [-2637.301] (-2639.875) (-2638.044) (-2641.018) * [-2636.312] (-2639.212) (-2638.595) (-2642.139) -- 0:00:25 881000 -- (-2638.873) (-2651.406) (-2641.782) [-2639.003] * (-2638.722) (-2640.715) [-2635.348] (-2642.688) -- 0:00:25 881500 -- (-2638.559) [-2641.110] (-2639.236) (-2642.543) * (-2636.696) [-2643.823] (-2646.993) (-2646.118) -- 0:00:25 882000 -- [-2639.186] (-2639.030) (-2642.295) (-2639.825) * (-2635.841) (-2640.779) (-2647.635) [-2639.882] -- 0:00:25 882500 -- (-2643.627) (-2635.767) (-2641.907) [-2636.007] * (-2635.029) (-2639.259) (-2650.966) [-2637.945] -- 0:00:24 883000 -- (-2641.052) [-2637.538] (-2647.613) (-2638.402) * (-2641.307) (-2643.798) (-2634.630) [-2636.595] -- 0:00:24 883500 -- [-2636.570] (-2639.439) (-2641.779) (-2642.982) * (-2640.950) [-2643.763] (-2642.825) (-2642.857) -- 0:00:24 884000 -- (-2639.978) [-2643.350] (-2640.771) (-2649.307) * (-2645.144) (-2650.906) [-2640.062] (-2636.661) -- 0:00:24 884500 -- (-2640.958) [-2641.979] (-2638.542) (-2641.500) * (-2651.707) (-2639.873) [-2644.058] (-2641.144) -- 0:00:24 885000 -- [-2636.793] (-2638.906) (-2647.858) (-2645.247) * (-2640.391) [-2637.251] (-2637.246) (-2640.093) -- 0:00:24 Average standard deviation of split frequencies: 0.000000 885500 -- (-2640.039) (-2639.542) [-2641.172] (-2636.586) * (-2646.820) [-2637.833] (-2637.657) (-2641.814) -- 0:00:24 886000 -- (-2639.617) (-2642.177) [-2638.030] (-2644.863) * (-2655.637) (-2636.157) [-2647.754] (-2640.858) -- 0:00:24 886500 -- [-2638.130] (-2645.178) (-2643.876) (-2635.569) * [-2644.923] (-2642.640) (-2645.471) (-2636.946) -- 0:00:23 887000 -- [-2635.989] (-2654.706) (-2635.817) (-2642.645) * (-2635.474) (-2639.860) [-2639.879] (-2637.466) -- 0:00:23 887500 -- [-2642.635] (-2638.631) (-2642.268) (-2639.049) * (-2647.749) [-2642.232] (-2639.578) (-2642.016) -- 0:00:23 888000 -- (-2646.255) (-2637.457) [-2636.523] (-2644.184) * [-2639.798] (-2639.904) (-2642.673) (-2638.021) -- 0:00:23 888500 -- (-2643.918) [-2638.957] (-2642.263) (-2637.324) * (-2637.360) (-2642.694) (-2636.210) [-2641.016] -- 0:00:23 889000 -- (-2638.953) (-2642.824) (-2639.977) [-2637.863] * [-2637.311] (-2641.255) (-2639.996) (-2637.890) -- 0:00:23 889500 -- (-2635.335) [-2637.177] (-2640.960) (-2644.146) * (-2644.454) (-2649.581) [-2637.909] (-2640.527) -- 0:00:23 890000 -- (-2637.539) (-2643.267) (-2638.287) [-2638.247] * (-2639.580) (-2640.460) [-2637.114] (-2637.315) -- 0:00:23 Average standard deviation of split frequencies: 0.000000 890500 -- (-2637.369) (-2642.322) [-2643.372] (-2635.192) * (-2634.532) (-2641.231) [-2645.315] (-2644.621) -- 0:00:23 891000 -- [-2636.184] (-2640.746) (-2644.677) (-2639.306) * (-2639.072) (-2647.819) (-2637.895) [-2640.545] -- 0:00:22 891500 -- (-2639.856) [-2639.782] (-2642.049) (-2642.541) * [-2639.989] (-2642.417) (-2644.507) (-2637.171) -- 0:00:23 892000 -- (-2646.393) (-2639.801) [-2639.436] (-2643.781) * (-2641.084) (-2640.202) (-2637.601) [-2635.990] -- 0:00:22 892500 -- (-2638.424) (-2641.043) (-2641.434) [-2636.886] * (-2641.051) (-2635.647) (-2637.809) [-2637.351] -- 0:00:22 893000 -- (-2646.263) [-2640.864] (-2636.057) (-2640.871) * [-2644.284] (-2640.363) (-2640.545) (-2640.314) -- 0:00:22 893500 -- (-2640.866) (-2640.609) [-2637.703] (-2641.851) * [-2641.259] (-2636.579) (-2637.045) (-2638.310) -- 0:00:22 894000 -- [-2640.321] (-2643.349) (-2640.735) (-2640.885) * [-2640.382] (-2643.777) (-2639.499) (-2646.509) -- 0:00:22 894500 -- (-2636.611) (-2644.746) [-2638.723] (-2640.737) * [-2643.489] (-2644.436) (-2642.593) (-2638.740) -- 0:00:22 895000 -- [-2642.746] (-2639.598) (-2641.830) (-2637.496) * (-2641.729) [-2643.526] (-2643.141) (-2638.508) -- 0:00:22 Average standard deviation of split frequencies: 0.000000 895500 -- (-2646.225) [-2633.322] (-2638.559) (-2642.457) * (-2644.462) (-2638.212) (-2641.586) [-2635.517] -- 0:00:22 896000 -- (-2636.926) (-2636.755) (-2642.186) [-2638.928] * (-2638.531) (-2635.110) (-2644.106) [-2637.296] -- 0:00:22 896500 -- (-2633.950) [-2636.004] (-2640.353) (-2641.968) * (-2640.146) (-2640.957) (-2642.524) [-2637.324] -- 0:00:21 897000 -- (-2645.521) (-2642.089) [-2637.335] (-2636.768) * (-2640.046) (-2639.721) (-2642.609) [-2634.710] -- 0:00:21 897500 -- (-2645.171) (-2637.697) [-2638.635] (-2637.445) * [-2643.634] (-2637.429) (-2638.094) (-2641.899) -- 0:00:21 898000 -- (-2643.931) (-2640.529) (-2641.932) [-2642.449] * (-2644.155) (-2638.704) (-2647.715) [-2634.724] -- 0:00:21 898500 -- (-2643.681) (-2644.040) (-2635.207) [-2640.701] * (-2648.165) (-2639.311) (-2639.880) [-2641.740] -- 0:00:21 899000 -- (-2639.746) (-2641.388) [-2637.343] (-2640.822) * (-2647.162) (-2642.045) [-2638.572] (-2639.888) -- 0:00:21 899500 -- (-2638.045) (-2638.223) (-2642.810) [-2644.215] * [-2636.161] (-2639.062) (-2638.642) (-2644.470) -- 0:00:21 900000 -- (-2637.771) [-2644.659] (-2642.202) (-2646.717) * [-2637.177] (-2641.656) (-2637.256) (-2642.124) -- 0:00:21 Average standard deviation of split frequencies: 0.000000 900500 -- (-2646.335) (-2641.157) (-2648.365) [-2636.038] * [-2640.888] (-2642.119) (-2640.947) (-2637.574) -- 0:00:20 901000 -- (-2639.497) (-2651.081) (-2639.700) [-2642.512] * [-2637.646] (-2650.941) (-2639.484) (-2642.302) -- 0:00:20 901500 -- [-2641.446] (-2637.868) (-2636.712) (-2640.722) * [-2639.427] (-2641.887) (-2644.300) (-2641.425) -- 0:00:20 902000 -- (-2641.625) [-2635.178] (-2638.215) (-2647.061) * (-2638.633) [-2636.925] (-2640.862) (-2638.385) -- 0:00:20 902500 -- (-2641.630) [-2637.740] (-2642.464) (-2644.055) * [-2642.191] (-2637.071) (-2651.087) (-2640.989) -- 0:00:20 903000 -- (-2646.913) (-2646.930) [-2637.054] (-2642.955) * (-2641.182) [-2642.823] (-2640.007) (-2644.450) -- 0:00:20 903500 -- (-2647.560) (-2639.911) (-2637.537) [-2648.126] * (-2640.034) [-2640.353] (-2637.371) (-2645.507) -- 0:00:20 904000 -- (-2639.443) (-2643.660) [-2642.040] (-2645.749) * [-2641.384] (-2637.089) (-2645.168) (-2637.729) -- 0:00:20 904500 -- (-2637.884) [-2639.209] (-2640.496) (-2638.494) * [-2638.565] (-2641.923) (-2637.726) (-2637.906) -- 0:00:20 905000 -- (-2641.080) (-2646.469) [-2635.264] (-2642.780) * [-2636.149] (-2638.681) (-2647.657) (-2639.272) -- 0:00:20 Average standard deviation of split frequencies: 0.000000 905500 -- [-2642.579] (-2645.416) (-2641.713) (-2641.648) * (-2637.643) (-2638.965) [-2639.382] (-2639.312) -- 0:00:20 906000 -- (-2636.070) (-2639.720) (-2638.382) [-2635.597] * (-2643.824) (-2642.810) (-2641.985) [-2636.973] -- 0:00:19 906500 -- (-2645.557) (-2639.411) (-2634.376) [-2638.703] * (-2644.313) (-2636.459) (-2641.146) [-2639.843] -- 0:00:19 907000 -- (-2635.324) (-2648.973) (-2639.894) [-2636.590] * (-2647.048) (-2644.581) (-2642.283) [-2633.617] -- 0:00:19 907500 -- (-2641.089) [-2638.488] (-2643.793) (-2641.261) * (-2638.262) [-2641.385] (-2641.782) (-2635.823) -- 0:00:19 908000 -- (-2638.832) (-2643.575) (-2642.952) [-2645.270] * (-2644.369) (-2636.069) (-2640.992) [-2635.449] -- 0:00:19 908500 -- (-2642.222) (-2640.863) [-2639.984] (-2638.407) * [-2634.966] (-2647.800) (-2644.886) (-2637.886) -- 0:00:19 909000 -- [-2639.814] (-2638.314) (-2638.536) (-2641.748) * (-2636.952) (-2636.626) (-2641.792) [-2638.239] -- 0:00:19 909500 -- [-2640.865] (-2642.986) (-2645.433) (-2645.111) * (-2635.941) (-2636.575) (-2637.380) [-2638.490] -- 0:00:19 910000 -- (-2636.228) (-2642.219) [-2637.772] (-2642.520) * (-2642.576) (-2641.337) (-2637.499) [-2636.306] -- 0:00:18 Average standard deviation of split frequencies: 0.000000 910500 -- [-2638.977] (-2641.556) (-2638.968) (-2638.515) * (-2640.468) (-2633.336) (-2642.656) [-2644.106] -- 0:00:18 911000 -- (-2641.993) (-2641.890) [-2642.759] (-2640.675) * (-2636.958) (-2644.998) [-2642.636] (-2641.296) -- 0:00:18 911500 -- (-2639.702) (-2653.212) [-2638.526] (-2642.263) * (-2643.282) [-2641.722] (-2638.869) (-2639.021) -- 0:00:18 912000 -- (-2639.347) (-2656.925) [-2638.585] (-2640.257) * (-2641.324) [-2639.576] (-2648.516) (-2635.657) -- 0:00:18 912500 -- (-2648.711) [-2641.671] (-2646.528) (-2641.736) * (-2637.734) (-2642.058) (-2648.566) [-2638.112] -- 0:00:18 913000 -- (-2643.909) (-2636.504) [-2645.534] (-2645.604) * (-2636.993) (-2634.265) (-2640.877) [-2641.937] -- 0:00:18 913500 -- [-2640.185] (-2647.609) (-2638.986) (-2640.682) * (-2643.131) (-2639.045) [-2645.489] (-2635.318) -- 0:00:18 914000 -- [-2640.801] (-2636.387) (-2640.320) (-2641.743) * (-2640.174) (-2642.122) (-2641.469) [-2637.076] -- 0:00:18 914500 -- (-2638.903) (-2640.913) (-2646.166) [-2641.547] * (-2634.711) (-2640.306) [-2639.536] (-2641.746) -- 0:00:18 915000 -- (-2647.888) (-2641.856) (-2652.492) [-2633.833] * [-2639.871] (-2645.724) (-2647.048) (-2638.870) -- 0:00:18 Average standard deviation of split frequencies: 0.000000 915500 -- (-2640.209) (-2651.577) (-2645.370) [-2641.332] * (-2635.592) (-2642.319) [-2640.769] (-2640.033) -- 0:00:17 916000 -- (-2636.582) (-2643.459) (-2644.898) [-2639.371] * (-2640.610) (-2643.474) [-2639.307] (-2638.451) -- 0:00:17 916500 -- [-2643.801] (-2639.887) (-2642.752) (-2636.945) * (-2637.500) (-2639.190) (-2641.425) [-2633.300] -- 0:00:17 917000 -- (-2641.762) [-2640.707] (-2647.547) (-2638.451) * [-2641.480] (-2650.557) (-2643.478) (-2643.809) -- 0:00:17 917500 -- (-2647.033) (-2649.815) [-2642.311] (-2639.015) * (-2657.851) (-2640.341) [-2636.891] (-2642.072) -- 0:00:17 918000 -- (-2641.260) (-2637.526) (-2639.279) [-2637.529] * (-2639.255) (-2646.383) (-2640.875) [-2638.774] -- 0:00:17 918500 -- [-2639.028] (-2641.167) (-2640.107) (-2643.861) * (-2640.272) (-2635.909) (-2647.453) [-2639.047] -- 0:00:17 919000 -- (-2634.470) [-2640.720] (-2644.684) (-2639.335) * [-2640.038] (-2642.122) (-2635.440) (-2640.566) -- 0:00:17 919500 -- [-2640.586] (-2636.035) (-2643.761) (-2642.689) * (-2639.458) [-2636.805] (-2638.819) (-2638.986) -- 0:00:17 920000 -- (-2639.026) [-2641.596] (-2646.035) (-2638.125) * [-2641.929] (-2640.733) (-2633.512) (-2645.988) -- 0:00:16 Average standard deviation of split frequencies: 0.000000 920500 -- (-2637.266) [-2642.622] (-2647.587) (-2643.110) * (-2635.831) (-2639.756) (-2639.758) [-2643.572] -- 0:00:16 921000 -- (-2643.904) (-2646.845) (-2640.655) [-2638.825] * (-2642.646) (-2638.719) [-2635.912] (-2639.104) -- 0:00:16 921500 -- (-2642.393) (-2639.504) (-2634.076) [-2642.532] * (-2641.747) (-2642.380) (-2635.540) [-2638.053] -- 0:00:16 922000 -- [-2643.386] (-2638.969) (-2637.881) (-2644.767) * [-2636.704] (-2637.385) (-2645.993) (-2642.807) -- 0:00:16 922500 -- (-2643.619) (-2643.432) [-2638.493] (-2643.422) * [-2634.931] (-2647.508) (-2639.494) (-2635.720) -- 0:00:16 923000 -- [-2641.330] (-2642.216) (-2642.132) (-2643.235) * [-2635.325] (-2646.501) (-2636.307) (-2638.162) -- 0:00:16 923500 -- [-2646.778] (-2645.999) (-2640.126) (-2643.802) * (-2643.328) (-2638.015) (-2636.373) [-2641.991] -- 0:00:16 924000 -- (-2645.674) (-2643.008) (-2649.801) [-2638.613] * (-2646.060) (-2636.878) [-2639.229] (-2639.100) -- 0:00:16 924500 -- (-2646.412) (-2644.766) (-2650.316) [-2642.960] * (-2643.305) (-2635.891) [-2634.128] (-2644.203) -- 0:00:16 925000 -- [-2641.480] (-2645.319) (-2642.109) (-2643.055) * [-2648.165] (-2640.454) (-2636.385) (-2642.803) -- 0:00:15 Average standard deviation of split frequencies: 0.000000 925500 -- [-2641.441] (-2639.340) (-2642.017) (-2639.105) * (-2649.199) [-2636.668] (-2639.177) (-2637.058) -- 0:00:15 926000 -- (-2640.366) (-2637.137) [-2642.133] (-2641.978) * (-2644.760) [-2639.066] (-2640.864) (-2642.660) -- 0:00:15 926500 -- (-2637.266) [-2641.200] (-2639.820) (-2638.504) * (-2641.879) (-2637.613) (-2643.624) [-2634.764] -- 0:00:15 927000 -- [-2648.717] (-2639.640) (-2646.161) (-2637.829) * (-2638.395) (-2641.753) [-2640.404] (-2648.647) -- 0:00:15 927500 -- [-2641.280] (-2643.657) (-2643.019) (-2635.897) * (-2644.865) (-2637.350) (-2643.708) [-2641.679] -- 0:00:15 928000 -- (-2646.324) (-2638.726) (-2639.095) [-2638.416] * (-2643.862) (-2640.975) (-2638.140) [-2641.001] -- 0:00:15 928500 -- (-2642.021) (-2644.024) (-2635.054) [-2643.873] * (-2641.128) [-2638.842] (-2638.350) (-2636.865) -- 0:00:15 929000 -- (-2641.585) (-2638.464) (-2639.246) [-2638.328] * [-2640.679] (-2640.118) (-2638.755) (-2641.406) -- 0:00:15 929500 -- (-2643.405) (-2640.071) (-2645.651) [-2637.569] * (-2642.628) (-2636.790) (-2635.499) [-2637.640] -- 0:00:14 930000 -- (-2636.639) (-2640.937) (-2640.243) [-2637.727] * (-2641.500) (-2643.967) [-2638.246] (-2643.086) -- 0:00:14 Average standard deviation of split frequencies: 0.000000 930500 -- (-2643.616) (-2639.644) (-2638.455) [-2636.244] * (-2641.817) (-2633.775) [-2638.155] (-2642.504) -- 0:00:14 931000 -- (-2635.408) (-2639.441) (-2637.045) [-2643.522] * (-2644.839) (-2634.965) [-2637.406] (-2643.335) -- 0:00:14 931500 -- (-2636.513) (-2639.748) [-2634.076] (-2644.833) * (-2642.043) [-2634.265] (-2635.902) (-2634.306) -- 0:00:14 932000 -- (-2642.936) [-2643.113] (-2643.190) (-2633.839) * (-2645.497) (-2637.413) (-2642.797) [-2637.927] -- 0:00:14 932500 -- [-2636.884] (-2647.351) (-2643.368) (-2636.435) * (-2645.660) (-2638.754) (-2639.697) [-2638.205] -- 0:00:14 933000 -- (-2637.624) (-2643.524) (-2645.862) [-2639.587] * [-2636.063] (-2634.460) (-2647.350) (-2639.913) -- 0:00:14 933500 -- (-2645.601) [-2640.094] (-2644.796) (-2634.983) * (-2644.325) (-2646.398) (-2642.396) [-2635.722] -- 0:00:14 934000 -- (-2641.526) (-2643.350) (-2639.337) [-2636.267] * (-2643.086) (-2644.281) (-2643.624) [-2636.636] -- 0:00:13 934500 -- (-2638.025) [-2641.901] (-2642.815) (-2640.582) * [-2643.907] (-2640.900) (-2639.519) (-2638.127) -- 0:00:13 935000 -- (-2639.634) [-2641.028] (-2644.357) (-2639.276) * (-2642.157) (-2640.640) (-2639.882) [-2638.745] -- 0:00:13 Average standard deviation of split frequencies: 0.000000 935500 -- [-2638.815] (-2636.985) (-2642.211) (-2641.224) * (-2642.005) (-2641.278) [-2637.910] (-2640.892) -- 0:00:13 936000 -- (-2640.154) [-2637.754] (-2640.204) (-2636.891) * (-2636.063) (-2638.281) [-2638.612] (-2645.768) -- 0:00:13 936500 -- (-2639.551) (-2638.754) (-2635.453) [-2634.865] * (-2638.524) (-2651.416) [-2639.477] (-2634.536) -- 0:00:13 937000 -- (-2636.594) [-2640.923] (-2637.019) (-2643.146) * (-2636.346) (-2641.338) (-2639.386) [-2638.880] -- 0:00:13 937500 -- (-2635.610) [-2645.061] (-2640.553) (-2642.237) * [-2637.077] (-2650.588) (-2635.878) (-2640.403) -- 0:00:13 938000 -- (-2643.373) (-2644.114) [-2640.643] (-2641.685) * (-2647.195) (-2646.984) (-2633.857) [-2636.683] -- 0:00:13 938500 -- [-2642.328] (-2647.265) (-2640.574) (-2641.909) * (-2644.188) (-2648.817) (-2638.510) [-2639.178] -- 0:00:13 939000 -- (-2637.301) (-2637.170) [-2640.559] (-2649.595) * (-2639.767) (-2640.993) (-2636.201) [-2640.558] -- 0:00:12 939500 -- (-2647.219) (-2645.075) [-2638.109] (-2649.127) * (-2635.408) (-2639.382) (-2641.808) [-2640.437] -- 0:00:12 940000 -- (-2636.490) (-2641.053) (-2642.290) [-2643.003] * (-2643.287) [-2635.469] (-2636.452) (-2636.479) -- 0:00:12 Average standard deviation of split frequencies: 0.000000 940500 -- [-2634.740] (-2646.504) (-2647.881) (-2655.935) * (-2638.147) [-2642.300] (-2642.753) (-2636.438) -- 0:00:12 941000 -- (-2641.174) (-2636.869) (-2641.516) [-2641.596] * (-2635.897) (-2636.560) (-2642.903) [-2639.421] -- 0:00:12 941500 -- (-2643.575) [-2636.300] (-2642.759) (-2644.085) * (-2638.319) (-2641.794) (-2639.418) [-2640.038] -- 0:00:12 942000 -- (-2644.877) (-2639.273) [-2643.117] (-2649.406) * (-2635.762) [-2637.265] (-2645.173) (-2641.530) -- 0:00:12 942500 -- (-2646.853) (-2643.942) [-2636.670] (-2646.012) * (-2638.389) [-2635.653] (-2638.665) (-2632.103) -- 0:00:12 943000 -- [-2644.616] (-2637.045) (-2639.935) (-2641.629) * (-2637.197) (-2643.154) (-2649.213) [-2644.900] -- 0:00:12 943500 -- (-2638.846) (-2642.831) (-2640.521) [-2637.905] * [-2638.301] (-2644.618) (-2643.916) (-2648.076) -- 0:00:11 944000 -- (-2638.663) (-2641.934) (-2641.066) [-2638.462] * (-2640.161) (-2636.433) (-2634.926) [-2642.066] -- 0:00:11 944500 -- (-2638.452) (-2643.743) [-2640.447] (-2639.693) * [-2642.220] (-2636.891) (-2641.147) (-2640.801) -- 0:00:11 945000 -- [-2638.808] (-2647.435) (-2640.936) (-2648.551) * [-2636.220] (-2642.401) (-2640.480) (-2637.840) -- 0:00:11 Average standard deviation of split frequencies: 0.000000 945500 -- (-2639.963) [-2638.943] (-2646.714) (-2647.116) * (-2639.785) (-2636.523) (-2641.362) [-2638.454] -- 0:00:11 946000 -- (-2639.671) (-2643.262) (-2640.132) [-2639.027] * (-2634.814) (-2645.953) (-2641.055) [-2636.455] -- 0:00:11 946500 -- (-2640.353) (-2643.377) [-2646.921] (-2640.701) * [-2639.849] (-2639.456) (-2644.179) (-2641.498) -- 0:00:11 947000 -- (-2644.769) (-2640.531) (-2636.001) [-2633.523] * (-2636.113) [-2635.504] (-2650.034) (-2642.711) -- 0:00:11 947500 -- [-2635.206] (-2635.481) (-2637.850) (-2643.303) * [-2636.713] (-2639.502) (-2641.006) (-2641.058) -- 0:00:11 948000 -- (-2642.773) [-2642.802] (-2640.191) (-2638.390) * (-2641.542) (-2644.055) [-2639.515] (-2639.025) -- 0:00:11 948500 -- (-2640.036) (-2639.422) (-2637.000) [-2636.884] * (-2641.835) (-2637.959) [-2643.049] (-2638.059) -- 0:00:10 949000 -- (-2644.617) (-2643.623) [-2639.027] (-2642.620) * (-2641.867) (-2636.360) [-2639.289] (-2635.929) -- 0:00:10 949500 -- [-2639.515] (-2646.368) (-2637.313) (-2640.020) * (-2641.792) [-2643.396] (-2637.604) (-2640.302) -- 0:00:10 950000 -- (-2635.968) (-2643.820) (-2642.483) [-2636.743] * [-2639.841] (-2647.280) (-2638.175) (-2640.495) -- 0:00:10 Average standard deviation of split frequencies: 0.000000 950500 -- [-2637.552] (-2640.249) (-2638.689) (-2638.262) * (-2639.020) (-2645.061) (-2639.336) [-2642.019] -- 0:00:10 951000 -- (-2636.378) [-2640.850] (-2639.699) (-2640.063) * (-2641.072) (-2643.202) [-2642.646] (-2638.722) -- 0:00:10 951500 -- (-2637.525) (-2637.608) (-2638.719) [-2638.536] * (-2639.038) (-2642.585) (-2644.600) [-2644.579] -- 0:00:10 952000 -- (-2638.443) (-2635.394) [-2643.548] (-2634.835) * [-2636.769] (-2636.851) (-2635.586) (-2642.634) -- 0:00:10 952500 -- (-2635.176) (-2643.673) (-2636.796) [-2636.262] * [-2636.838] (-2644.706) (-2638.439) (-2645.796) -- 0:00:10 953000 -- (-2637.355) (-2646.214) (-2638.323) [-2638.527] * (-2644.569) (-2636.221) (-2637.999) [-2646.238] -- 0:00:09 953500 -- [-2647.527] (-2638.849) (-2635.519) (-2639.507) * [-2639.925] (-2646.460) (-2643.674) (-2645.390) -- 0:00:09 954000 -- (-2643.941) (-2638.637) (-2638.049) [-2639.437] * [-2639.982] (-2638.670) (-2640.637) (-2643.257) -- 0:00:09 954500 -- (-2644.326) (-2641.168) (-2638.479) [-2637.150] * (-2642.839) (-2639.169) [-2636.838] (-2644.632) -- 0:00:09 955000 -- (-2636.688) (-2638.137) [-2643.395] (-2646.086) * (-2636.860) [-2644.969] (-2644.348) (-2639.140) -- 0:00:09 Average standard deviation of split frequencies: 0.000000 955500 -- (-2643.044) [-2634.935] (-2641.828) (-2643.389) * (-2638.704) (-2646.183) [-2641.226] (-2638.251) -- 0:00:09 956000 -- (-2643.268) (-2643.922) (-2639.577) [-2640.786] * (-2639.094) [-2645.720] (-2638.632) (-2642.672) -- 0:00:09 956500 -- [-2637.803] (-2638.712) (-2640.810) (-2644.650) * (-2641.647) (-2639.748) [-2637.964] (-2650.091) -- 0:00:09 957000 -- (-2637.460) (-2639.195) [-2636.749] (-2643.673) * (-2636.497) [-2635.914] (-2643.362) (-2636.822) -- 0:00:09 957500 -- (-2641.021) [-2640.654] (-2639.181) (-2638.888) * (-2635.824) (-2640.252) (-2643.337) [-2640.234] -- 0:00:09 958000 -- (-2643.229) [-2639.348] (-2642.272) (-2640.878) * (-2639.796) [-2634.061] (-2640.231) (-2646.521) -- 0:00:08 958500 -- (-2640.180) (-2646.778) [-2644.189] (-2644.287) * [-2639.888] (-2645.625) (-2646.243) (-2645.254) -- 0:00:08 959000 -- (-2642.559) (-2639.013) (-2640.548) [-2633.769] * (-2639.333) (-2646.851) (-2639.621) [-2641.080] -- 0:00:08 959500 -- (-2635.458) (-2638.266) [-2638.028] (-2643.772) * [-2640.264] (-2639.742) (-2637.751) (-2639.480) -- 0:00:08 960000 -- (-2639.493) (-2636.459) (-2640.222) [-2637.105] * (-2636.853) (-2642.646) (-2640.411) [-2635.009] -- 0:00:08 Average standard deviation of split frequencies: 0.000000 960500 -- [-2642.261] (-2639.041) (-2640.347) (-2636.371) * (-2641.390) [-2640.994] (-2636.415) (-2636.647) -- 0:00:08 961000 -- (-2640.517) [-2636.706] (-2641.987) (-2638.688) * [-2637.588] (-2641.691) (-2647.926) (-2637.500) -- 0:00:08 961500 -- (-2641.179) [-2636.440] (-2641.123) (-2640.032) * [-2638.304] (-2650.550) (-2641.924) (-2635.961) -- 0:00:08 962000 -- (-2642.506) (-2641.178) [-2641.501] (-2643.370) * [-2640.318] (-2641.754) (-2640.966) (-2642.429) -- 0:00:08 962500 -- (-2640.521) (-2639.056) (-2640.966) [-2637.752] * (-2643.321) [-2642.060] (-2642.842) (-2642.803) -- 0:00:07 963000 -- (-2636.171) (-2637.169) (-2641.422) [-2634.095] * (-2637.348) [-2641.000] (-2638.540) (-2644.609) -- 0:00:07 963500 -- (-2644.943) [-2634.131] (-2641.772) (-2636.794) * (-2637.305) (-2642.349) [-2638.654] (-2640.448) -- 0:00:07 964000 -- [-2635.680] (-2638.239) (-2640.705) (-2642.141) * (-2641.523) (-2641.832) [-2640.792] (-2639.272) -- 0:00:07 964500 -- [-2644.815] (-2637.386) (-2642.580) (-2645.281) * [-2643.853] (-2656.438) (-2641.697) (-2638.833) -- 0:00:07 965000 -- (-2643.798) (-2638.562) [-2634.777] (-2639.470) * (-2649.445) (-2640.478) (-2636.752) [-2637.750] -- 0:00:07 Average standard deviation of split frequencies: 0.000000 965500 -- [-2647.715] (-2636.633) (-2636.449) (-2647.674) * (-2643.266) (-2636.498) (-2641.350) [-2639.506] -- 0:00:07 966000 -- [-2641.691] (-2639.467) (-2639.381) (-2645.417) * [-2640.105] (-2647.223) (-2637.432) (-2637.517) -- 0:00:07 966500 -- [-2637.525] (-2646.051) (-2644.283) (-2650.353) * (-2644.774) (-2642.088) [-2634.855] (-2636.935) -- 0:00:07 967000 -- [-2636.422] (-2638.883) (-2640.339) (-2645.393) * (-2639.649) (-2637.997) [-2644.068] (-2638.965) -- 0:00:06 967500 -- (-2640.354) [-2636.855] (-2641.069) (-2645.251) * (-2648.215) (-2646.275) (-2635.941) [-2636.386] -- 0:00:06 968000 -- [-2638.020] (-2654.511) (-2637.020) (-2640.094) * (-2650.212) (-2646.455) (-2636.478) [-2639.519] -- 0:00:06 968500 -- (-2638.561) (-2641.500) (-2637.762) [-2640.474] * (-2643.790) [-2634.414] (-2637.683) (-2637.679) -- 0:00:06 969000 -- (-2638.750) [-2633.154] (-2636.612) (-2637.384) * (-2648.445) [-2636.353] (-2640.222) (-2643.542) -- 0:00:06 969500 -- [-2638.230] (-2639.703) (-2636.094) (-2641.941) * (-2643.870) [-2637.631] (-2637.126) (-2634.845) -- 0:00:06 970000 -- (-2649.801) [-2640.372] (-2636.564) (-2640.049) * (-2645.994) (-2639.621) [-2637.729] (-2636.282) -- 0:00:06 Average standard deviation of split frequencies: 0.000000 970500 -- (-2641.825) [-2641.739] (-2636.527) (-2638.418) * (-2639.361) (-2642.204) [-2638.043] (-2636.764) -- 0:00:06 971000 -- (-2642.380) (-2636.973) (-2640.255) [-2642.558] * (-2636.128) (-2640.935) [-2639.895] (-2640.697) -- 0:00:06 971500 -- (-2642.389) (-2641.996) [-2635.749] (-2641.827) * [-2639.857] (-2644.653) (-2637.010) (-2648.628) -- 0:00:06 972000 -- (-2648.495) (-2640.768) [-2643.847] (-2642.689) * [-2641.708] (-2644.644) (-2636.669) (-2639.853) -- 0:00:05 972500 -- (-2639.856) [-2643.933] (-2638.346) (-2637.371) * [-2636.861] (-2643.303) (-2637.427) (-2642.376) -- 0:00:05 973000 -- (-2640.740) [-2642.053] (-2641.856) (-2639.447) * (-2642.309) (-2643.757) [-2639.814] (-2647.277) -- 0:00:05 973500 -- (-2643.984) (-2645.770) [-2635.064] (-2637.885) * (-2643.076) (-2642.413) [-2638.103] (-2642.417) -- 0:00:05 974000 -- (-2639.579) (-2644.165) (-2641.518) [-2643.505] * (-2639.350) (-2647.215) (-2636.473) [-2642.451] -- 0:00:05 974500 -- (-2638.831) [-2645.401] (-2635.084) (-2647.877) * (-2639.943) (-2641.589) (-2637.087) [-2642.568] -- 0:00:05 975000 -- [-2639.342] (-2642.577) (-2635.671) (-2640.445) * (-2640.960) (-2642.665) [-2633.972] (-2640.037) -- 0:00:05 Average standard deviation of split frequencies: 0.000000 975500 -- (-2634.360) (-2641.477) [-2639.672] (-2641.433) * (-2642.696) (-2650.151) [-2637.985] (-2647.352) -- 0:00:05 976000 -- (-2636.761) (-2639.307) [-2643.521] (-2646.647) * (-2636.858) (-2646.282) [-2640.254] (-2644.170) -- 0:00:05 976500 -- (-2640.761) (-2636.701) (-2639.681) [-2639.825] * (-2641.220) (-2642.293) [-2654.214] (-2649.227) -- 0:00:04 977000 -- (-2647.119) (-2651.111) [-2638.092] (-2639.028) * (-2641.763) [-2634.259] (-2645.371) (-2648.714) -- 0:00:04 977500 -- (-2638.201) [-2637.479] (-2639.555) (-2640.585) * (-2643.372) [-2642.634] (-2642.493) (-2654.548) -- 0:00:04 978000 -- (-2651.005) [-2635.875] (-2639.933) (-2636.076) * (-2642.381) (-2644.862) (-2638.646) [-2637.575] -- 0:00:04 978500 -- (-2645.638) (-2644.026) (-2642.990) [-2638.112] * (-2641.462) (-2639.002) (-2645.603) [-2646.840] -- 0:00:04 979000 -- (-2644.299) [-2642.407] (-2639.198) (-2636.086) * (-2639.693) [-2637.156] (-2637.258) (-2644.321) -- 0:00:04 979500 -- (-2640.997) [-2648.089] (-2638.771) (-2637.505) * (-2635.787) (-2638.162) [-2641.884] (-2644.175) -- 0:00:04 980000 -- [-2639.188] (-2653.890) (-2644.950) (-2641.103) * (-2634.048) (-2639.404) (-2641.313) [-2637.270] -- 0:00:04 Average standard deviation of split frequencies: 0.000000 980500 -- (-2639.358) (-2640.383) (-2643.147) [-2642.585] * (-2640.677) [-2640.795] (-2643.115) (-2637.000) -- 0:00:04 981000 -- [-2641.652] (-2637.518) (-2645.433) (-2642.143) * (-2642.354) (-2640.867) [-2639.857] (-2636.346) -- 0:00:04 981500 -- [-2643.905] (-2640.866) (-2637.757) (-2642.874) * (-2642.391) [-2642.168] (-2638.305) (-2634.988) -- 0:00:03 982000 -- (-2641.630) (-2644.731) (-2644.576) [-2639.728] * (-2640.743) (-2636.946) (-2633.827) [-2637.304] -- 0:00:03 982500 -- (-2641.780) [-2643.006] (-2643.021) (-2641.879) * (-2644.004) (-2650.998) (-2637.181) [-2640.980] -- 0:00:03 983000 -- (-2651.644) (-2641.191) [-2634.386] (-2639.548) * [-2634.644] (-2639.610) (-2638.905) (-2640.308) -- 0:00:03 983500 -- [-2634.611] (-2643.647) (-2640.977) (-2643.477) * [-2641.436] (-2645.065) (-2645.154) (-2644.414) -- 0:00:03 984000 -- (-2638.384) (-2639.162) [-2636.335] (-2640.607) * [-2638.465] (-2639.881) (-2641.878) (-2638.471) -- 0:00:03 984500 -- [-2635.742] (-2643.386) (-2643.656) (-2642.757) * (-2642.757) [-2642.226] (-2645.914) (-2641.238) -- 0:00:03 985000 -- (-2641.815) (-2645.103) (-2636.498) [-2642.263] * [-2642.756] (-2643.938) (-2641.885) (-2640.782) -- 0:00:03 Average standard deviation of split frequencies: 0.000000 985500 -- (-2637.688) (-2642.100) [-2637.891] (-2637.605) * [-2643.731] (-2645.150) (-2644.386) (-2641.913) -- 0:00:03 986000 -- (-2637.379) (-2645.659) [-2645.132] (-2641.149) * (-2641.538) (-2645.464) (-2637.793) [-2640.400] -- 0:00:02 986500 -- (-2638.779) (-2654.138) (-2642.324) [-2643.382] * [-2635.939] (-2645.869) (-2639.427) (-2641.800) -- 0:00:02 987000 -- (-2644.342) (-2644.829) (-2649.308) [-2639.700] * [-2644.556] (-2636.462) (-2635.958) (-2637.614) -- 0:00:02 987500 -- (-2640.146) (-2643.591) [-2644.273] (-2643.365) * (-2637.648) [-2634.682] (-2640.852) (-2640.233) -- 0:00:02 988000 -- (-2642.965) (-2651.530) (-2644.272) [-2639.770] * (-2640.200) (-2639.693) (-2644.651) [-2641.490] -- 0:00:02 988500 -- (-2644.952) (-2646.862) [-2644.146] (-2645.892) * (-2641.775) (-2640.255) [-2645.373] (-2642.157) -- 0:00:02 989000 -- (-2642.570) (-2645.241) [-2643.545] (-2644.694) * (-2645.241) [-2635.331] (-2638.986) (-2639.400) -- 0:00:02 989500 -- [-2640.930] (-2654.762) (-2642.121) (-2647.823) * (-2643.637) (-2642.177) (-2638.537) [-2637.412] -- 0:00:02 990000 -- (-2636.312) (-2640.350) (-2648.370) [-2642.085] * [-2639.301] (-2639.668) (-2646.825) (-2644.638) -- 0:00:02 Average standard deviation of split frequencies: 0.000000 990500 -- (-2636.605) (-2645.105) (-2644.858) [-2639.126] * [-2639.049] (-2643.615) (-2645.257) (-2632.444) -- 0:00:02 991000 -- (-2641.316) (-2648.725) (-2641.400) [-2647.652] * (-2638.738) (-2635.168) (-2641.327) [-2644.123] -- 0:00:01 991500 -- (-2637.124) (-2643.403) (-2643.284) [-2635.428] * (-2646.282) (-2636.115) (-2638.452) [-2639.017] -- 0:00:01 992000 -- (-2640.294) [-2639.822] (-2636.635) (-2639.109) * (-2638.622) [-2638.259] (-2641.997) (-2652.981) -- 0:00:01 992500 -- (-2642.157) (-2636.557) (-2643.937) [-2635.540] * (-2638.902) (-2636.963) (-2647.010) [-2647.676] -- 0:00:01 993000 -- (-2639.948) [-2633.290] (-2641.921) (-2637.923) * [-2639.207] (-2641.317) (-2645.938) (-2637.768) -- 0:00:01 993500 -- (-2645.360) (-2637.117) [-2637.120] (-2640.537) * (-2639.280) (-2637.941) (-2647.030) [-2639.475] -- 0:00:01 994000 -- (-2648.788) (-2641.344) (-2643.134) [-2648.170] * [-2641.648] (-2643.305) (-2645.594) (-2641.244) -- 0:00:01 994500 -- (-2646.256) (-2641.735) [-2641.244] (-2637.787) * (-2639.350) (-2632.856) [-2653.963] (-2647.133) -- 0:00:01 995000 -- (-2645.134) (-2642.989) (-2641.124) [-2637.118] * (-2639.422) (-2642.334) (-2639.912) [-2645.505] -- 0:00:01 Average standard deviation of split frequencies: 0.000000 995500 -- (-2651.818) [-2641.527] (-2642.281) (-2636.564) * (-2637.393) (-2639.362) [-2640.010] (-2643.607) -- 0:00:00 996000 -- (-2644.323) (-2640.139) (-2644.738) [-2636.843] * (-2641.182) [-2646.785] (-2648.860) (-2646.730) -- 0:00:00 996500 -- (-2645.212) (-2643.115) [-2640.528] (-2636.436) * (-2649.479) (-2650.501) [-2638.246] (-2639.434) -- 0:00:00 997000 -- (-2641.485) (-2641.500) [-2644.124] (-2638.156) * (-2644.253) (-2647.613) (-2639.842) [-2638.952] -- 0:00:00 997500 -- [-2638.184] (-2636.905) (-2644.741) (-2641.201) * (-2642.924) (-2644.621) [-2639.731] (-2639.511) -- 0:00:00 998000 -- (-2644.613) [-2635.871] (-2641.357) (-2643.960) * (-2639.238) (-2638.809) [-2643.525] (-2649.311) -- 0:00:00 998500 -- (-2642.585) (-2637.373) (-2649.296) [-2642.611] * (-2651.218) (-2640.585) (-2635.661) [-2640.587] -- 0:00:00 999000 -- (-2640.942) [-2638.934] (-2643.691) (-2639.762) * (-2636.436) [-2638.577] (-2638.251) (-2641.899) -- 0:00:00 999500 -- [-2641.400] (-2635.950) (-2641.899) (-2640.538) * (-2639.436) [-2637.750] (-2644.462) (-2637.257) -- 0:00:00 1000000 -- (-2638.160) [-2641.997] (-2637.961) (-2647.926) * (-2641.355) (-2642.250) (-2640.498) [-2638.154] -- 0:00:00 Average standard deviation of split frequencies: 0.000000 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2638.160184 -- 14.073805 Chain 1 -- -2638.160184 -- 14.073805 Chain 2 -- -2641.996980 -- 15.282182 Chain 2 -- -2641.996981 -- 15.282182 Chain 3 -- -2637.960885 -- 12.929933 Chain 3 -- -2637.960884 -- 12.929933 Chain 4 -- -2647.925798 -- 15.371857 Chain 4 -- -2647.925798 -- 15.371857 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2641.355472 -- 14.793371 Chain 1 -- -2641.355472 -- 14.793371 Chain 2 -- -2642.250254 -- 10.353372 Chain 2 -- -2642.250254 -- 10.353372 Chain 3 -- -2640.498287 -- 12.242142 Chain 3 -- -2640.498288 -- 12.242142 Chain 4 -- -2638.153516 -- 15.063796 Chain 4 -- -2638.153516 -- 15.063796 Analysis completed in 3 mins 32 seconds Analysis used 211.66 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2630.56 Likelihood of best state for "cold" chain of run 2 was -2630.59 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 49.5 % ( 30 %) Dirichlet(Revmat{all}) 63.1 % ( 54 %) Slider(Revmat{all}) 24.1 % ( 22 %) Dirichlet(Pi{all}) 26.7 % ( 23 %) Slider(Pi{all}) 67.2 % ( 36 %) Multiplier(Alpha{1,2}) 47.1 % ( 25 %) Multiplier(Alpha{3}) 59.8 % ( 30 %) Slider(Pinvar{all}) 0.0 % ( 0 %) ExtSPR(Tau{all},V{all}) 0.0 % ( 0 %) ExtTBR(Tau{all},V{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 25.9 % ( 23 %) Multiplier(V{all}) 25.4 % ( 24 %) Nodeslider(V{all}) 25.6 % ( 28 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 49.7 % ( 37 %) Dirichlet(Revmat{all}) 63.7 % ( 51 %) Slider(Revmat{all}) 23.6 % ( 30 %) Dirichlet(Pi{all}) 26.6 % ( 29 %) Slider(Pi{all}) 66.8 % ( 38 %) Multiplier(Alpha{1,2}) 47.0 % ( 26 %) Multiplier(Alpha{3}) 58.5 % ( 29 %) Slider(Pinvar{all}) 0.0 % ( 0 %) ExtSPR(Tau{all},V{all}) 0.0 % ( 0 %) ExtTBR(Tau{all},V{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 25.9 % ( 21 %) Multiplier(V{all}) 25.2 % ( 20 %) Nodeslider(V{all}) 25.6 % ( 30 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.84 0.69 0.57 2 | 167117 0.85 0.72 3 | 166912 166020 0.86 4 | 166667 166800 166484 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.84 0.70 0.57 2 | 166705 0.85 0.72 3 | 166806 166142 0.86 4 | 166302 167220 166825 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2638.09 | 1 2 | | 2 1 | | 2 1 1 2 | | 2 2 1 11 2 1 1 22 | | 222 21 1 2 12 | | 2 1 21 2 * 2 21 | | 1 2 2 1 2 2 21 2 * 2 2 * | |2 2* 2 2 1 21 2 2 1 1 2 2 | | 1 12 2 211 1 1 1 11 | | 1 1 21* 22 21 2 1 2 1 | | 1 2 1 1* 1 2 | |1 1 1 1 21| | 1 | | 1 1 2 2 1 2 2| | 1 1 1 2 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2641.15 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2636.47 -2650.76 2 -2636.38 -2648.79 -------------------------------------- TOTAL -2636.42 -2650.20 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.265048 0.001297 0.200728 0.338737 0.263109 1323.43 1412.21 1.000 r(A<->C){all} 0.101834 0.000787 0.050844 0.158733 0.099981 838.79 900.81 1.002 r(A<->G){all} 0.223364 0.001599 0.145480 0.299709 0.221629 966.26 978.66 1.000 r(A<->T){all} 0.153448 0.001533 0.081050 0.227897 0.150388 713.04 841.62 1.000 r(C<->G){all} 0.032116 0.000215 0.007681 0.063461 0.030432 786.92 966.25 1.000 r(C<->T){all} 0.411639 0.002714 0.314381 0.517202 0.409638 917.27 938.56 1.001 r(G<->T){all} 0.077597 0.000553 0.037376 0.127206 0.075162 944.87 1053.66 1.000 pi(A){all} 0.237616 0.000134 0.215239 0.260798 0.237491 1433.11 1446.12 1.000 pi(C){all} 0.259306 0.000153 0.237050 0.284759 0.258952 1157.68 1226.56 1.000 pi(G){all} 0.282081 0.000158 0.255279 0.304790 0.281884 1267.34 1292.21 1.001 pi(T){all} 0.220996 0.000136 0.198676 0.243893 0.220781 1165.01 1246.78 1.002 alpha{1,2} 0.051052 0.001360 0.000146 0.119656 0.044448 1501.00 1501.00 1.000 alpha{3} 2.393420 0.727893 0.950996 4.082431 2.265720 1290.37 1395.69 1.000 pinvar{all} 0.388266 0.008204 0.190037 0.541954 0.398662 1052.75 1157.34 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 Key to taxon bipartitions (saved to file "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ----------- 1 -- .**** 2 -- .*... 3 -- ..*.. 4 -- ...*. 5 -- ....* 6 -- ...** 7 -- .**.. ----------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 6 3002 1.000000 0.000000 1.000000 1.000000 2 7 3002 1.000000 0.000000 1.000000 1.000000 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------ length{all}[1] 0.037567 0.000089 0.021628 0.056737 0.036549 1.000 2 length{all}[2] 0.013614 0.000019 0.006350 0.022448 0.013066 1.000 2 length{all}[3] 0.009057 0.000013 0.002826 0.016075 0.008567 1.002 2 length{all}[4] 0.050604 0.000138 0.030545 0.075352 0.049422 1.000 2 length{all}[5] 0.038162 0.000102 0.018905 0.057299 0.037101 1.000 2 length{all}[6] 0.097878 0.000461 0.061536 0.142056 0.096204 1.000 2 length{all}[7] 0.018166 0.000041 0.006567 0.030902 0.017596 1.001 2 ------------------------------------------------------------------------------------------ + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.000000 Maximum standard deviation of split frequencies = 0.000000 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.002 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------------------------ C2 (2) |----------------100----------------+ + \------------------------------------ C3 (3) | | /------------------------------------ C4 (4) \----------------100----------------+ \------------------------------------ C5 (5) Phylogram (based on average branch lengths): /------------------ C1 (1) | | /------ C2 (2) |--------+ + \---- C3 (3) | | /------------------------ C4 (4) \-----------------------------------------------+ \------------------ C5 (5) |--------| 0.020 expected changes per site Calculating tree probabilities... Credible sets of trees (1 tree sampled): 99 % credible set contains 1 tree Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 5 ls = 1209 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Sequences read.. Counting site patterns.. 0:00 192 patterns at 403 / 403 sites (100.0%), 0:00 Counting codons.. 80 bytes for distance 187392 bytes for conP 26112 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (2, 3), (4, 5)); MP score: 169 281088 bytes for conP, adjusted 0.071319 0.035805 0.030783 0.014614 0.150805 0.093570 0.079526 0.300000 1.300000 ntime & nrate & np: 7 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 9 lnL0 = -2756.923062 Iterating by ming2 Initial: fx= 2756.923062 x= 0.07132 0.03580 0.03078 0.01461 0.15080 0.09357 0.07953 0.30000 1.30000 1 h-m-p 0.0000 0.0055 270.7722 ++++YYCCCCC 2684.444548 6 0.0027 28 | 0/9 2 h-m-p 0.0000 0.0002 966.3957 +YYCYCCC 2661.624460 6 0.0002 50 | 0/9 3 h-m-p 0.0000 0.0001 3193.3707 YCCC 2646.952560 3 0.0001 67 | 0/9 4 h-m-p 0.0001 0.0004 188.1401 CYCCC 2644.772692 4 0.0002 86 | 0/9 5 h-m-p 0.0001 0.0016 225.1883 +YCCCCC 2637.926826 5 0.0006 108 | 0/9 6 h-m-p 0.0002 0.0009 518.0639 +YYYYCCC 2615.734590 6 0.0007 129 | 0/9 7 h-m-p 0.0000 0.0000 12016.3578 +YYCYCCC 2596.409324 6 0.0000 151 | 0/9 8 h-m-p 0.0000 0.0000 7937.4580 CYCYCC 2591.296856 5 0.0000 172 | 0/9 9 h-m-p 0.0052 0.0261 4.3801 YC 2591.242058 1 0.0010 185 | 0/9 10 h-m-p 0.0041 0.1604 1.0706 ++YYYCCCCC 2571.615725 7 0.0755 210 | 0/9 11 h-m-p 0.2813 1.6320 0.2875 YCCCC 2551.303144 4 0.5256 229 | 0/9 12 h-m-p 1.3690 6.8449 0.0505 CCCCC 2546.964197 4 1.9195 258 | 0/9 13 h-m-p 0.8413 5.5582 0.1153 CCCCC 2543.785257 4 1.3965 287 | 0/9 14 h-m-p 1.6000 8.0000 0.0524 YCCC 2542.869264 3 2.4411 313 | 0/9 15 h-m-p 1.6000 8.0000 0.0631 CCC 2542.575870 2 1.5585 338 | 0/9 16 h-m-p 1.6000 8.0000 0.0110 CC 2542.527424 1 2.0814 361 | 0/9 17 h-m-p 1.6000 8.0000 0.0124 +CC 2542.449933 1 5.8700 385 | 0/9 18 h-m-p 1.6000 8.0000 0.0180 YC 2542.386505 1 3.1852 407 | 0/9 19 h-m-p 1.6000 8.0000 0.0068 CC 2542.379977 1 2.1894 430 | 0/9 20 h-m-p 1.6000 8.0000 0.0009 CC 2542.378371 1 1.9367 453 | 0/9 21 h-m-p 1.6000 8.0000 0.0008 CC 2542.377964 1 2.5440 476 | 0/9 22 h-m-p 1.6000 8.0000 0.0006 C 2542.377863 0 1.6607 497 | 0/9 23 h-m-p 1.6000 8.0000 0.0001 C 2542.377859 0 1.3996 518 | 0/9 24 h-m-p 1.6000 8.0000 0.0000 Y 2542.377859 0 1.1428 539 | 0/9 25 h-m-p 1.6000 8.0000 0.0000 Y 2542.377859 0 0.8925 560 | 0/9 26 h-m-p 1.6000 8.0000 0.0000 ----C 2542.377859 0 0.0016 585 Out.. lnL = -2542.377859 586 lfun, 586 eigenQcodon, 4102 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, (2, 3), (4, 5)); MP score: 169 0.071319 0.035805 0.030783 0.014614 0.150805 0.093570 0.079526 2.107129 0.573207 0.492243 ntime & nrate & np: 7 2 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 6.020588 np = 10 lnL0 = -2602.809741 Iterating by ming2 Initial: fx= 2602.809741 x= 0.07132 0.03580 0.03078 0.01461 0.15080 0.09357 0.07953 2.10713 0.57321 0.49224 1 h-m-p 0.0000 0.0063 100.6881 ++YYCCC 2601.718405 4 0.0003 23 | 0/10 2 h-m-p 0.0001 0.0014 289.2635 +YCYYCCC 2585.766063 6 0.0010 47 | 0/10 3 h-m-p 0.0000 0.0001 4049.6039 +YYCCCC 2573.448839 5 0.0000 69 | 0/10 4 h-m-p 0.0000 0.0001 1550.8160 YYYC 2572.432868 3 0.0000 85 | 0/10 5 h-m-p 0.0003 0.0013 47.2357 YCC 2572.296384 2 0.0002 101 | 0/10 6 h-m-p 0.0001 0.0023 51.0846 CCC 2572.178775 2 0.0002 118 | 0/10 7 h-m-p 0.0001 0.0013 77.4161 +CCCC 2571.658589 3 0.0005 138 | 0/10 8 h-m-p 0.0001 0.0004 158.0655 YCCC 2571.394383 3 0.0001 156 | 0/10 9 h-m-p 0.0028 0.0348 8.1552 CYC 2571.350372 2 0.0008 172 | 0/10 10 h-m-p 0.0072 3.5962 30.2297 +YCYCCC 2562.248902 5 0.0527 194 | 0/10 11 h-m-p 0.1234 0.6171 1.4497 ++ 2550.315972 m 0.6171 207 | 0/10 12 h-m-p 0.0554 0.2768 2.2714 YCYCCC 2546.025765 5 0.1263 228 | 0/10 13 h-m-p 0.1752 1.5849 1.6378 YCCCC 2544.134989 4 0.3872 248 | 0/10 14 h-m-p 1.6000 8.0000 0.1749 CCC 2543.072897 2 1.3225 265 | 0/10 15 h-m-p 0.4202 2.1012 0.0602 YC 2542.719996 1 0.9851 289 | 0/10 16 h-m-p 1.2480 8.0000 0.0476 CYC 2542.561143 2 1.1867 315 | 0/10 17 h-m-p 1.6000 8.0000 0.0112 CCC 2542.352253 2 1.5769 342 | 0/10 18 h-m-p 0.3231 7.6936 0.0545 +CCC 2542.240363 2 1.8277 370 | 0/10 19 h-m-p 1.6000 8.0000 0.0319 CC 2542.178417 1 2.0347 395 | 0/10 20 h-m-p 1.6000 8.0000 0.0086 CC 2542.171389 1 1.7564 420 | 0/10 21 h-m-p 1.6000 8.0000 0.0015 CC 2542.169584 1 1.9331 445 | 0/10 22 h-m-p 1.6000 8.0000 0.0003 C 2542.169533 0 1.5779 468 | 0/10 23 h-m-p 1.6000 8.0000 0.0001 C 2542.169526 0 1.6165 491 | 0/10 24 h-m-p 1.6000 8.0000 0.0000 Y 2542.169526 0 1.1192 514 | 0/10 25 h-m-p 1.6000 8.0000 0.0000 C 2542.169526 0 1.3467 537 | 0/10 26 h-m-p 1.6000 8.0000 0.0000 C 2542.169526 0 1.6000 560 | 0/10 27 h-m-p 1.6000 8.0000 0.0000 C 2542.169526 0 1.6000 583 | 0/10 28 h-m-p 1.6000 8.0000 0.0000 ---C 2542.169526 0 0.0091 609 Out.. lnL = -2542.169526 610 lfun, 1830 eigenQcodon, 8540 P(t) Time used: 0:05 Model 2: PositiveSelection TREE # 1 (1, (2, 3), (4, 5)); MP score: 169 initial w for M2:NSpselection reset. 0.071319 0.035805 0.030783 0.014614 0.150805 0.093570 0.079526 2.111375 0.986220 0.117156 0.463564 2.408838 ntime & nrate & np: 7 3 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.685269 np = 12 lnL0 = -2622.817008 Iterating by ming2 Initial: fx= 2622.817008 x= 0.07132 0.03580 0.03078 0.01461 0.15080 0.09357 0.07953 2.11138 0.98622 0.11716 0.46356 2.40884 1 h-m-p 0.0000 0.0084 120.5496 ++YCCC 2622.090440 3 0.0001 24 | 0/12 2 h-m-p 0.0001 0.0010 123.6618 +YYYYC 2620.084409 4 0.0004 44 | 0/12 3 h-m-p 0.0002 0.0015 316.6800 ++ 2594.021856 m 0.0015 59 | 1/12 4 h-m-p 0.0001 0.0005 689.2310 CCC 2593.409033 2 0.0001 78 | 1/12 5 h-m-p 0.0003 0.0090 162.6663 +CCC 2590.736336 2 0.0014 98 | 1/12 6 h-m-p 0.0036 0.0180 54.4655 YCC 2589.155702 2 0.0027 116 | 1/12 7 h-m-p 0.0035 0.0174 28.7367 CCCC 2587.713288 3 0.0037 137 | 0/12 8 h-m-p 0.0010 0.0073 105.8169 YYCCC 2586.640775 4 0.0004 158 | 0/12 9 h-m-p 0.0008 0.0178 51.5399 ++YYCCCC 2573.052944 5 0.0114 183 | 0/12 10 h-m-p 0.0021 0.0105 32.7317 YCCC 2572.625680 3 0.0014 203 | 0/12 11 h-m-p 0.0012 0.0219 38.6324 +++ 2565.640823 m 0.0219 219 | 1/12 12 h-m-p 0.0023 0.0115 3.9782 ++ 2565.079529 m 0.0115 234 | 2/12 13 h-m-p 0.0711 8.0000 0.4314 +CYCCC 2557.692361 4 0.3699 257 | 1/12 14 h-m-p 0.0027 0.0199 59.2891 CYCC 2557.140093 3 0.0005 287 | 1/12 15 h-m-p 0.0056 0.8724 4.8964 +++YCCCC 2553.297769 4 0.2417 312 | 1/12 16 h-m-p 0.6334 3.1672 1.0003 CYC 2551.779737 2 0.5903 330 | 1/12 17 h-m-p 0.8675 4.3377 0.5407 CCCCC 2549.021668 4 1.1526 353 | 1/12 18 h-m-p 0.4991 2.4956 0.7976 CCCCC 2545.912909 4 0.5618 387 | 1/12 19 h-m-p 0.4938 7.3683 0.9074 CCC 2544.050886 2 0.6116 417 | 1/12 20 h-m-p 1.5107 8.0000 0.3673 YCCC 2543.099704 3 1.0058 448 | 1/12 21 h-m-p 1.4733 8.0000 0.2508 CYC 2542.693792 2 1.3146 477 | 1/12 22 h-m-p 1.2473 8.0000 0.2643 CCC 2542.460232 2 1.5093 507 | 1/12 23 h-m-p 1.1939 8.0000 0.3342 CYC 2542.266268 2 1.3417 536 | 1/12 24 h-m-p 1.6000 8.0000 0.2301 CCC 2542.178544 2 1.3705 566 | 1/12 25 h-m-p 1.6000 8.0000 0.0781 YC 2542.170189 1 0.9703 593 | 1/12 26 h-m-p 1.6000 8.0000 0.0232 C 2542.169796 0 1.3198 619 | 1/12 27 h-m-p 1.6000 8.0000 0.0096 YC 2542.169540 1 3.8753 646 | 1/12 28 h-m-p 1.6000 8.0000 0.0025 Y 2542.169526 0 1.0801 672 | 1/12 29 h-m-p 1.6000 8.0000 0.0002 Y 2542.169526 0 1.0739 698 | 1/12 30 h-m-p 1.6000 8.0000 0.0000 Y 2542.169526 0 1.0743 724 | 1/12 31 h-m-p 1.6000 8.0000 0.0000 -----------C 2542.169526 0 0.0000 761 Out.. lnL = -2542.169526 762 lfun, 3048 eigenQcodon, 16002 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2556.974818 S = -2437.296990 -110.757450 Calculating f(w|X), posterior probabilities of site classes. did 10 / 192 patterns 0:12 did 20 / 192 patterns 0:12 did 30 / 192 patterns 0:12 did 40 / 192 patterns 0:12 did 50 / 192 patterns 0:12 did 60 / 192 patterns 0:12 did 70 / 192 patterns 0:12 did 80 / 192 patterns 0:12 did 90 / 192 patterns 0:12 did 100 / 192 patterns 0:13 did 110 / 192 patterns 0:13 did 120 / 192 patterns 0:13 did 130 / 192 patterns 0:13 did 140 / 192 patterns 0:13 did 150 / 192 patterns 0:13 did 160 / 192 patterns 0:13 did 170 / 192 patterns 0:13 did 180 / 192 patterns 0:13 did 190 / 192 patterns 0:13 did 192 / 192 patterns 0:13 Time used: 0:13 Model 3: discrete TREE # 1 (1, (2, 3), (4, 5)); MP score: 169 0.071319 0.035805 0.030783 0.014614 0.150805 0.093570 0.079526 2.111375 0.331355 0.382499 0.062479 0.155973 0.261158 ntime & nrate & np: 7 4 13 Bounds (np=13): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 13.574177 np = 13 lnL0 = -2542.737487 Iterating by ming2 Initial: fx= 2542.737487 x= 0.07132 0.03580 0.03078 0.01461 0.15080 0.09357 0.07953 2.11138 0.33136 0.38250 0.06248 0.15597 0.26116 1 h-m-p 0.0000 0.0031 69.3143 +YCCC 2542.551791 3 0.0001 24 | 0/13 2 h-m-p 0.0001 0.0013 51.8017 CC 2542.389343 1 0.0002 42 | 0/13 3 h-m-p 0.0002 0.0015 54.5625 +YYC 2541.955659 2 0.0006 61 | 0/13 4 h-m-p 0.0003 0.0016 35.5442 YCC 2541.911480 2 0.0001 80 | 0/13 5 h-m-p 0.0003 0.0042 14.0321 YC 2541.894933 1 0.0002 97 | 0/13 6 h-m-p 0.0007 0.0097 4.9167 CC 2541.888646 1 0.0006 115 | 0/13 7 h-m-p 0.0006 0.0082 4.8284 +YC 2541.874334 1 0.0022 133 | 0/13 8 h-m-p 0.0003 0.0015 19.6023 +CC 2541.847905 1 0.0010 152 | 0/13 9 h-m-p 0.0003 0.0017 6.0718 YC 2541.846294 1 0.0003 169 | 0/13 10 h-m-p 0.0030 0.0270 0.5290 ++ 2541.839369 m 0.0270 185 | 1/13 11 h-m-p 0.0013 0.0461 10.5737 CC 2541.826415 1 0.0019 216 | 1/13 12 h-m-p 0.7141 8.0000 0.0277 CC 2541.819789 1 1.0222 234 | 1/13 13 h-m-p 0.2327 8.0000 0.1217 YC 2541.817940 1 0.1644 263 | 1/13 14 h-m-p 0.8507 8.0000 0.0235 +Y 2541.814640 0 3.4027 292 | 1/13 15 h-m-p 1.6000 8.0000 0.0082 YC 2541.814162 1 1.2437 321 | 1/13 16 h-m-p 1.6000 8.0000 0.0030 +Y 2541.814029 0 5.3763 350 | 1/13 17 h-m-p 1.6000 8.0000 0.0088 Y 2541.814005 0 0.9490 378 | 1/13 18 h-m-p 1.6000 8.0000 0.0007 Y 2541.814005 0 0.8565 406 | 1/13 19 h-m-p 1.6000 8.0000 0.0001 Y 2541.814005 0 0.8680 434 | 1/13 20 h-m-p 1.6000 8.0000 0.0000 Y 2541.814005 0 0.7856 462 | 1/13 21 h-m-p 1.6000 8.0000 0.0000 --------Y 2541.814005 0 0.0000 498 Out.. lnL = -2541.814005 499 lfun, 1996 eigenQcodon, 10479 P(t) Time used: 0:17 Model 7: beta TREE # 1 (1, (2, 3), (4, 5)); MP score: 169 0.071319 0.035805 0.030783 0.014614 0.150805 0.093570 0.079526 2.109178 0.665673 1.549129 ntime & nrate & np: 7 1 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 10.170538 np = 10 lnL0 = -2555.568412 Iterating by ming2 Initial: fx= 2555.568412 x= 0.07132 0.03580 0.03078 0.01461 0.15080 0.09357 0.07953 2.10918 0.66567 1.54913 1 h-m-p 0.0000 0.0180 83.7092 +YCCC 2555.279775 3 0.0001 21 | 0/10 2 h-m-p 0.0001 0.0013 72.0678 +YCC 2554.789086 2 0.0003 38 | 0/10 3 h-m-p 0.0001 0.0050 140.0446 ++YYYYYYYYYC 2546.407923 9 0.0024 62 | 0/10 4 h-m-p 0.0003 0.0014 273.5961 YCCCCC 2544.631671 5 0.0003 84 | 0/10 5 h-m-p 0.0003 0.0013 51.1881 YCCC 2544.525372 3 0.0002 102 | 0/10 6 h-m-p 0.0003 0.0108 30.8522 CCC 2544.448257 2 0.0003 119 | 0/10 7 h-m-p 0.0008 0.0287 10.7230 CC 2544.391047 1 0.0012 134 | 0/10 8 h-m-p 0.0007 0.0460 19.5571 +YCCC 2543.958475 3 0.0059 153 | 0/10 9 h-m-p 0.0004 0.0060 286.4973 +YCCC 2542.847302 3 0.0010 172 | 0/10 10 h-m-p 0.3328 2.7509 0.9006 YCCC 2542.718502 3 0.2068 190 | 0/10 11 h-m-p 1.0725 5.9271 0.1736 YCCC 2542.511881 3 0.7302 218 | 0/10 12 h-m-p 1.0964 8.0000 0.1157 +YCC 2542.327424 2 5.1136 245 | 0/10 13 h-m-p 1.3642 8.0000 0.4335 YCCC 2542.070030 3 2.2847 273 | 0/10 14 h-m-p 1.6000 8.0000 0.4315 CCC 2541.956514 2 2.3069 300 | 0/10 15 h-m-p 1.6000 8.0000 0.4386 YCC 2541.900391 2 2.4264 326 | 0/10 16 h-m-p 1.6000 8.0000 0.4156 CCC 2541.880966 2 1.9368 353 | 0/10 17 h-m-p 1.6000 8.0000 0.2911 CY 2541.875087 1 1.7823 378 | 0/10 18 h-m-p 1.6000 8.0000 0.1540 CC 2541.872960 1 1.8737 403 | 0/10 19 h-m-p 1.6000 8.0000 0.0280 YC 2541.871086 1 3.1946 427 | 0/10 20 h-m-p 0.6958 8.0000 0.1283 +YC 2541.869605 1 2.2293 452 | 0/10 21 h-m-p 1.6000 8.0000 0.0897 Y 2541.869513 0 1.1399 475 | 0/10 22 h-m-p 1.6000 8.0000 0.0014 Y 2541.869513 0 0.9335 498 | 0/10 23 h-m-p 1.6000 8.0000 0.0003 Y 2541.869513 0 0.9258 521 | 0/10 24 h-m-p 1.6000 8.0000 0.0000 Y 2541.869513 0 0.4000 544 | 0/10 25 h-m-p 1.6000 8.0000 0.0000 -C 2541.869513 0 0.1000 568 Out.. lnL = -2541.869513 569 lfun, 6259 eigenQcodon, 39830 P(t) Time used: 0:35 Model 8: beta&w>1 TREE # 1 (1, (2, 3), (4, 5)); MP score: 169 initial w for M8:NSbetaw>1 reset. 0.071319 0.035805 0.030783 0.014614 0.150805 0.093570 0.079526 2.108956 0.900000 0.401601 1.403915 2.022819 ntime & nrate & np: 7 2 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 8.685446 np = 12 lnL0 = -2564.478385 Iterating by ming2 Initial: fx= 2564.478385 x= 0.07132 0.03580 0.03078 0.01461 0.15080 0.09357 0.07953 2.10896 0.90000 0.40160 1.40392 2.02282 1 h-m-p 0.0000 0.0006 226.3158 ++YCCC 2556.746283 3 0.0003 24 | 0/12 2 h-m-p 0.0000 0.0001 403.5345 ++ 2550.664147 m 0.0001 39 | 1/12 3 h-m-p 0.0001 0.0007 164.9948 +YYYYCCCC 2545.648398 7 0.0004 65 | 1/12 4 h-m-p 0.0002 0.0008 103.4778 CCCCC 2544.941346 4 0.0002 88 | 1/12 5 h-m-p 0.0003 0.0016 59.4826 YC 2544.742304 1 0.0002 104 | 1/12 6 h-m-p 0.0001 0.0040 82.5454 +CCCC 2543.964018 3 0.0006 126 | 1/12 7 h-m-p 0.0012 0.0062 37.0435 YCC 2543.736080 2 0.0005 144 | 1/12 8 h-m-p 0.0045 0.0456 4.4005 CC 2543.726937 1 0.0009 161 | 1/12 9 h-m-p 0.0008 0.3795 5.9607 +++CCC 2543.189858 2 0.0576 183 | 1/12 10 h-m-p 0.0007 0.0042 462.5253 YC 2542.932529 1 0.0004 199 | 1/12 11 h-m-p 0.1298 2.5166 1.2701 CCCC 2542.768768 3 0.2085 220 | 1/12 12 h-m-p 0.4483 8.0000 0.5907 +CC 2542.281805 1 2.0266 238 | 1/12 13 h-m-p 1.6000 8.0000 0.5698 CYC 2542.086507 2 1.4009 267 | 1/12 14 h-m-p 1.5669 8.0000 0.5094 YC 2541.991735 1 1.2475 294 | 1/12 15 h-m-p 1.0332 8.0000 0.6151 YCCC 2541.916832 3 2.0494 325 | 1/12 16 h-m-p 1.6000 8.0000 0.5968 CC 2541.887156 1 1.2761 353 | 1/12 17 h-m-p 1.6000 8.0000 0.4486 CYC 2541.875458 2 1.7834 382 | 1/12 18 h-m-p 1.6000 8.0000 0.2780 C 2541.872903 0 1.6000 408 | 1/12 19 h-m-p 1.6000 8.0000 0.0992 C 2541.872477 0 1.6512 434 | 1/12 20 h-m-p 1.6000 8.0000 0.0174 +Y 2541.871964 0 5.3889 461 | 1/12 21 h-m-p 1.3477 8.0000 0.0695 YC 2541.871488 1 2.3029 488 | 1/12 22 h-m-p 1.6000 8.0000 0.0382 Y 2541.871474 0 0.9879 514 | 1/12 23 h-m-p 1.6000 8.0000 0.0024 Y 2541.871474 0 1.0997 540 | 1/12 24 h-m-p 1.6000 8.0000 0.0001 ++ 2541.871473 m 8.0000 566 | 1/12 25 h-m-p 0.0416 8.0000 0.0165 +++Y 2541.871466 0 2.2477 595 | 1/12 26 h-m-p 1.6000 8.0000 0.0205 ++ 2541.871396 m 8.0000 621 | 1/12 27 h-m-p 0.0329 8.0000 4.9893 --------------.. | 1/12 28 h-m-p 0.0002 0.1243 0.2387 C 2541.871394 0 0.0001 674 | 1/12 29 h-m-p 0.0007 0.3253 0.1659 Y 2541.871393 0 0.0001 700 | 1/12 30 h-m-p 0.0130 6.4766 0.0477 --C 2541.871393 0 0.0003 728 | 1/12 31 h-m-p 0.0160 8.0000 0.0245 --Y 2541.871393 0 0.0004 756 | 1/12 32 h-m-p 0.0047 2.3494 0.0523 -C 2541.871393 0 0.0002 783 | 1/12 33 h-m-p 0.0160 8.0000 0.0525 Y 2541.871392 0 0.0025 809 | 1/12 34 h-m-p 0.0105 5.2305 0.2732 Y 2541.871388 0 0.0017 835 | 1/12 35 h-m-p 0.0136 4.5104 0.0344 --C 2541.871388 0 0.0003 863 | 1/12 36 h-m-p 0.0160 8.0000 0.0058 +C 2541.871387 0 0.0927 890 | 1/12 37 h-m-p 1.1076 8.0000 0.0005 ++ 2541.871385 m 8.0000 916 | 1/12 38 h-m-p 0.0197 8.0000 0.1958 +++C 2541.871329 0 1.2638 945 | 1/12 39 h-m-p 1.6000 8.0000 0.0122 C 2541.871321 0 1.9058 971 | 1/12 40 h-m-p 1.6000 8.0000 0.0073 ++ 2541.871311 m 8.0000 997 | 1/12 41 h-m-p 0.1392 7.5830 0.4179 ++C 2541.871171 0 2.4193 1025 | 1/12 42 h-m-p 0.7915 3.9573 0.5383 ++ 2541.870651 m 3.9573 1051 | 2/12 43 h-m-p 0.3358 8.0000 0.4879 +YC 2541.869618 1 0.9216 1079 | 2/12 44 h-m-p 1.6000 8.0000 0.0063 Y 2541.869617 0 0.9787 1104 | 2/12 45 h-m-p 1.6000 8.0000 0.0008 Y 2541.869617 0 0.9191 1129 | 2/12 46 h-m-p 1.6000 8.0000 0.0000 ---C 2541.869617 0 0.0063 1157 | 2/12 47 h-m-p 0.2880 8.0000 0.0000 -----------Y 2541.869617 0 0.0000 1193 Out.. lnL = -2541.869617 1194 lfun, 14328 eigenQcodon, 91938 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2553.866283 S = -2437.412004 -108.750254 Calculating f(w|X), posterior probabilities of site classes. did 10 / 192 patterns 1:14 did 20 / 192 patterns 1:14 did 30 / 192 patterns 1:15 did 40 / 192 patterns 1:15 did 50 / 192 patterns 1:15 did 60 / 192 patterns 1:15 did 70 / 192 patterns 1:15 did 80 / 192 patterns 1:16 did 90 / 192 patterns 1:16 did 100 / 192 patterns 1:16 did 110 / 192 patterns 1:16 did 120 / 192 patterns 1:16 did 130 / 192 patterns 1:17 did 140 / 192 patterns 1:17 did 150 / 192 patterns 1:17 did 160 / 192 patterns 1:17 did 170 / 192 patterns 1:17 did 180 / 192 patterns 1:18 did 190 / 192 patterns 1:18 did 192 / 192 patterns 1:18 Time used: 1:18 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=403 D_melanogaster_CG31344-PA MQVDGCTSSSSEIPHPAKRETWISGKMQSSSHSKDGHNAAGASKLLQDHQ D_sechellia_CG31344-PA MQVDGCTSSSSEIPHPANRESWNSVKMQSSSHSKDGHNGVGATKLLQDHQ D_simulans_CG31344-PA MQVDGCTSSSSEIPHPTNRETWNSVKMQSSSHSKDGHNGVGATKLLQDHQ D_yakuba_CG31344-PA MQVDSCTSNSSEIPDPTKREAWNSGKMQSSPHSKDGHNAAGASKLVQDQQ D_erecta_CG31344-PA MQVDSCASSSSEIPNHTKRETWNSGKMQSSPHSKDGHNAAGASKLVQDQQ ****.*:*.*****. ::**:* * *****.*******..**:**:**:* D_melanogaster_CG31344-PA EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA D_sechellia_CG31344-PA EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA D_simulans_CG31344-PA EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA D_yakuba_CG31344-PA AAEDYLEHLMTKGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA D_erecta_CG31344-PA AAEDYLQHLMTEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA .****:***.:**********************:*************** D_melanogaster_CG31344-PA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI D_sechellia_CG31344-PA GMLAGLIAVLAIPSILRVLSCTRQSWTAFTAYRRYVRTIFHTQAWYNYNI D_simulans_CG31344-PA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI D_yakuba_CG31344-PA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI D_erecta_CG31344-PA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ************************* *********************:** D_melanogaster_CG31344-PA ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT D_sechellia_CG31344-PA ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT D_simulans_CG31344-PA ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT D_yakuba_CG31344-PA ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT D_erecta_CG31344-PA ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT ***************************:********************** D_melanogaster_CG31344-PA MGAHRIKLKDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI D_sechellia_CG31344-PA MGAHRIKLNDQVFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI D_simulans_CG31344-PA MGAHRIKLNDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI D_yakuba_CG31344-PA MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICARNWAESKLRLDI D_erecta_CG31344-PA MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI ********:* *************************.************ D_melanogaster_CG31344-PA VMRKVYEPALANTGEDFKRMTEALINGLWHINTMLSVNANIFFAKRLACV D_sechellia_CG31344-PA VMRKVYEPALANTDEEFNRMTEALINGLWHMNTMLSVNANIFFAKRLACV D_simulans_CG31344-PA VMRKVYEPALANTDEEFNRMTKALINGLWHMNTMLSVNANIFFAKRLACV D_yakuba_CG31344-PA VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV D_erecta_CG31344-PA VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV **********:**.*:* ***:********:******************* D_melanogaster_CG31344-PA KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL D_sechellia_CG31344-PA KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFIVTYLHRYAL D_simulans_CG31344-PA KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRLIVSYGLFLVTYLHRYAL D_yakuba_CG31344-PA KGYEYFSFDHENGVERDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL D_erecta_CG31344-PA KGYEYYSFDHENGVEQDPQQKLHYYDMGWWDRFVVSYGLFLVTYLHKYAL *****:******** :****************::******:*****:*** D_melanogaster_CG31344-PA VRWYLNFRVWLVDIFTYYLPYVAIWKFGPKSAYVRIFRNGGEAQDFALGL D_sechellia_CG31344-PA VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL D_simulans_CG31344-PA VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL D_yakuba_CG31344-PA VRWYFNFRIWLGDVLTYYLPYVAIWKFGPKFAYVRIFRKGGEAQDFTSGL D_erecta_CG31344-PA VRWYFNFRVWLVDVLTYYLPYVAIWKFGPRFAYVRIFRKGGEAQDFTSGL ****:***:** *::**************: *******:*******: ** D_melanogaster_CG31344-PA KDD D_sechellia_CG31344-PA KDD D_simulans_CG31344-PA KDD D_yakuba_CG31344-PA KDD D_erecta_CG31344-PA KDD ***
>D_melanogaster_CG31344-PA ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCGC GAAGCGTGAAACGTGGATCAGTGGGAAAATGCAGTCGTCATCGCATTCCA AAGATGGTCATAATGCAGCGGGGGCTTCAAAACTGCTTCAGGATCACCAG GAGCCCGAGGACTACTTGGAGCACCTAATGAAGGAGGGCAGTCAGGAGGG CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT TCAGGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTTGTAATGAACGCC GGAATGCTGGCTGGTCTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCCTACCGTC GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAACATC GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC CCACAGCCGCTCCAGTCATGCGTGCGCCCGCCAAGGAGCTGGACAGATCA CCCAGAAGGATTTGGCGCTCACGCAGTTCGGTTTCATTGGCTTCATAACG ATGGGCGCACATCGCATAAAGCTGAAAGATCAGGACTTCCTGGAGGCCAC TACGCATATGTGGCGCGTTCTCGGCTATCTGCTGGGCATCAAGGATGAGT ACAACATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTCCGCCTGGACATT GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGGGGAGGATTT CAAACGAATGACCGAGGCCCTGATTAATGGCTTGTGGCACATAAACACCA TGCTGTCGGTGAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTT AAGGGATACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGACCGATTCA TAGTCAGCTACGGCCTGTTCCTCGTCACATATCTGCACAGGTATGCCCTG GTGCGATGGTACTTGAACTTCCGCGTCTGGCTGGTGGACATATTCACCTA TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCGTATG TGCGGATTTTCAGGAATGGCGGGGAAGCCCAAGACTTTGCCCTGGGCTTG AAGGACGAT >D_sechellia_CG31344-PA ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCGC AAATCGTGAATCGTGGAACAGTGTGAAAATGCAGTCGTCGTCGCATTCCA AAGATGGTCATAATGGAGTGGGGGCTACCAAACTGCTCCAGGATCACCAG GAGCCCGAGGACTACTTGGAGCACCTGATGAAGGAGGGCAGTCAGGAGGG CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT TCAAGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTCGTAATGAACGCC GGAATGCTGGCTGGACTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG GGTGCTGTCGTGCACACGCCAATCCTGGACAGCGTTCACTGCCTACCGTC GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACTACAACATC GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC CCACAGCCGCTCCAGTCATGCGTGCGCCCGTCAAGGAGCTGGACAGATCA CCCAGAAGGATTTGGCCCTCACACAGTTCGGTTTCATTGGTTTCATAACG ATGGGCGCTCATCGCATAAAGCTGAACGATCAGGTCTTTCTGGAGGCCAC TACGCATATGTGGCGCGTTCTTGGCTATCTGCTGGGCATCAAGGATGAGT ACAATATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTTCGCCTCGACATT GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGATGAGGAATT CAACCGAATGACCGAGGCTCTGATTAATGGCTTGTGGCACATGAACACCA TGCTGTCGGTAAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTC AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGATCGATTCA TAGTCAGCTACGGCCTGTTCATCGTCACATATCTGCACAGGTACGCCCTG GTGCGATGGTACTTGAACTTCCGTGTCTGGCTGGTGGACATACTCACATA TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCGTATG TGCGGATCTTCAGGAAAGGCGGGGAGGCTCAAGACTTTGCACTGGGCTTA AAGGACGAT >D_simulans_CG31344-PA ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCAC AAATCGTGAAACGTGGAACAGTGTGAAAATGCAGTCGTCGTCGCATTCCA AAGATGGTCATAATGGAGTGGGGGCTACCAAACTGCTCCAAGATCACCAG GAGCCCGAGGACTACTTGGAGCACCTGATGAAGGAGGGCAGTCAGGAGGG CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT TCAAGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTCGTAATGAACGCC GGAATGCTGGCTGGACTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG TGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACTGCCTACCGTC GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAACATC GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC CCACAGCCGCTCCAGTCATGCGTGCGCCCGACAAGGAGCTGGACAGATCA CCCAGAAGGATTTGGCCCTCACACAGTTCGGTTTCATTGGCTTCATAACG ATGGGCGCTCATCGCATAAAGCTGAACGATCAGGACTTCCTGGAGGCCAC TACGCATATGTGGCGCGTTCTTGGCTATCTGCTGGGCATCAAGGATGAGT ACAATATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTTCGCCTCGACATT GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGATGAGGAATT CAACCGAATGACCAAGGCTCTGATTAATGGCTTGTGGCACATGAACACCA TGCTGTCGGTAAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTC AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGATCGATTAA TAGTCAGCTACGGCCTGTTCCTCGTCACATATCTGCACAGGTACGCCCTG GTGCGATGGTACTTGAACTTCCGTGTCTGGCTGGTGGACATACTCACATA TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCTTATG TGCGGATCTTCAGGAAAGGCGGGGAGGCCCAAGATTTTGCCCTGGGCTTG AAGGACGAT >D_yakuba_CG31344-PA ATGCAGGTTGATAGTTGCACCAGCAACTCATCTGAGATCCCCGACCCCAC AAAGCGTGAAGCGTGGAACAGTGGGAAAATGCAGTCGTCGCCGCATTCCA AAGATGGTCATAATGCAGCGGGGGCTAGCAAACTGGTCCAGGATCAGCAG GCAGCCGAGGACTACCTGGAGCACCTGATGACGAAGGGCAGTCAGGAGGG CGACAGTGGGGCAGACTTGGAACTACCTTCATGGTACGATGAGCAGCTAT TCAGGCGTGGTCAGAGCTACTTCAGCACGTATCGCTTCGTAATGAACGCC GGAATGCTGGCCGGTCTTATAGCTGTTCTGGCTATTCCCTCTATTCTACG GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCATACCGTC GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAATATC GCGGACCGTGGGAGCAGGTTTTGGACCAGTATTGCGGCCGTGAGACGGGC CCACAGCCGCTCCAGTCATGCTTGCGCCCGCAAAGGAGCTGGACAGATAA CCCAGAAAGATTTGGCCCTCACACAGTTCGGATTTATTGGCTTCATAACG ATGGGCGCTCATCGCATAAAGCTGAACGATCCGGACTTCCTAGAGGCCAC GACGCATATGTGGCGCGTTCTCGGTTATCTGCTGGGCATCAAGGATGAGT ACAACATCTGCGCAAGGAACTGGGCGGAATCAAAGCTTCGCCTGGACATT GTGATGCGAAAGGTATACGAACCAGCTTTGACAAACACTGGTGAGGACTT CTACCGAATGACCGAGGCCTTGATTAATGGATTGTGGCACATGAACACCA TGCTTTCGGTAAACGCCAACATATTCTTCGCCAAGCGATTGGCCTGCGTT AAGGGCTACGAGTACTTCAGTTTCGATCATGAAAACGGCGTGGAACGGGA TCCCCAGCAGAAACTGCACTACTACGACATGGGATGGTGGGATCGTTTCA TAGTCAGCTACGGCCTGTTCCTTGTCACATATCTGCACAGGTACGCCCTG GTGCGATGGTATTTCAACTTCCGCATCTGGCTGGGTGACGTACTGACCTA TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCAAAGTTCGCGTATG TGCGGATCTTCAGGAAGGGAGGGGAGGCCCAAGATTTTACCTCGGGCTTG AAGGACGAT >D_erecta_CG31344-PA ATGCAGGTGGATAGTTGCGCAAGCAGCTCATCTGAGATCCCCAACCACAC AAAACGTGAAACGTGGAACAGTGGGAAAATGCAGTCGTCGCCGCATTCCA AAGATGGTCATAATGCAGCGGGGGCTAGCAAACTGGTCCAGGATCAGCAG GCAGCCGAGGACTACTTGCAGCACCTGATGACGGAGGGCAGTCAGGAGGG CGACAGCGGGGCTGACTTGGAGCTACCTTCATGGTACGATGAGCAGCTAT TCAGGCGTGGTCAGAGCTATTTCAGCACGTATCGCTTCGTAATGAACGCC GGAATGCTGGCTGGTCTAATAGCCGTGCTGGCTATTCCCTCTATTCTTCG GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCCTACCGTC GCTATGTGCGCACTATATTCCACACGCAAGCCTGGTATAACCACAACATC GCGGACCGTGGGAGCAGGTTCTGGACCAGTATTGCGGCCGTGAGGCGGGC CCACAGCCGCTCCAGTCATGCGTGCGCTCGCAAAGGAGCTGGACAGATCA CCCAGAAAGATTTGGCTCTCACACAATTTGGATTCATTGGCTTTATAACG ATGGGCGCTCATCGCATAAAGCTTAACGATCCAGACTTCCTGGAGGCCAC GACGCATATGTGGCGCGTTCTCGGCTATCTGCTGGGCATCAAGGATGAGT ACAATATCTGCGGAAGGAACTGGGCGGAATCAAAGCTTCGCCTGGACATT GTGATGCGAAAAGTATATGAACCAGCTCTGACAAACACTGGTGAGGATTT TTACCGAATGACCGAGGCCTTGATTAATGGTTTGTGGCACATGAACACTA TGCTTTCGGTAAACGCCAACATATTCTTCGCCAAGCGATTGGCATGTGTC AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGAGCAGGA TCCTCAGCAGAAACTGCACTACTACGACATGGGATGGTGGGATCGTTTCG TAGTCAGCTACGGCCTGTTCCTTGTCACATATCTGCACAAGTACGCCCTG GTGCGATGGTATTTCAACTTCCGCGTCTGGCTGGTGGACGTACTGACCTA TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCAAGGTTCGCGTATG TGCGGATCTTCAGAAAAGGAGGGGAGGCCCAAGATTTTACCTCGGGCTTG AAGGACGAT
>D_melanogaster_CG31344-PA MQVDGCTSSSSEIPHPAKRETWISGKMQSSSHSKDGHNAAGASKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLKDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTGEDFKRMTEALINGLWHINTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL VRWYLNFRVWLVDIFTYYLPYVAIWKFGPKSAYVRIFRNGGEAQDFALGL KDD >D_sechellia_CG31344-PA MQVDGCTSSSSEIPHPANRESWNSVKMQSSSHSKDGHNGVGATKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSWTAFTAYRRYVRTIFHTQAWYNYNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDQVFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTDEEFNRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFIVTYLHRYAL VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL KDD >D_simulans_CG31344-PA MQVDGCTSSSSEIPHPTNRETWNSVKMQSSSHSKDGHNGVGATKLLQDHQ EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALANTDEEFNRMTKALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRLIVSYGLFLVTYLHRYAL VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL KDD >D_yakuba_CG31344-PA MQVDSCTSNSSEIPDPTKREAWNSGKMQSSPHSKDGHNAAGASKLVQDQQ AAEDYLEHLMTKGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICARNWAESKLRLDI VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYFSFDHENGVERDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL VRWYFNFRIWLGDVLTYYLPYVAIWKFGPKFAYVRIFRKGGEAQDFTSGL KDD >D_erecta_CG31344-PA MQVDSCASSSSEIPNHTKRETWNSGKMQSSPHSKDGHNAAGASKLVQDQQ AAEDYLQHLMTEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV KGYEYYSFDHENGVEQDPQQKLHYYDMGWWDRFVVSYGLFLVTYLHKYAL VRWYFNFRVWLVDVLTYYLPYVAIWKFGPRFAYVRIFRKGGEAQDFTSGL KDD
#NEXUS [ID: 7284912462] begin taxa; dimensions ntax=5; taxlabels D_melanogaster_CG31344-PA D_sechellia_CG31344-PA D_simulans_CG31344-PA D_yakuba_CG31344-PA D_erecta_CG31344-PA ; end; begin trees; translate 1 D_melanogaster_CG31344-PA, 2 D_sechellia_CG31344-PA, 3 D_simulans_CG31344-PA, 4 D_yakuba_CG31344-PA, 5 D_erecta_CG31344-PA ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.03654903,(2:0.01306587,3:0.008566781)1.000:0.01759647,(4:0.04942221,5:0.03710078)1.000:0.0962042); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.03654903,(2:0.01306587,3:0.008566781):0.01759647,(4:0.04942221,5:0.03710078):0.0962042); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2636.47 -2650.76 2 -2636.38 -2648.79 -------------------------------------- TOTAL -2636.42 -2650.20 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.265048 0.001297 0.200728 0.338737 0.263109 1323.43 1412.21 1.000 r(A<->C){all} 0.101834 0.000787 0.050844 0.158733 0.099981 838.79 900.81 1.002 r(A<->G){all} 0.223364 0.001599 0.145480 0.299709 0.221629 966.26 978.66 1.000 r(A<->T){all} 0.153448 0.001533 0.081050 0.227897 0.150388 713.04 841.62 1.000 r(C<->G){all} 0.032116 0.000215 0.007681 0.063461 0.030432 786.92 966.25 1.000 r(C<->T){all} 0.411639 0.002714 0.314381 0.517202 0.409638 917.27 938.56 1.001 r(G<->T){all} 0.077597 0.000553 0.037376 0.127206 0.075162 944.87 1053.66 1.000 pi(A){all} 0.237616 0.000134 0.215239 0.260798 0.237491 1433.11 1446.12 1.000 pi(C){all} 0.259306 0.000153 0.237050 0.284759 0.258952 1157.68 1226.56 1.000 pi(G){all} 0.282081 0.000158 0.255279 0.304790 0.281884 1267.34 1292.21 1.001 pi(T){all} 0.220996 0.000136 0.198676 0.243893 0.220781 1165.01 1246.78 1.002 alpha{1,2} 0.051052 0.001360 0.000146 0.119656 0.044448 1501.00 1501.00 1.000 alpha{3} 2.393420 0.727893 0.950996 4.082431 2.265720 1290.37 1395.69 1.000 pinvar{all} 0.388266 0.008204 0.190037 0.541954 0.398662 1052.75 1157.34 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/110/CG31344-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 5 ls = 403 Codon usage in sequences ---------------------------------------------------------------------------------------------------------------------- Phe TTT 5 5 4 4 5 | Ser TCT 0 0 0 2 2 | Tyr TAT 8 7 7 8 10 | Cys TGT 1 1 1 0 1 TTC 16 15 15 19 17 | TCC 6 6 6 3 3 | TAC 15 17 16 15 14 | TGC 4 4 4 5 4 Leu TTA 0 1 1 0 0 | TCA 4 2 2 3 3 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0 TTG 8 7 8 8 8 | TCG 6 7 7 6 6 | TAG 0 0 0 0 0 | Trp TGG 12 13 12 12 12 ---------------------------------------------------------------------------------------------------------------------- Leu CTT 2 3 3 4 5 | Pro CCT 1 1 1 1 2 | His CAT 7 7 7 6 6 | Arg CGT 6 8 8 6 5 CTC 5 5 6 2 2 | CCC 5 5 5 5 3 | CAC 8 7 8 7 8 | CGC 9 7 7 9 10 CTA 3 2 2 4 3 | CCA 2 2 2 2 3 | Gln CAA 4 4 5 3 4 | CGA 4 4 5 4 4 CTG 18 18 18 16 16 | CCG 1 1 1 2 1 | CAG 14 14 13 13 14 | CGG 3 3 2 4 3 ---------------------------------------------------------------------------------------------------------------------- Ile ATT 9 8 8 7 7 | Thr ACT 3 4 4 2 3 | Asn AAT 4 5 5 3 3 | Ser AGT 4 4 4 7 6 ATC 6 7 6 6 6 | ACC 7 6 6 8 6 | AAC 10 12 12 13 13 | AGC 9 9 9 7 9 ATA 7 6 6 7 5 | ACA 3 5 6 6 6 | Lys AAA 5 4 4 6 9 | Arg AGA 0 0 0 1 1 Met ATG 11 12 12 12 12 | ACG 6 4 5 6 7 | AAG 13 13 14 12 8 | AGG 6 5 5 5 5 ---------------------------------------------------------------------------------------------------------------------- Val GTT 3 2 2 4 1 | Ala GCT 6 9 9 7 9 | Asp GAT 12 13 14 12 13 | Gly GGT 7 7 6 6 5 GTC 4 6 5 4 6 | GCC 16 14 16 16 14 | GAC 10 8 8 11 9 | GGC 12 12 13 10 10 GTA 2 3 3 4 5 | GCA 3 3 1 5 4 | Glu GAA 3 3 3 6 3 | GGA 6 7 7 7 8 GTG 10 11 11 7 10 | GCG 10 7 6 7 7 | GAG 15 16 15 11 14 | GGG 4 2 2 5 5 ---------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_CG31344-PA position 1: T:0.21092 C:0.22829 A:0.25558 G:0.30521 position 2: T:0.27047 C:0.19603 A:0.31762 G:0.21588 position 3: T:0.19355 C:0.35236 A:0.11414 G:0.33995 Average T:0.22498 C:0.25889 A:0.22911 G:0.28701 #2: D_sechellia_CG31344-PA position 1: T:0.21092 C:0.22581 A:0.25806 G:0.30521 position 2: T:0.27543 C:0.18859 A:0.32258 G:0.21340 position 3: T:0.20844 C:0.34739 A:0.11414 G:0.33002 Average T:0.23160 C:0.25393 A:0.23160 G:0.28288 #3: D_simulans_CG31344-PA position 1: T:0.20596 C:0.23077 A:0.26303 G:0.30025 position 2: T:0.27295 C:0.19107 A:0.32506 G:0.21092 position 3: T:0.20596 C:0.35236 A:0.11663 G:0.32506 Average T:0.22829 C:0.25806 A:0.23490 G:0.27874 #4: D_yakuba_CG31344-PA position 1: T:0.21092 C:0.21836 A:0.26799 G:0.30273 position 2: T:0.26799 C:0.20099 A:0.31266 G:0.21836 position 3: T:0.19603 C:0.34739 A:0.14392 G:0.31266 Average T:0.22498 C:0.25558 A:0.24152 G:0.27792 #5: D_erecta_CG31344-PA position 1: T:0.21092 C:0.22084 A:0.26303 G:0.30521 position 2: T:0.26799 C:0.19603 A:0.31762 G:0.21836 position 3: T:0.20596 C:0.33251 A:0.14392 G:0.31762 Average T:0.22829 C:0.24979 A:0.24152 G:0.28040 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 23 | Ser S TCT 4 | Tyr Y TAT 40 | Cys C TGT 4 TTC 82 | TCC 24 | TAC 77 | TGC 21 Leu L TTA 2 | TCA 14 | *** * TAA 0 | *** * TGA 0 TTG 39 | TCG 32 | TAG 0 | Trp W TGG 61 ------------------------------------------------------------------------------ Leu L CTT 17 | Pro P CCT 6 | His H CAT 33 | Arg R CGT 33 CTC 20 | CCC 23 | CAC 38 | CGC 42 CTA 14 | CCA 11 | Gln Q CAA 20 | CGA 21 CTG 86 | CCG 6 | CAG 68 | CGG 15 ------------------------------------------------------------------------------ Ile I ATT 39 | Thr T ACT 16 | Asn N AAT 20 | Ser S AGT 25 ATC 31 | ACC 33 | AAC 60 | AGC 43 ATA 31 | ACA 26 | Lys K AAA 28 | Arg R AGA 2 Met M ATG 59 | ACG 28 | AAG 60 | AGG 26 ------------------------------------------------------------------------------ Val V GTT 12 | Ala A GCT 40 | Asp D GAT 64 | Gly G GGT 31 GTC 25 | GCC 76 | GAC 46 | GGC 57 GTA 17 | GCA 16 | Glu E GAA 18 | GGA 35 GTG 49 | GCG 37 | GAG 71 | GGG 18 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.20993 C:0.22481 A:0.26154 G:0.30372 position 2: T:0.27097 C:0.19454 A:0.31911 G:0.21538 position 3: T:0.20199 C:0.34640 A:0.12655 G:0.32506 Average T:0.22763 C:0.25525 A:0.23573 G:0.28139 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_CG31344-PA D_sechellia_CG31344-PA 0.1723 (0.0212 0.1232) D_simulans_CG31344-PA 0.1602 (0.0190 0.1188) 0.2329 (0.0086 0.0371) D_yakuba_CG31344-PA 0.1233 (0.0394 0.3195) 0.1400 (0.0436 0.3114) 0.1365 (0.0402 0.2946) D_erecta_CG31344-PA 0.1159 (0.0371 0.3203) 0.1461 (0.0424 0.2905) 0.1384 (0.0379 0.2742) 0.0824 (0.0163 0.1974) Model 0: one-ratio TREE # 1: (1, (2, 3), (4, 5)); MP score: 169 lnL(ntime: 7 np: 9): -2542.377859 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.071967 0.040934 0.030492 0.016503 0.155532 0.094421 0.077189 2.107129 0.124957 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.48704 (1: 0.071967, (2: 0.030492, 3: 0.016503): 0.040934, (4: 0.094421, 5: 0.077189): 0.155532); (D_melanogaster_CG31344-PA: 0.071967, (D_sechellia_CG31344-PA: 0.030492, D_simulans_CG31344-PA: 0.016503): 0.040934, (D_yakuba_CG31344-PA: 0.094421, D_erecta_CG31344-PA: 0.077189): 0.155532); Detailed output identifying parameters kappa (ts/tv) = 2.10713 omega (dN/dS) = 0.12496 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.072 933.3 275.7 0.1250 0.0092 0.0739 8.6 20.4 6..7 0.041 933.3 275.7 0.1250 0.0053 0.0420 4.9 11.6 7..2 0.030 933.3 275.7 0.1250 0.0039 0.0313 3.7 8.6 7..3 0.017 933.3 275.7 0.1250 0.0021 0.0170 2.0 4.7 6..8 0.156 933.3 275.7 0.1250 0.0200 0.1597 18.6 44.0 8..4 0.094 933.3 275.7 0.1250 0.0121 0.0970 11.3 26.7 8..5 0.077 933.3 275.7 0.1250 0.0099 0.0793 9.2 21.9 tree length for dN: 0.0625 tree length for dS: 0.5002 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 169 lnL(ntime: 7 np: 10): -2542.169526 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.072294 0.041024 0.030580 0.016549 0.156729 0.094725 0.077522 2.111375 0.982345 0.112828 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.48942 (1: 0.072294, (2: 0.030580, 3: 0.016549): 0.041024, (4: 0.094725, 5: 0.077522): 0.156729); (D_melanogaster_CG31344-PA: 0.072294, (D_sechellia_CG31344-PA: 0.030580, D_simulans_CG31344-PA: 0.016549): 0.041024, (D_yakuba_CG31344-PA: 0.094725, D_erecta_CG31344-PA: 0.077522): 0.156729); Detailed output identifying parameters kappa (ts/tv) = 2.11138 dN/dS (w) for site classes (K=2) p: 0.98235 0.01765 w: 0.11283 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.072 933.2 275.8 0.1285 0.0095 0.0736 8.8 20.3 6..7 0.041 933.2 275.8 0.1285 0.0054 0.0418 5.0 11.5 7..2 0.031 933.2 275.8 0.1285 0.0040 0.0311 3.7 8.6 7..3 0.017 933.2 275.8 0.1285 0.0022 0.0169 2.0 4.6 6..8 0.157 933.2 275.8 0.1285 0.0205 0.1596 19.1 44.0 8..4 0.095 933.2 275.8 0.1285 0.0124 0.0965 11.6 26.6 8..5 0.078 933.2 275.8 0.1285 0.0101 0.0789 9.5 21.8 Time used: 0:05 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 169 lnL(ntime: 7 np: 12): -2542.169526 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.072294 0.041024 0.030580 0.016549 0.156729 0.094725 0.077522 2.111375 0.982345 0.009500 0.112828 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.48942 (1: 0.072294, (2: 0.030580, 3: 0.016549): 0.041024, (4: 0.094725, 5: 0.077522): 0.156729); (D_melanogaster_CG31344-PA: 0.072294, (D_sechellia_CG31344-PA: 0.030580, D_simulans_CG31344-PA: 0.016549): 0.041024, (D_yakuba_CG31344-PA: 0.094725, D_erecta_CG31344-PA: 0.077522): 0.156729); Detailed output identifying parameters kappa (ts/tv) = 2.11138 dN/dS (w) for site classes (K=3) p: 0.98235 0.00950 0.00815 w: 0.11283 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.072 933.2 275.8 0.1285 0.0095 0.0736 8.8 20.3 6..7 0.041 933.2 275.8 0.1285 0.0054 0.0418 5.0 11.5 7..2 0.031 933.2 275.8 0.1285 0.0040 0.0311 3.7 8.6 7..3 0.017 933.2 275.8 0.1285 0.0022 0.0169 2.0 4.6 6..8 0.157 933.2 275.8 0.1285 0.0205 0.1596 19.1 44.0 8..4 0.095 933.2 275.8 0.1285 0.0124 0.0965 11.6 26.6 8..5 0.078 933.2 275.8 0.1285 0.0101 0.0789 9.5 21.8 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG31344-PA) Pr(w>1) post mean +- SE for w 17 A 0.588 1.268 +- 0.465 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.862 0.138 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.958 0.037 0.004 0.001 0.000 0.000 0.000 0.000 0.000 0.000 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.036 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.051 0.912 sum of density on p0-p1 = 1.000000 Time used: 0:13 Model 3: discrete (3 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 169 lnL(ntime: 7 np: 13): -2541.814005 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.072291 0.040863 0.030556 0.016519 0.156681 0.094712 0.077392 2.109178 0.376698 0.244554 0.000001 0.203484 0.203484 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.48901 (1: 0.072291, (2: 0.030556, 3: 0.016519): 0.040863, (4: 0.094712, 5: 0.077392): 0.156681); (D_melanogaster_CG31344-PA: 0.072291, (D_sechellia_CG31344-PA: 0.030556, D_simulans_CG31344-PA: 0.016519): 0.040863, (D_yakuba_CG31344-PA: 0.094712, D_erecta_CG31344-PA: 0.077392): 0.156681); Detailed output identifying parameters kappa (ts/tv) = 2.10918 dN/dS (w) for site classes (K=3) p: 0.37670 0.24455 0.37875 w: 0.00000 0.20348 0.20348 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.072 933.2 275.8 0.1268 0.0094 0.0739 8.7 20.4 6..7 0.041 933.2 275.8 0.1268 0.0053 0.0418 4.9 11.5 7..2 0.031 933.2 275.8 0.1268 0.0040 0.0312 3.7 8.6 7..3 0.017 933.2 275.8 0.1268 0.0021 0.0169 2.0 4.7 6..8 0.157 933.2 275.8 0.1268 0.0203 0.1602 19.0 44.2 8..4 0.095 933.2 275.8 0.1268 0.0123 0.0968 11.5 26.7 8..5 0.077 933.2 275.8 0.1268 0.0100 0.0791 9.4 21.8 Naive Empirical Bayes (NEB) analysis Time used: 0:17 Model 7: beta (10 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 169 lnL(ntime: 7 np: 10): -2541.869513 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.072301 0.040892 0.030561 0.016525 0.156720 0.094717 0.077418 2.108956 1.073231 7.217434 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.48913 (1: 0.072301, (2: 0.030561, 3: 0.016525): 0.040892, (4: 0.094717, 5: 0.077418): 0.156720); (D_melanogaster_CG31344-PA: 0.072301, (D_sechellia_CG31344-PA: 0.030561, D_simulans_CG31344-PA: 0.016525): 0.040892, (D_yakuba_CG31344-PA: 0.094717, D_erecta_CG31344-PA: 0.077418): 0.156720); Detailed output identifying parameters kappa (ts/tv) = 2.10896 Parameters in M7 (beta): p = 1.07323 q = 7.21743 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00896 0.02624 0.04460 0.06475 0.08742 0.11365 0.14518 0.18534 0.24236 0.35108 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.072 933.2 275.8 0.1270 0.0094 0.0739 8.8 20.4 6..7 0.041 933.2 275.8 0.1270 0.0053 0.0418 5.0 11.5 7..2 0.031 933.2 275.8 0.1270 0.0040 0.0312 3.7 8.6 7..3 0.017 933.2 275.8 0.1270 0.0021 0.0169 2.0 4.7 6..8 0.157 933.2 275.8 0.1270 0.0203 0.1602 19.0 44.2 8..4 0.095 933.2 275.8 0.1270 0.0123 0.0968 11.5 26.7 8..5 0.077 933.2 275.8 0.1270 0.0100 0.0791 9.4 21.8 Time used: 0:35 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 169 lnL(ntime: 7 np: 12): -2541.869617 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.072301 0.040892 0.030561 0.016525 0.156721 0.094717 0.077418 2.108960 0.999990 1.073516 7.219818 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.48914 (1: 0.072301, (2: 0.030561, 3: 0.016525): 0.040892, (4: 0.094717, 5: 0.077418): 0.156721); (D_melanogaster_CG31344-PA: 0.072301, (D_sechellia_CG31344-PA: 0.030561, D_simulans_CG31344-PA: 0.016525): 0.040892, (D_yakuba_CG31344-PA: 0.094717, D_erecta_CG31344-PA: 0.077418): 0.156721); Detailed output identifying parameters kappa (ts/tv) = 2.10896 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 1.07352 q = 7.21982 (p1 = 0.00001) w = 1.00000 dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00896 0.02625 0.04461 0.06476 0.08742 0.11365 0.14517 0.18533 0.24234 0.35103 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.072 933.2 275.8 0.1270 0.0094 0.0739 8.8 20.4 6..7 0.041 933.2 275.8 0.1270 0.0053 0.0418 5.0 11.5 7..2 0.031 933.2 275.8 0.1270 0.0040 0.0312 3.7 8.6 7..3 0.017 933.2 275.8 0.1270 0.0021 0.0169 2.0 4.7 6..8 0.157 933.2 275.8 0.1270 0.0203 0.1602 19.0 44.2 8..4 0.095 933.2 275.8 0.1270 0.0123 0.0968 11.5 26.7 8..5 0.077 933.2 275.8 0.1270 0.0100 0.0791 9.4 21.8 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG31344-PA) Pr(w>1) post mean +- SE for w 15 H 0.569 1.065 +- 0.548 17 A 0.715 1.232 +- 0.477 21 T 0.597 1.099 +- 0.537 43 S 0.595 1.095 +- 0.539 268 K 0.556 1.049 +- 0.551 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 0.988 0.012 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.006 0.043 0.110 0.174 0.213 0.226 0.227 ws: 0.989 0.010 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 Time used: 1:18
Model 1: NearlyNeutral -2542.169526 Model 2: PositiveSelection -2542.169526 Model 0: one-ratio -2542.377859 Model 3: discrete -2541.814005 Model 7: beta -2541.869513 Model 8: beta&w>1 -2541.869617 Model 0 vs 1 0.4166660000000775 Model 2 vs 1 0.0 Model 8 vs 7 2.0799999947485048E-4