--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Mon Oct 31 15:00:11 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/110/CG31344-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2636.47         -2650.76
2      -2636.38         -2648.79
--------------------------------------
TOTAL    -2636.42         -2650.20
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.265048    0.001297    0.200728    0.338737    0.263109   1323.43   1412.21    1.000
r(A<->C){all}   0.101834    0.000787    0.050844    0.158733    0.099981    838.79    900.81    1.002
r(A<->G){all}   0.223364    0.001599    0.145480    0.299709    0.221629    966.26    978.66    1.000
r(A<->T){all}   0.153448    0.001533    0.081050    0.227897    0.150388    713.04    841.62    1.000
r(C<->G){all}   0.032116    0.000215    0.007681    0.063461    0.030432    786.92    966.25    1.000
r(C<->T){all}   0.411639    0.002714    0.314381    0.517202    0.409638    917.27    938.56    1.001
r(G<->T){all}   0.077597    0.000553    0.037376    0.127206    0.075162    944.87   1053.66    1.000
pi(A){all}      0.237616    0.000134    0.215239    0.260798    0.237491   1433.11   1446.12    1.000
pi(C){all}      0.259306    0.000153    0.237050    0.284759    0.258952   1157.68   1226.56    1.000
pi(G){all}      0.282081    0.000158    0.255279    0.304790    0.281884   1267.34   1292.21    1.001
pi(T){all}      0.220996    0.000136    0.198676    0.243893    0.220781   1165.01   1246.78    1.002
alpha{1,2}      0.051052    0.001360    0.000146    0.119656    0.044448   1501.00   1501.00    1.000
alpha{3}        2.393420    0.727893    0.950996    4.082431    2.265720   1290.37   1395.69    1.000
pinvar{all}     0.388266    0.008204    0.190037    0.541954    0.398662   1052.75   1157.34    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2542.169526
Model 2: PositiveSelection	-2542.169526
Model 0: one-ratio	-2542.377859
Model 3: discrete	-2541.814005
Model 7: beta	-2541.869513
Model 8: beta&w>1	-2541.869617


Model 0 vs 1	0.4166660000000775

Model 2 vs 1	0.0

Model 8 vs 7	2.0799999947485048E-4
>C1
MQVDGCTSSSSEIPHPAKRETWISGKMQSSSHSKDGHNAAGASKLLQDHQ
EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
MGAHRIKLKDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALANTGEDFKRMTEALINGLWHINTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL
VRWYLNFRVWLVDIFTYYLPYVAIWKFGPKSAYVRIFRNGGEAQDFALGL
KDD
>C2
MQVDGCTSSSSEIPHPANRESWNSVKMQSSSHSKDGHNGVGATKLLQDHQ
EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSWTAFTAYRRYVRTIFHTQAWYNYNI
ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDQVFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALANTDEEFNRMTEALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFIVTYLHRYAL
VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL
KDD
>C3
MQVDGCTSSSSEIPHPTNRETWNSVKMQSSSHSKDGHNGVGATKLLQDHQ
EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALANTDEEFNRMTKALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRLIVSYGLFLVTYLHRYAL
VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL
KDD
>C4
MQVDSCTSNSSEIPDPTKREAWNSGKMQSSPHSKDGHNAAGASKLVQDQQ
AAEDYLEHLMTKGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICARNWAESKLRLDI
VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYFSFDHENGVERDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL
VRWYFNFRIWLGDVLTYYLPYVAIWKFGPKFAYVRIFRKGGEAQDFTSGL
KDD
>C5
MQVDSCASSSSEIPNHTKRETWNSGKMQSSPHSKDGHNAAGASKLVQDQQ
AAEDYLQHLMTEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVEQDPQQKLHYYDMGWWDRFVVSYGLFLVTYLHKYAL
VRWYFNFRVWLVDVLTYYLPYVAIWKFGPRFAYVRIFRKGGEAQDFTSGL
KDD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=403 

C1              MQVDGCTSSSSEIPHPAKRETWISGKMQSSSHSKDGHNAAGASKLLQDHQ
C2              MQVDGCTSSSSEIPHPANRESWNSVKMQSSSHSKDGHNGVGATKLLQDHQ
C3              MQVDGCTSSSSEIPHPTNRETWNSVKMQSSSHSKDGHNGVGATKLLQDHQ
C4              MQVDSCTSNSSEIPDPTKREAWNSGKMQSSPHSKDGHNAAGASKLVQDQQ
C5              MQVDSCASSSSEIPNHTKRETWNSGKMQSSPHSKDGHNAAGASKLVQDQQ
                ****.*:*.*****. ::**:* * *****.*******..**:**:**:*

C1              EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
C2              EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA
C3              EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA
C4              AAEDYLEHLMTKGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
C5              AAEDYLQHLMTEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
                 .****:***.:**********************:***************

C1              GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
C2              GMLAGLIAVLAIPSILRVLSCTRQSWTAFTAYRRYVRTIFHTQAWYNYNI
C3              GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
C4              GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
C5              GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
                ************************* *********************:**

C1              ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
C2              ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
C3              ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
C4              ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT
C5              ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT
                ***************************:**********************

C1              MGAHRIKLKDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
C2              MGAHRIKLNDQVFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
C3              MGAHRIKLNDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
C4              MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICARNWAESKLRLDI
C5              MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
                ********:*  *************************.************

C1              VMRKVYEPALANTGEDFKRMTEALINGLWHINTMLSVNANIFFAKRLACV
C2              VMRKVYEPALANTDEEFNRMTEALINGLWHMNTMLSVNANIFFAKRLACV
C3              VMRKVYEPALANTDEEFNRMTKALINGLWHMNTMLSVNANIFFAKRLACV
C4              VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV
C5              VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV
                **********:**.*:* ***:********:*******************

C1              KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL
C2              KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFIVTYLHRYAL
C3              KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRLIVSYGLFLVTYLHRYAL
C4              KGYEYFSFDHENGVERDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL
C5              KGYEYYSFDHENGVEQDPQQKLHYYDMGWWDRFVVSYGLFLVTYLHKYAL
                *****:******** :****************::******:*****:***

C1              VRWYLNFRVWLVDIFTYYLPYVAIWKFGPKSAYVRIFRNGGEAQDFALGL
C2              VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL
C3              VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL
C4              VRWYFNFRIWLGDVLTYYLPYVAIWKFGPKFAYVRIFRKGGEAQDFTSGL
C5              VRWYFNFRVWLVDVLTYYLPYVAIWKFGPRFAYVRIFRKGGEAQDFTSGL
                ****:***:** *::**************: *******:*******: **

C1              KDD
C2              KDD
C3              KDD
C4              KDD
C5              KDD
                ***




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  403 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  403 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8060]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [8060]--->[8060]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/110/CG31344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.306 Mb, Max= 30.683 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MQVDGCTSSSSEIPHPAKRETWISGKMQSSSHSKDGHNAAGASKLLQDHQ
EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
MGAHRIKLKDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALANTGEDFKRMTEALINGLWHINTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL
VRWYLNFRVWLVDIFTYYLPYVAIWKFGPKSAYVRIFRNGGEAQDFALGL
KDD
>C2
MQVDGCTSSSSEIPHPANRESWNSVKMQSSSHSKDGHNGVGATKLLQDHQ
EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSWTAFTAYRRYVRTIFHTQAWYNYNI
ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDQVFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALANTDEEFNRMTEALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFIVTYLHRYAL
VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL
KDD
>C3
MQVDGCTSSSSEIPHPTNRETWNSVKMQSSSHSKDGHNGVGATKLLQDHQ
EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALANTDEEFNRMTKALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRLIVSYGLFLVTYLHRYAL
VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL
KDD
>C4
MQVDSCTSNSSEIPDPTKREAWNSGKMQSSPHSKDGHNAAGASKLVQDQQ
AAEDYLEHLMTKGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICARNWAESKLRLDI
VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYFSFDHENGVERDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL
VRWYFNFRIWLGDVLTYYLPYVAIWKFGPKFAYVRIFRKGGEAQDFTSGL
KDD
>C5
MQVDSCASSSSEIPNHTKRETWNSGKMQSSPHSKDGHNAAGASKLVQDQQ
AAEDYLQHLMTEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVEQDPQQKLHYYDMGWWDRFVVSYGLFLVTYLHKYAL
VRWYFNFRVWLVDVLTYYLPYVAIWKFGPRFAYVRIFRKGGEAQDFTSGL
KDD

FORMAT of file /tmp/tmp3990113748442366930aln Not Supported[FATAL:T-COFFEE]
>C1
MQVDGCTSSSSEIPHPAKRETWISGKMQSSSHSKDGHNAAGASKLLQDHQ
EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
MGAHRIKLKDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALANTGEDFKRMTEALINGLWHINTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL
VRWYLNFRVWLVDIFTYYLPYVAIWKFGPKSAYVRIFRNGGEAQDFALGL
KDD
>C2
MQVDGCTSSSSEIPHPANRESWNSVKMQSSSHSKDGHNGVGATKLLQDHQ
EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSWTAFTAYRRYVRTIFHTQAWYNYNI
ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDQVFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALANTDEEFNRMTEALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFIVTYLHRYAL
VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL
KDD
>C3
MQVDGCTSSSSEIPHPTNRETWNSVKMQSSSHSKDGHNGVGATKLLQDHQ
EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALANTDEEFNRMTKALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRLIVSYGLFLVTYLHRYAL
VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL
KDD
>C4
MQVDSCTSNSSEIPDPTKREAWNSGKMQSSPHSKDGHNAAGASKLVQDQQ
AAEDYLEHLMTKGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICARNWAESKLRLDI
VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYFSFDHENGVERDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL
VRWYFNFRIWLGDVLTYYLPYVAIWKFGPKFAYVRIFRKGGEAQDFTSGL
KDD
>C5
MQVDSCASSSSEIPNHTKRETWNSGKMQSSPHSKDGHNAAGASKLVQDQQ
AAEDYLQHLMTEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVEQDPQQKLHYYDMGWWDRFVVSYGLFLVTYLHKYAL
VRWYFNFRVWLVDVLTYYLPYVAIWKFGPRFAYVRIFRKGGEAQDFTSGL
KDD
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:403 S:100 BS:403
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 95.29 C1	 C2	 95.29
TOP	    1    0	 95.29 C2	 C1	 95.29
BOT	    0    2	 95.78 C1	 C3	 95.78
TOP	    2    0	 95.78 C3	 C1	 95.78
BOT	    0    3	 92.06 C1	 C4	 92.06
TOP	    3    0	 92.06 C4	 C1	 92.06
BOT	    0    4	 92.56 C1	 C5	 92.56
TOP	    4    0	 92.56 C5	 C1	 92.56
BOT	    1    2	 98.01 C2	 C3	 98.01
TOP	    2    1	 98.01 C3	 C2	 98.01
BOT	    1    3	 90.32 C2	 C4	 90.32
TOP	    3    1	 90.32 C4	 C2	 90.32
BOT	    1    4	 90.57 C2	 C5	 90.57
TOP	    4    1	 90.57 C5	 C2	 90.57
BOT	    2    3	 91.07 C3	 C4	 91.07
TOP	    3    2	 91.07 C4	 C3	 91.07
BOT	    2    4	 91.56 C3	 C5	 91.56
TOP	    4    2	 91.56 C5	 C3	 91.56
BOT	    3    4	 96.28 C4	 C5	 96.28
TOP	    4    3	 96.28 C5	 C4	 96.28
AVG	 0	 C1	  *	 93.92
AVG	 1	 C2	  *	 93.55
AVG	 2	 C3	  *	 94.11
AVG	 3	 C4	  *	 92.43
AVG	 4	 C5	  *	 92.74
TOT	 TOT	  *	 93.35
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCGC
C2              ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCGC
C3              ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCAC
C4              ATGCAGGTTGATAGTTGCACCAGCAACTCATCTGAGATCCCCGACCCCAC
C5              ATGCAGGTGGATAGTTGCGCAAGCAGCTCATCTGAGATCCCCAACCACAC
                ******** ***.**** .*.****.****** ********* * *.*.*

C1              GAAGCGTGAAACGTGGATCAGTGGGAAAATGCAGTCGTCATCGCATTCCA
C2              AAATCGTGAATCGTGGAACAGTGTGAAAATGCAGTCGTCGTCGCATTCCA
C3              AAATCGTGAAACGTGGAACAGTGTGAAAATGCAGTCGTCGTCGCATTCCA
C4              AAAGCGTGAAGCGTGGAACAGTGGGAAAATGCAGTCGTCGCCGCATTCCA
C5              AAAACGTGAAACGTGGAACAGTGGGAAAATGCAGTCGTCGCCGCATTCCA
                .** ****** ******:***** ***************. *********

C1              AAGATGGTCATAATGCAGCGGGGGCTTCAAAACTGCTTCAGGATCACCAG
C2              AAGATGGTCATAATGGAGTGGGGGCTACCAAACTGCTCCAGGATCACCAG
C3              AAGATGGTCATAATGGAGTGGGGGCTACCAAACTGCTCCAAGATCACCAG
C4              AAGATGGTCATAATGCAGCGGGGGCTAGCAAACTGGTCCAGGATCAGCAG
C5              AAGATGGTCATAATGCAGCGGGGGCTAGCAAACTGGTCCAGGATCAGCAG
                *************** ** *******: .****** * **.***** ***

C1              GAGCCCGAGGACTACTTGGAGCACCTAATGAAGGAGGGCAGTCAGGAGGG
C2              GAGCCCGAGGACTACTTGGAGCACCTGATGAAGGAGGGCAGTCAGGAGGG
C3              GAGCCCGAGGACTACTTGGAGCACCTGATGAAGGAGGGCAGTCAGGAGGG
C4              GCAGCCGAGGACTACCTGGAGCACCTGATGACGAAGGGCAGTCAGGAGGG
C5              GCAGCCGAGGACTACTTGCAGCACCTGATGACGGAGGGCAGTCAGGAGGG
                *.. *********** ** *******.****.*.****************

C1              CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT
C2              CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT
C3              CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT
C4              CGACAGTGGGGCAGACTTGGAACTACCTTCATGGTACGATGAGCAGCTAT
C5              CGACAGCGGGGCTGACTTGGAGCTACCTTCATGGTACGATGAGCAGCTAT
                ****** ** **:** *****.********.*******************

C1              TCAGGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTTGTAATGAACGCC
C2              TCAAGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTCGTAATGAACGCC
C3              TCAAGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTCGTAATGAACGCC
C4              TCAGGCGTGGTCAGAGCTACTTCAGCACGTATCGCTTCGTAATGAACGCC
C5              TCAGGCGTGGTCAGAGCTATTTCAGCACGTATCGCTTCGTAATGAACGCC
                ***.*************** ** ************** ************

C1              GGAATGCTGGCTGGTCTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG
C2              GGAATGCTGGCTGGACTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG
C3              GGAATGCTGGCTGGACTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG
C4              GGAATGCTGGCCGGTCTTATAGCTGTTCTGGCTATTCCCTCTATTCTACG
C5              GGAATGCTGGCTGGTCTAATAGCCGTGCTGGCTATTCCCTCTATTCTTCG
                *********** **:**:**:** ** ***********.** ***** **

C1              GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCCTACCGTC
C2              GGTGCTGTCGTGCACACGCCAATCCTGGACAGCGTTCACTGCCTACCGTC
C3              TGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACTGCCTACCGTC
C4              GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCATACCGTC
C5              GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCCTACCGTC
                 ************************* ************ **.*******

C1              GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAACATC
C2              GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACTACAACATC
C3              GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAACATC
C4              GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAATATC
C5              GCTATGTGCGCACTATATTCCACACGCAAGCCTGGTATAACCACAACATC
                ********** ****************************** **** ***

C1              GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC
C2              GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC
C3              GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC
C4              GCGGACCGTGGGAGCAGGTTTTGGACCAGTATTGCGGCCGTGAGACGGGC
C5              GCGGACCGTGGGAGCAGGTTCTGGACCAGTATTGCGGCCGTGAGGCGGGC
                *********** ******** ******** **************.*****

C1              CCACAGCCGCTCCAGTCATGCGTGCGCCCGCCAAGGAGCTGGACAGATCA
C2              CCACAGCCGCTCCAGTCATGCGTGCGCCCGTCAAGGAGCTGGACAGATCA
C3              CCACAGCCGCTCCAGTCATGCGTGCGCCCGACAAGGAGCTGGACAGATCA
C4              CCACAGCCGCTCCAGTCATGCTTGCGCCCGCAAAGGAGCTGGACAGATAA
C5              CCACAGCCGCTCCAGTCATGCGTGCGCTCGCAAAGGAGCTGGACAGATCA
                ********************* ***** ** .****************.*

C1              CCCAGAAGGATTTGGCGCTCACGCAGTTCGGTTTCATTGGCTTCATAACG
C2              CCCAGAAGGATTTGGCCCTCACACAGTTCGGTTTCATTGGTTTCATAACG
C3              CCCAGAAGGATTTGGCCCTCACACAGTTCGGTTTCATTGGCTTCATAACG
C4              CCCAGAAAGATTTGGCCCTCACACAGTTCGGATTTATTGGCTTCATAACG
C5              CCCAGAAAGATTTGGCTCTCACACAATTTGGATTCATTGGCTTTATAACG
                *******.******** *****.**.** **:** ***** ** ******

C1              ATGGGCGCACATCGCATAAAGCTGAAAGATCAGGACTTCCTGGAGGCCAC
C2              ATGGGCGCTCATCGCATAAAGCTGAACGATCAGGTCTTTCTGGAGGCCAC
C3              ATGGGCGCTCATCGCATAAAGCTGAACGATCAGGACTTCCTGGAGGCCAC
C4              ATGGGCGCTCATCGCATAAAGCTGAACGATCCGGACTTCCTAGAGGCCAC
C5              ATGGGCGCTCATCGCATAAAGCTTAACGATCCAGACTTCCTGGAGGCCAC
                ********:************** **.****..*:*** **.********

C1              TACGCATATGTGGCGCGTTCTCGGCTATCTGCTGGGCATCAAGGATGAGT
C2              TACGCATATGTGGCGCGTTCTTGGCTATCTGCTGGGCATCAAGGATGAGT
C3              TACGCATATGTGGCGCGTTCTTGGCTATCTGCTGGGCATCAAGGATGAGT
C4              GACGCATATGTGGCGCGTTCTCGGTTATCTGCTGGGCATCAAGGATGAGT
C5              GACGCATATGTGGCGCGTTCTCGGCTATCTGCTGGGCATCAAGGATGAGT
                 ******************** ** *************************

C1              ACAACATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTCCGCCTGGACATT
C2              ACAATATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTTCGCCTCGACATT
C3              ACAATATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTTCGCCTCGACATT
C4              ACAACATCTGCGCAAGGAACTGGGCGGAATCAAAGCTTCGCCTGGACATT
C5              ACAATATCTGCGGAAGGAACTGGGCGGAATCAAAGCTTCGCCTGGACATT
                **** ******* :**************.******** ***** ******

C1              GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGGGGAGGATTT
C2              GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGATGAGGAATT
C3              GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGATGAGGAATT
C4              GTGATGCGAAAGGTATACGAACCAGCTTTGACAAACACTGGTGAGGACTT
C5              GTGATGCGAAAAGTATATGAACCAGCTCTGACAAACACTGGTGAGGATTT
                ********:**.***** ********* **.*********. ***** **

C1              CAAACGAATGACCGAGGCCCTGATTAATGGCTTGTGGCACATAAACACCA
C2              CAACCGAATGACCGAGGCTCTGATTAATGGCTTGTGGCACATGAACACCA
C3              CAACCGAATGACCAAGGCTCTGATTAATGGCTTGTGGCACATGAACACCA
C4              CTACCGAATGACCGAGGCCTTGATTAATGGATTGTGGCACATGAACACCA
C5              TTACCGAATGACCGAGGCCTTGATTAATGGTTTGTGGCACATGAACACTA
                 :*.*********.****  ********** ***********.***** *

C1              TGCTGTCGGTGAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTT
C2              TGCTGTCGGTAAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTC
C3              TGCTGTCGGTAAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTC
C4              TGCTTTCGGTAAACGCCAACATATTCTTCGCCAAGCGATTGGCCTGCGTT
C5              TGCTTTCGGTAAACGCCAACATATTCTTCGCCAAGCGATTGGCATGTGTC
                **** *****.** ************** **************.** ** 

C1              AAGGGATACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA
C2              AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA
C3              AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA
C4              AAGGGCTACGAGTACTTCAGTTTCGATCATGAAAACGGCGTGGAACGGGA
C5              AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGAGCAGGA
                *****.**********:***************.*****.****..*.***

C1              TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGACCGATTCA
C2              TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGATCGATTCA
C3              TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGATCGATTAA
C4              TCCCCAGCAGAAACTGCACTACTACGACATGGGATGGTGGGATCGTTTCA
C5              TCCTCAGCAGAAACTGCACTACTACGACATGGGATGGTGGGATCGTTTCG
                *** ********.***************************** **:**..

C1              TAGTCAGCTACGGCCTGTTCCTCGTCACATATCTGCACAGGTATGCCCTG
C2              TAGTCAGCTACGGCCTGTTCATCGTCACATATCTGCACAGGTACGCCCTG
C3              TAGTCAGCTACGGCCTGTTCCTCGTCACATATCTGCACAGGTACGCCCTG
C4              TAGTCAGCTACGGCCTGTTCCTTGTCACATATCTGCACAGGTACGCCCTG
C5              TAGTCAGCTACGGCCTGTTCCTTGTCACATATCTGCACAAGTACGCCCTG
                ********************.* ****************.*** ******

C1              GTGCGATGGTACTTGAACTTCCGCGTCTGGCTGGTGGACATATTCACCTA
C2              GTGCGATGGTACTTGAACTTCCGTGTCTGGCTGGTGGACATACTCACATA
C3              GTGCGATGGTACTTGAACTTCCGTGTCTGGCTGGTGGACATACTCACATA
C4              GTGCGATGGTATTTCAACTTCCGCATCTGGCTGGGTGACGTACTGACCTA
C5              GTGCGATGGTATTTCAACTTCCGCGTCTGGCTGGTGGACGTACTGACCTA
                *********** ** ******** .*********  ***.** * **.**

C1              TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCGTATG
C2              TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCGTATG
C3              TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCTTATG
C4              TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCAAAGTTCGCGTATG
C5              TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCAAGGTTCGCGTATG
                ************************************.*.** *** ****

C1              TGCGGATTTTCAGGAATGGCGGGGAAGCCCAAGACTTTGCCCTGGGCTTG
C2              TGCGGATCTTCAGGAAAGGCGGGGAGGCTCAAGACTTTGCACTGGGCTTA
C3              TGCGGATCTTCAGGAAAGGCGGGGAGGCCCAAGATTTTGCCCTGGGCTTG
C4              TGCGGATCTTCAGGAAGGGAGGGGAGGCCCAAGATTTTACCTCGGGCTTG
C5              TGCGGATCTTCAGAAAAGGAGGGGAGGCCCAAGATTTTACCTCGGGCTTG
                ******* *****.** **.*****.** ***** ***.*.  ******.

C1              AAGGACGAT
C2              AAGGACGAT
C3              AAGGACGAT
C4              AAGGACGAT
C5              AAGGACGAT
                *********



>C1
ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCGC
GAAGCGTGAAACGTGGATCAGTGGGAAAATGCAGTCGTCATCGCATTCCA
AAGATGGTCATAATGCAGCGGGGGCTTCAAAACTGCTTCAGGATCACCAG
GAGCCCGAGGACTACTTGGAGCACCTAATGAAGGAGGGCAGTCAGGAGGG
CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT
TCAGGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTTGTAATGAACGCC
GGAATGCTGGCTGGTCTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG
GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCCTACCGTC
GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAACATC
GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC
CCACAGCCGCTCCAGTCATGCGTGCGCCCGCCAAGGAGCTGGACAGATCA
CCCAGAAGGATTTGGCGCTCACGCAGTTCGGTTTCATTGGCTTCATAACG
ATGGGCGCACATCGCATAAAGCTGAAAGATCAGGACTTCCTGGAGGCCAC
TACGCATATGTGGCGCGTTCTCGGCTATCTGCTGGGCATCAAGGATGAGT
ACAACATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTCCGCCTGGACATT
GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGGGGAGGATTT
CAAACGAATGACCGAGGCCCTGATTAATGGCTTGTGGCACATAAACACCA
TGCTGTCGGTGAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTT
AAGGGATACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA
TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGACCGATTCA
TAGTCAGCTACGGCCTGTTCCTCGTCACATATCTGCACAGGTATGCCCTG
GTGCGATGGTACTTGAACTTCCGCGTCTGGCTGGTGGACATATTCACCTA
TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCGTATG
TGCGGATTTTCAGGAATGGCGGGGAAGCCCAAGACTTTGCCCTGGGCTTG
AAGGACGAT
>C2
ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCGC
AAATCGTGAATCGTGGAACAGTGTGAAAATGCAGTCGTCGTCGCATTCCA
AAGATGGTCATAATGGAGTGGGGGCTACCAAACTGCTCCAGGATCACCAG
GAGCCCGAGGACTACTTGGAGCACCTGATGAAGGAGGGCAGTCAGGAGGG
CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT
TCAAGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTCGTAATGAACGCC
GGAATGCTGGCTGGACTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG
GGTGCTGTCGTGCACACGCCAATCCTGGACAGCGTTCACTGCCTACCGTC
GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACTACAACATC
GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC
CCACAGCCGCTCCAGTCATGCGTGCGCCCGTCAAGGAGCTGGACAGATCA
CCCAGAAGGATTTGGCCCTCACACAGTTCGGTTTCATTGGTTTCATAACG
ATGGGCGCTCATCGCATAAAGCTGAACGATCAGGTCTTTCTGGAGGCCAC
TACGCATATGTGGCGCGTTCTTGGCTATCTGCTGGGCATCAAGGATGAGT
ACAATATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTTCGCCTCGACATT
GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGATGAGGAATT
CAACCGAATGACCGAGGCTCTGATTAATGGCTTGTGGCACATGAACACCA
TGCTGTCGGTAAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTC
AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA
TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGATCGATTCA
TAGTCAGCTACGGCCTGTTCATCGTCACATATCTGCACAGGTACGCCCTG
GTGCGATGGTACTTGAACTTCCGTGTCTGGCTGGTGGACATACTCACATA
TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCGTATG
TGCGGATCTTCAGGAAAGGCGGGGAGGCTCAAGACTTTGCACTGGGCTTA
AAGGACGAT
>C3
ATGCAGGTTGATGGTTGTACCAGCAGCTCATCCGAGATCCCCCATCCCAC
AAATCGTGAAACGTGGAACAGTGTGAAAATGCAGTCGTCGTCGCATTCCA
AAGATGGTCATAATGGAGTGGGGGCTACCAAACTGCTCCAAGATCACCAG
GAGCCCGAGGACTACTTGGAGCACCTGATGAAGGAGGGCAGTCAGGAGGG
CGACAGCGGTGCTGATTTGGAGCTACCTTCGTGGTACGATGAGCAGCTAT
TCAAGCGTGGTCAGAGCTACTTTAGCACGTATCGCTTCGTAATGAACGCC
GGAATGCTGGCTGGACTTATTGCCGTGCTGGCTATTCCATCCATTCTCCG
TGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACTGCCTACCGTC
GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAACATC
GCGGACCGTGGCAGCAGGTTCTGGACCAGCATTGCGGCCGTGAGGCGGGC
CCACAGCCGCTCCAGTCATGCGTGCGCCCGACAAGGAGCTGGACAGATCA
CCCAGAAGGATTTGGCCCTCACACAGTTCGGTTTCATTGGCTTCATAACG
ATGGGCGCTCATCGCATAAAGCTGAACGATCAGGACTTCCTGGAGGCCAC
TACGCATATGTGGCGCGTTCTTGGCTATCTGCTGGGCATCAAGGATGAGT
ACAATATCTGCGGTAGGAACTGGGCGGAGTCAAAGCTTCGCCTCGACATT
GTGATGCGTAAGGTATACGAACCAGCTCTGGCAAACACTGATGAGGAATT
CAACCGAATGACCAAGGCTCTGATTAATGGCTTGTGGCACATGAACACCA
TGCTGTCGGTAAATGCCAACATATTCTTTGCCAAGCGATTGGCCTGCGTC
AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGCGCAGGA
TCCCCAGCAGAAGCTGCACTACTACGACATGGGATGGTGGGATCGATTAA
TAGTCAGCTACGGCCTGTTCCTCGTCACATATCTGCACAGGTACGCCCTG
GTGCGATGGTACTTGAACTTCCGTGTCTGGCTGGTGGACATACTCACATA
TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCGAAGTCCGCTTATG
TGCGGATCTTCAGGAAAGGCGGGGAGGCCCAAGATTTTGCCCTGGGCTTG
AAGGACGAT
>C4
ATGCAGGTTGATAGTTGCACCAGCAACTCATCTGAGATCCCCGACCCCAC
AAAGCGTGAAGCGTGGAACAGTGGGAAAATGCAGTCGTCGCCGCATTCCA
AAGATGGTCATAATGCAGCGGGGGCTAGCAAACTGGTCCAGGATCAGCAG
GCAGCCGAGGACTACCTGGAGCACCTGATGACGAAGGGCAGTCAGGAGGG
CGACAGTGGGGCAGACTTGGAACTACCTTCATGGTACGATGAGCAGCTAT
TCAGGCGTGGTCAGAGCTACTTCAGCACGTATCGCTTCGTAATGAACGCC
GGAATGCTGGCCGGTCTTATAGCTGTTCTGGCTATTCCCTCTATTCTACG
GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCATACCGTC
GCTATGTGCGTACTATATTCCACACGCAAGCCTGGTATAACCACAATATC
GCGGACCGTGGGAGCAGGTTTTGGACCAGTATTGCGGCCGTGAGACGGGC
CCACAGCCGCTCCAGTCATGCTTGCGCCCGCAAAGGAGCTGGACAGATAA
CCCAGAAAGATTTGGCCCTCACACAGTTCGGATTTATTGGCTTCATAACG
ATGGGCGCTCATCGCATAAAGCTGAACGATCCGGACTTCCTAGAGGCCAC
GACGCATATGTGGCGCGTTCTCGGTTATCTGCTGGGCATCAAGGATGAGT
ACAACATCTGCGCAAGGAACTGGGCGGAATCAAAGCTTCGCCTGGACATT
GTGATGCGAAAGGTATACGAACCAGCTTTGACAAACACTGGTGAGGACTT
CTACCGAATGACCGAGGCCTTGATTAATGGATTGTGGCACATGAACACCA
TGCTTTCGGTAAACGCCAACATATTCTTCGCCAAGCGATTGGCCTGCGTT
AAGGGCTACGAGTACTTCAGTTTCGATCATGAAAACGGCGTGGAACGGGA
TCCCCAGCAGAAACTGCACTACTACGACATGGGATGGTGGGATCGTTTCA
TAGTCAGCTACGGCCTGTTCCTTGTCACATATCTGCACAGGTACGCCCTG
GTGCGATGGTATTTCAACTTCCGCATCTGGCTGGGTGACGTACTGACCTA
TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCAAAGTTCGCGTATG
TGCGGATCTTCAGGAAGGGAGGGGAGGCCCAAGATTTTACCTCGGGCTTG
AAGGACGAT
>C5
ATGCAGGTGGATAGTTGCGCAAGCAGCTCATCTGAGATCCCCAACCACAC
AAAACGTGAAACGTGGAACAGTGGGAAAATGCAGTCGTCGCCGCATTCCA
AAGATGGTCATAATGCAGCGGGGGCTAGCAAACTGGTCCAGGATCAGCAG
GCAGCCGAGGACTACTTGCAGCACCTGATGACGGAGGGCAGTCAGGAGGG
CGACAGCGGGGCTGACTTGGAGCTACCTTCATGGTACGATGAGCAGCTAT
TCAGGCGTGGTCAGAGCTATTTCAGCACGTATCGCTTCGTAATGAACGCC
GGAATGCTGGCTGGTCTAATAGCCGTGCTGGCTATTCCCTCTATTCTTCG
GGTGCTGTCGTGCACACGCCAATCCTCGACAGCGTTCACCGCCTACCGTC
GCTATGTGCGCACTATATTCCACACGCAAGCCTGGTATAACCACAACATC
GCGGACCGTGGGAGCAGGTTCTGGACCAGTATTGCGGCCGTGAGGCGGGC
CCACAGCCGCTCCAGTCATGCGTGCGCTCGCAAAGGAGCTGGACAGATCA
CCCAGAAAGATTTGGCTCTCACACAATTTGGATTCATTGGCTTTATAACG
ATGGGCGCTCATCGCATAAAGCTTAACGATCCAGACTTCCTGGAGGCCAC
GACGCATATGTGGCGCGTTCTCGGCTATCTGCTGGGCATCAAGGATGAGT
ACAATATCTGCGGAAGGAACTGGGCGGAATCAAAGCTTCGCCTGGACATT
GTGATGCGAAAAGTATATGAACCAGCTCTGACAAACACTGGTGAGGATTT
TTACCGAATGACCGAGGCCTTGATTAATGGTTTGTGGCACATGAACACTA
TGCTTTCGGTAAACGCCAACATATTCTTCGCCAAGCGATTGGCATGTGTC
AAGGGCTACGAGTACTACAGTTTCGATCATGAGAACGGAGTGGAGCAGGA
TCCTCAGCAGAAACTGCACTACTACGACATGGGATGGTGGGATCGTTTCG
TAGTCAGCTACGGCCTGTTCCTTGTCACATATCTGCACAAGTACGCCCTG
GTGCGATGGTATTTCAACTTCCGCGTCTGGCTGGTGGACGTACTGACCTA
TTACTTGCCCTACGTCGCCATTTGGAAGTTTGGCCCAAGGTTCGCGTATG
TGCGGATCTTCAGAAAAGGAGGGGAGGCCCAAGATTTTACCTCGGGCTTG
AAGGACGAT
>C1
MQVDGCTSSSSEIPHPAKRETWISGKMQSSSHSKDGHNAAGASKLLQDHQ
EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
MGAHRIKLKDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALANTGEDFKRMTEALINGLWHINTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL
VRWYLNFRVWLVDIFTYYLPYVAIWKFGPKSAYVRIFRNGGEAQDFALGL
KDD
>C2
MQVDGCTSSSSEIPHPANRESWNSVKMQSSSHSKDGHNGVGATKLLQDHQ
EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSWTAFTAYRRYVRTIFHTQAWYNYNI
ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDQVFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALANTDEEFNRMTEALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRFIVSYGLFIVTYLHRYAL
VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL
KDD
>C3
MQVDGCTSSSSEIPHPTNRETWNSVKMQSSSHSKDGHNGVGATKLLQDHQ
EPEDYLEHLMKEGSQEGDSGADLELPSWYDEQLFKRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARQGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDQDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALANTDEEFNRMTKALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVAQDPQQKLHYYDMGWWDRLIVSYGLFLVTYLHRYAL
VRWYLNFRVWLVDILTYYLPYVAIWKFGPKSAYVRIFRKGGEAQDFALGL
KDD
>C4
MQVDSCTSNSSEIPDPTKREAWNSGKMQSSPHSKDGHNAAGASKLVQDQQ
AAEDYLEHLMTKGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICARNWAESKLRLDI
VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYFSFDHENGVERDPQQKLHYYDMGWWDRFIVSYGLFLVTYLHRYAL
VRWYFNFRIWLGDVLTYYLPYVAIWKFGPKFAYVRIFRKGGEAQDFTSGL
KDD
>C5
MQVDSCASSSSEIPNHTKRETWNSGKMQSSPHSKDGHNAAGASKLVQDQQ
AAEDYLQHLMTEGSQEGDSGADLELPSWYDEQLFRRGQSYFSTYRFVMNA
GMLAGLIAVLAIPSILRVLSCTRQSSTAFTAYRRYVRTIFHTQAWYNHNI
ADRGSRFWTSIAAVRRAHSRSSHACARKGAGQITQKDLALTQFGFIGFIT
MGAHRIKLNDPDFLEATTHMWRVLGYLLGIKDEYNICGRNWAESKLRLDI
VMRKVYEPALTNTGEDFYRMTEALINGLWHMNTMLSVNANIFFAKRLACV
KGYEYYSFDHENGVEQDPQQKLHYYDMGWWDRFVVSYGLFLVTYLHKYAL
VRWYFNFRVWLVDVLTYYLPYVAIWKFGPRFAYVRIFRKGGEAQDFTSGL
KDD


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 1209 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1477925720
      Setting output file names to "/opt/ADOPS/110/CG31344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1329312427
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 7284912462
      Seed = 581468397
      Swapseed = 1477925720
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 24 unique site patterns
      Division 2 has 24 unique site patterns
      Division 3 has 55 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3200.307100 -- -25.624409
         Chain 2 -- -3267.722626 -- -25.624409
         Chain 3 -- -3247.680214 -- -25.624409
         Chain 4 -- -3247.347120 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3267.722626 -- -25.624409
         Chain 2 -- -3276.080210 -- -25.624409
         Chain 3 -- -3068.274125 -- -25.624409
         Chain 4 -- -3276.080210 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3200.307] (-3267.723) (-3247.680) (-3247.347) * [-3267.723] (-3276.080) (-3068.274) (-3276.080) 
        500 -- (-2690.009) (-2684.555) (-2681.891) [-2675.866] * (-2677.576) (-2668.772) [-2672.069] (-2676.658) -- 0:00:00
       1000 -- (-2672.859) (-2681.591) [-2672.830] (-2666.369) * (-2675.631) (-2660.808) [-2667.862] (-2670.873) -- 0:00:00
       1500 -- (-2671.939) (-2663.717) (-2669.447) [-2657.105] * (-2673.835) [-2660.171] (-2662.822) (-2671.411) -- 0:00:00
       2000 -- [-2654.923] (-2664.027) (-2657.254) (-2660.461) * (-2665.206) (-2653.014) (-2659.292) [-2648.250] -- 0:00:00
       2500 -- (-2652.017) (-2658.308) (-2654.523) [-2652.573] * (-2655.597) [-2647.103] (-2651.115) (-2646.225) -- 0:00:00
       3000 -- (-2640.768) (-2655.208) (-2645.290) [-2640.755] * (-2655.017) [-2642.675] (-2648.432) (-2645.001) -- 0:00:00
       3500 -- (-2634.186) [-2648.261] (-2648.803) (-2640.118) * [-2646.508] (-2644.067) (-2655.483) (-2643.555) -- 0:04:44
       4000 -- (-2640.661) (-2640.810) (-2646.490) [-2638.238] * (-2641.382) (-2636.687) (-2653.946) [-2636.123] -- 0:04:09
       4500 -- (-2637.598) [-2637.093] (-2647.182) (-2637.068) * [-2637.095] (-2640.120) (-2648.088) (-2645.592) -- 0:03:41
       5000 -- (-2643.643) [-2637.310] (-2644.455) (-2641.847) * (-2640.338) [-2641.160] (-2640.413) (-2645.421) -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-2651.908) [-2635.915] (-2642.775) (-2644.285) * [-2635.385] (-2638.999) (-2647.394) (-2641.519) -- 0:03:00
       6000 -- (-2642.307) (-2636.422) [-2641.422] (-2645.780) * (-2643.740) (-2635.077) [-2636.934] (-2641.998) -- 0:02:45
       6500 -- (-2644.950) [-2642.306] (-2645.451) (-2646.195) * (-2646.639) (-2640.632) [-2640.611] (-2640.817) -- 0:02:32
       7000 -- (-2635.579) [-2634.031] (-2640.593) (-2648.028) * (-2647.827) (-2637.734) [-2643.670] (-2638.398) -- 0:02:21
       7500 -- (-2642.409) [-2640.641] (-2644.692) (-2646.401) * (-2646.413) [-2641.309] (-2640.931) (-2642.591) -- 0:02:12
       8000 -- (-2640.455) [-2649.471] (-2640.550) (-2645.778) * (-2641.467) [-2636.114] (-2642.734) (-2635.668) -- 0:04:08
       8500 -- (-2637.160) (-2642.036) [-2643.020] (-2641.563) * [-2639.513] (-2641.001) (-2644.695) (-2637.342) -- 0:03:53
       9000 -- [-2642.416] (-2644.833) (-2640.627) (-2642.867) * (-2639.066) (-2637.970) (-2639.448) [-2634.554] -- 0:03:40
       9500 -- (-2642.919) [-2640.083] (-2639.029) (-2642.911) * (-2643.702) (-2643.923) [-2634.665] (-2639.663) -- 0:03:28
      10000 -- (-2640.559) (-2643.847) (-2637.767) [-2636.816] * (-2641.876) (-2643.499) (-2641.588) [-2640.943] -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-2638.493) (-2645.629) [-2639.620] (-2637.358) * (-2639.167) (-2639.681) (-2645.219) [-2640.663] -- 0:03:08
      11000 -- [-2641.517] (-2648.051) (-2640.681) (-2640.442) * (-2640.223) [-2641.981] (-2644.596) (-2637.477) -- 0:02:59
      11500 -- (-2636.198) [-2649.015] (-2643.708) (-2648.398) * (-2644.949) [-2641.670] (-2641.758) (-2642.816) -- 0:02:51
      12000 -- (-2638.572) (-2642.195) [-2639.702] (-2641.638) * (-2651.531) (-2644.561) (-2643.410) [-2638.891] -- 0:02:44
      12500 -- (-2635.038) [-2637.293] (-2641.398) (-2638.432) * [-2641.414] (-2643.753) (-2638.282) (-2640.268) -- 0:03:57
      13000 -- (-2637.083) [-2639.778] (-2638.061) (-2643.804) * (-2642.675) (-2638.253) (-2640.431) [-2638.227] -- 0:03:47
      13500 -- [-2638.591] (-2642.809) (-2647.945) (-2650.765) * (-2648.522) [-2641.022] (-2638.865) (-2643.217) -- 0:03:39
      14000 -- [-2632.173] (-2644.099) (-2640.719) (-2644.084) * [-2643.684] (-2641.862) (-2637.998) (-2639.398) -- 0:03:31
      14500 -- (-2638.703) (-2656.385) (-2639.218) [-2635.513] * (-2638.381) (-2641.264) [-2639.548] (-2641.374) -- 0:03:23
      15000 -- [-2642.046] (-2640.131) (-2645.152) (-2642.533) * [-2640.224] (-2641.493) (-2641.283) (-2638.258) -- 0:03:17

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-2636.893) [-2636.701] (-2641.526) (-2635.222) * (-2640.058) (-2641.285) [-2638.763] (-2641.676) -- 0:03:10
      16000 -- (-2649.483) (-2640.678) (-2638.494) [-2637.154] * (-2639.930) (-2647.348) [-2635.761] (-2643.016) -- 0:03:04
      16500 -- (-2640.577) (-2642.311) (-2643.565) [-2638.645] * (-2636.210) (-2649.059) [-2645.435] (-2644.501) -- 0:02:58
      17000 -- (-2653.315) (-2643.353) [-2644.313] (-2640.313) * [-2635.408] (-2652.335) (-2638.242) (-2641.598) -- 0:02:53
      17500 -- (-2645.151) (-2641.166) [-2642.584] (-2638.057) * (-2637.703) (-2640.517) [-2640.607] (-2636.033) -- 0:03:44
      18000 -- (-2642.968) (-2635.744) (-2640.676) [-2638.936] * (-2636.223) [-2639.387] (-2635.051) (-2641.396) -- 0:03:38
      18500 -- (-2639.527) (-2639.418) (-2645.384) [-2636.176] * (-2637.572) (-2639.857) [-2634.516] (-2641.004) -- 0:03:32
      19000 -- [-2636.930] (-2638.733) (-2645.077) (-2641.924) * (-2637.015) [-2636.830] (-2638.640) (-2641.551) -- 0:03:26
      19500 -- (-2639.201) (-2640.885) (-2651.467) [-2637.488] * (-2637.077) (-2635.384) [-2636.532] (-2649.374) -- 0:03:21
      20000 -- (-2641.423) (-2644.312) [-2641.944] (-2635.041) * (-2637.784) [-2640.331] (-2645.449) (-2644.281) -- 0:03:16

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-2634.608) (-2643.995) (-2640.528) [-2640.955] * (-2640.653) [-2636.822] (-2639.083) (-2638.244) -- 0:03:11
      21000 -- [-2637.228] (-2645.101) (-2640.060) (-2642.505) * (-2638.472) [-2638.962] (-2653.123) (-2644.439) -- 0:03:06
      21500 -- (-2636.761) [-2636.266] (-2640.730) (-2642.669) * [-2641.600] (-2639.577) (-2645.386) (-2645.305) -- 0:03:02
      22000 -- [-2636.359] (-2641.106) (-2640.935) (-2642.511) * (-2638.425) (-2641.806) [-2646.291] (-2645.596) -- 0:02:57
      22500 -- [-2640.210] (-2643.541) (-2641.619) (-2643.179) * (-2639.787) [-2636.115] (-2644.372) (-2640.591) -- 0:03:37
      23000 -- (-2640.959) (-2640.889) (-2652.467) [-2640.230] * (-2648.194) (-2640.000) (-2635.720) [-2638.443] -- 0:03:32
      23500 -- (-2642.515) (-2637.164) (-2641.199) [-2640.010] * (-2640.728) (-2638.569) [-2640.367] (-2643.125) -- 0:03:27
      24000 -- (-2634.202) (-2639.149) [-2640.710] (-2641.414) * [-2636.418] (-2639.021) (-2637.315) (-2643.463) -- 0:03:23
      24500 -- (-2646.075) (-2640.615) [-2643.105] (-2636.869) * [-2638.844] (-2643.594) (-2638.228) (-2641.832) -- 0:03:19
      25000 -- (-2641.672) (-2638.421) [-2633.931] (-2639.817) * [-2640.884] (-2644.132) (-2642.488) (-2636.985) -- 0:03:15

      Average standard deviation of split frequencies: 0.000000

      25500 -- (-2641.566) (-2645.358) (-2644.869) [-2643.715] * (-2639.727) (-2642.263) (-2637.693) [-2638.109] -- 0:03:11
      26000 -- (-2634.549) (-2645.814) [-2641.534] (-2636.645) * (-2634.726) (-2636.087) [-2641.156] (-2645.671) -- 0:03:07
      26500 -- (-2639.753) (-2640.943) [-2635.842] (-2643.941) * (-2633.407) [-2640.619] (-2637.286) (-2646.037) -- 0:03:03
      27000 -- [-2636.657] (-2642.657) (-2638.556) (-2641.554) * [-2632.739] (-2640.433) (-2635.577) (-2637.086) -- 0:03:36
      27500 -- (-2637.271) (-2643.416) (-2639.634) [-2641.454] * (-2635.942) [-2634.855] (-2641.598) (-2638.805) -- 0:03:32
      28000 -- [-2635.847] (-2640.778) (-2644.519) (-2640.649) * (-2641.840) (-2641.094) [-2639.252] (-2639.026) -- 0:03:28
      28500 -- [-2637.987] (-2635.224) (-2645.273) (-2647.249) * [-2637.306] (-2638.697) (-2638.531) (-2644.013) -- 0:03:24
      29000 -- [-2638.909] (-2639.746) (-2641.694) (-2641.833) * (-2641.132) [-2638.990] (-2636.665) (-2644.646) -- 0:03:20
      29500 -- (-2649.531) (-2637.737) (-2646.358) [-2637.626] * (-2635.147) (-2641.801) (-2639.991) [-2641.758] -- 0:03:17
      30000 -- (-2648.242) [-2639.169] (-2640.230) (-2647.680) * (-2642.843) (-2637.310) [-2634.592] (-2636.254) -- 0:03:14

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-2638.431) (-2644.466) [-2641.957] (-2641.616) * (-2640.827) (-2638.057) (-2640.818) [-2637.923] -- 0:03:10
      31000 -- (-2639.479) [-2639.146] (-2641.930) (-2654.125) * (-2639.221) (-2635.852) (-2636.055) [-2633.015] -- 0:03:07
      31500 -- (-2649.297) (-2644.194) (-2636.966) [-2637.584] * [-2640.345] (-2637.054) (-2647.958) (-2638.618) -- 0:03:04
      32000 -- [-2644.552] (-2641.480) (-2641.591) (-2636.199) * (-2638.885) (-2640.465) (-2642.898) [-2636.802] -- 0:03:31
      32500 -- (-2642.594) (-2640.950) [-2637.647] (-2641.672) * (-2641.487) (-2637.378) [-2640.474] (-2644.011) -- 0:03:28
      33000 -- [-2637.086] (-2638.239) (-2637.807) (-2641.090) * (-2647.067) (-2641.159) (-2640.010) [-2638.306] -- 0:03:25
      33500 -- [-2639.881] (-2639.297) (-2645.343) (-2644.037) * (-2640.616) (-2639.457) (-2634.893) [-2637.872] -- 0:03:21
      34000 -- (-2636.565) [-2636.497] (-2638.759) (-2636.873) * [-2637.301] (-2637.539) (-2635.556) (-2644.207) -- 0:03:18
      34500 -- (-2637.292) [-2646.046] (-2638.793) (-2638.113) * (-2635.766) (-2635.019) (-2636.419) [-2641.670] -- 0:03:15
      35000 -- [-2635.116] (-2639.704) (-2636.768) (-2641.803) * [-2637.172] (-2637.368) (-2636.538) (-2646.565) -- 0:03:13

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-2636.916) [-2645.481] (-2644.898) (-2644.457) * (-2639.346) [-2638.246] (-2636.001) (-2643.306) -- 0:03:10
      36000 -- [-2638.259] (-2643.015) (-2642.059) (-2645.184) * [-2636.623] (-2638.509) (-2641.314) (-2647.348) -- 0:03:07
      36500 -- [-2642.978] (-2640.240) (-2638.661) (-2643.280) * (-2640.664) [-2639.793] (-2637.891) (-2647.776) -- 0:03:31
      37000 -- (-2641.907) (-2645.851) [-2637.606] (-2639.269) * (-2641.479) (-2641.582) [-2637.190] (-2644.679) -- 0:03:28
      37500 -- [-2642.748] (-2647.375) (-2638.409) (-2640.570) * (-2647.474) (-2639.432) (-2638.955) [-2639.900] -- 0:03:25
      38000 -- [-2637.995] (-2644.299) (-2640.612) (-2635.234) * (-2639.160) (-2643.656) [-2636.527] (-2646.546) -- 0:03:22
      38500 -- [-2641.779] (-2638.389) (-2636.602) (-2638.410) * (-2636.846) [-2633.699] (-2640.100) (-2646.504) -- 0:03:19
      39000 -- (-2647.829) (-2637.999) (-2641.244) [-2636.335] * (-2641.939) [-2644.445] (-2642.323) (-2645.482) -- 0:03:17
      39500 -- (-2643.773) [-2638.312] (-2641.119) (-2641.828) * (-2639.888) [-2639.284] (-2636.132) (-2638.423) -- 0:03:14
      40000 -- (-2639.117) (-2636.499) (-2637.524) [-2638.289] * (-2646.067) (-2636.222) [-2638.630] (-2636.954) -- 0:03:12

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-2635.421) (-2638.146) (-2641.863) [-2639.114] * (-2640.508) (-2639.163) [-2639.874] (-2640.012) -- 0:03:09
      41000 -- (-2638.360) [-2639.089] (-2638.123) (-2641.928) * [-2644.653] (-2644.198) (-2641.425) (-2641.253) -- 0:03:07
      41500 -- (-2640.179) (-2639.423) [-2642.424] (-2638.097) * (-2642.463) (-2634.453) [-2635.329] (-2644.993) -- 0:03:27
      42000 -- [-2642.460] (-2638.431) (-2641.125) (-2640.004) * (-2638.226) [-2633.112] (-2638.752) (-2642.394) -- 0:03:25
      42500 -- (-2642.575) (-2642.222) [-2639.331] (-2638.249) * (-2639.946) (-2637.705) [-2639.462] (-2646.772) -- 0:03:22
      43000 -- (-2643.045) (-2642.387) [-2638.691] (-2637.540) * (-2634.997) [-2635.986] (-2643.824) (-2640.599) -- 0:03:20
      43500 -- (-2637.091) (-2634.872) (-2640.010) [-2638.445] * (-2635.702) [-2643.076] (-2640.374) (-2635.855) -- 0:03:17
      44000 -- (-2643.852) [-2642.894] (-2639.391) (-2641.148) * [-2639.005] (-2640.292) (-2642.014) (-2641.224) -- 0:03:15
      44500 -- (-2638.388) (-2637.477) (-2645.205) [-2637.306] * (-2639.402) [-2638.626] (-2645.291) (-2644.908) -- 0:03:13
      45000 -- (-2636.408) (-2638.076) [-2642.042] (-2637.691) * (-2639.918) (-2642.791) [-2638.522] (-2644.324) -- 0:03:11

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-2641.477) (-2640.491) (-2638.747) [-2639.387] * [-2638.900] (-2647.048) (-2636.145) (-2641.832) -- 0:03:08
      46000 -- [-2640.368] (-2642.800) (-2643.484) (-2635.560) * (-2639.628) (-2641.297) [-2638.919] (-2639.332) -- 0:03:27
      46500 -- (-2636.316) (-2639.905) [-2636.158] (-2636.156) * [-2635.327] (-2639.317) (-2641.638) (-2638.111) -- 0:03:25
      47000 -- [-2642.122] (-2638.585) (-2639.737) (-2635.105) * (-2641.521) (-2640.631) (-2639.718) [-2644.761] -- 0:03:22
      47500 -- (-2636.809) (-2634.690) [-2638.756] (-2640.624) * (-2639.000) [-2645.328] (-2640.712) (-2647.117) -- 0:03:20
      48000 -- (-2646.055) [-2637.119] (-2640.405) (-2645.802) * [-2643.887] (-2640.754) (-2643.282) (-2639.328) -- 0:03:18
      48500 -- [-2636.742] (-2644.093) (-2635.389) (-2638.605) * (-2640.564) (-2640.714) (-2647.172) [-2641.282] -- 0:03:16
      49000 -- (-2640.811) (-2643.736) (-2645.462) [-2639.574] * (-2645.024) (-2641.750) [-2642.928] (-2636.305) -- 0:03:14
      49500 -- (-2638.864) (-2642.348) [-2649.304] (-2648.355) * (-2643.594) (-2645.086) [-2639.803] (-2641.233) -- 0:03:12
      50000 -- [-2639.806] (-2636.335) (-2643.651) (-2656.818) * (-2638.455) (-2642.802) (-2640.637) [-2634.168] -- 0:03:10

      Average standard deviation of split frequencies: 0.000000

      50500 -- [-2635.617] (-2641.534) (-2644.046) (-2646.035) * (-2637.918) (-2639.580) [-2643.371] (-2640.185) -- 0:03:08
      51000 -- (-2647.573) [-2642.414] (-2637.239) (-2641.410) * [-2640.025] (-2638.328) (-2642.993) (-2639.583) -- 0:03:24
      51500 -- (-2644.435) [-2642.968] (-2648.508) (-2638.558) * (-2638.818) (-2637.525) [-2640.763] (-2637.576) -- 0:03:22
      52000 -- [-2639.569] (-2641.292) (-2647.021) (-2641.501) * (-2639.995) [-2635.091] (-2637.038) (-2641.222) -- 0:03:20
      52500 -- (-2645.548) [-2644.304] (-2636.898) (-2636.715) * [-2640.966] (-2636.929) (-2639.296) (-2640.646) -- 0:03:18
      53000 -- (-2641.343) (-2636.569) [-2636.690] (-2640.099) * (-2641.242) (-2639.673) [-2638.751] (-2643.366) -- 0:03:16
      53500 -- [-2643.918] (-2645.209) (-2639.990) (-2638.069) * (-2642.921) (-2642.087) [-2636.240] (-2639.145) -- 0:03:14
      54000 -- (-2641.139) (-2642.658) (-2647.965) [-2640.523] * (-2637.834) (-2640.866) [-2636.290] (-2644.625) -- 0:03:12
      54500 -- (-2639.674) (-2639.829) (-2646.774) [-2640.929] * (-2636.678) (-2635.395) [-2641.669] (-2640.766) -- 0:03:10
      55000 -- (-2645.129) (-2644.834) (-2636.605) [-2642.259] * [-2640.680] (-2638.488) (-2638.863) (-2639.663) -- 0:03:09

      Average standard deviation of split frequencies: 0.000000

      55500 -- (-2638.568) [-2636.628] (-2635.921) (-2645.165) * (-2640.025) [-2638.064] (-2638.969) (-2635.627) -- 0:03:24
      56000 -- (-2638.744) (-2636.320) [-2639.164] (-2645.500) * (-2641.287) [-2643.263] (-2642.381) (-2638.463) -- 0:03:22
      56500 -- (-2637.178) [-2645.462] (-2641.054) (-2649.430) * (-2639.239) (-2636.826) [-2637.802] (-2644.154) -- 0:03:20
      57000 -- (-2639.100) (-2644.814) [-2638.543] (-2642.413) * (-2632.813) (-2639.067) (-2639.250) [-2640.201] -- 0:03:18
      57500 -- (-2641.521) [-2634.932] (-2642.376) (-2651.728) * (-2642.512) [-2636.717] (-2636.035) (-2642.532) -- 0:03:16
      58000 -- [-2638.186] (-2639.571) (-2640.554) (-2642.024) * (-2642.811) (-2639.053) (-2641.620) [-2640.273] -- 0:03:14
      58500 -- [-2637.240] (-2639.925) (-2636.144) (-2640.631) * (-2642.244) (-2636.675) [-2640.914] (-2642.903) -- 0:03:13
      59000 -- (-2642.756) (-2643.884) (-2633.624) [-2637.806] * (-2640.653) (-2647.284) (-2646.318) [-2641.133] -- 0:03:11
      59500 -- (-2646.570) (-2639.648) [-2635.041] (-2640.284) * [-2640.187] (-2643.200) (-2645.409) (-2642.017) -- 0:03:09
      60000 -- (-2636.110) (-2640.940) [-2635.235] (-2639.684) * (-2638.589) (-2652.119) [-2645.471] (-2641.347) -- 0:03:08

      Average standard deviation of split frequencies: 0.000000

      60500 -- [-2639.504] (-2638.782) (-2645.812) (-2644.086) * (-2639.165) (-2641.903) (-2640.474) [-2642.488] -- 0:03:21
      61000 -- (-2633.069) [-2637.496] (-2641.776) (-2640.318) * [-2645.503] (-2636.888) (-2647.794) (-2638.174) -- 0:03:20
      61500 -- (-2638.637) [-2633.432] (-2643.505) (-2644.196) * (-2644.931) (-2648.698) [-2642.499] (-2637.079) -- 0:03:18
      62000 -- (-2643.061) [-2637.491] (-2643.812) (-2643.264) * [-2640.895] (-2644.848) (-2640.162) (-2649.310) -- 0:03:16
      62500 -- (-2643.274) [-2635.752] (-2640.344) (-2641.493) * [-2638.280] (-2637.687) (-2633.913) (-2642.645) -- 0:03:15
      63000 -- (-2637.355) [-2643.622] (-2636.102) (-2641.534) * (-2636.491) [-2634.024] (-2638.545) (-2639.906) -- 0:03:13
      63500 -- (-2639.080) (-2640.025) (-2636.482) [-2642.267] * (-2640.855) (-2637.204) [-2636.556] (-2632.877) -- 0:03:11
      64000 -- (-2643.287) (-2641.271) [-2636.282] (-2642.554) * (-2640.477) (-2636.240) [-2635.192] (-2642.709) -- 0:03:10
      64500 -- [-2640.574] (-2644.944) (-2639.259) (-2642.173) * (-2641.106) (-2640.802) (-2639.186) [-2644.170] -- 0:03:08
      65000 -- (-2644.902) (-2636.429) (-2648.442) [-2640.765] * (-2645.197) (-2637.872) (-2644.255) [-2641.280] -- 0:03:21

      Average standard deviation of split frequencies: 0.003571

      65500 -- (-2645.480) (-2643.215) (-2638.625) [-2640.576] * (-2643.304) (-2641.041) (-2638.549) [-2637.108] -- 0:03:19
      66000 -- (-2638.746) (-2641.458) [-2643.479] (-2633.516) * [-2638.944] (-2640.134) (-2642.409) (-2648.226) -- 0:03:18
      66500 -- [-2634.776] (-2637.423) (-2636.939) (-2633.915) * [-2641.931] (-2641.942) (-2647.363) (-2648.472) -- 0:03:16
      67000 -- [-2633.547] (-2637.433) (-2641.792) (-2638.006) * (-2644.290) (-2644.328) (-2637.913) [-2639.222] -- 0:03:14
      67500 -- (-2642.898) (-2646.189) (-2645.105) [-2640.665] * [-2635.734] (-2643.216) (-2639.899) (-2638.668) -- 0:03:13
      68000 -- [-2643.805] (-2637.817) (-2644.134) (-2641.764) * [-2636.018] (-2637.995) (-2638.896) (-2652.584) -- 0:03:11
      68500 -- (-2641.682) (-2636.672) (-2640.024) [-2640.734] * (-2635.635) (-2633.929) (-2641.356) [-2643.837] -- 0:03:10
      69000 -- (-2640.687) [-2642.247] (-2639.640) (-2642.124) * (-2639.003) [-2636.556] (-2641.596) (-2646.261) -- 0:03:08
      69500 -- (-2642.949) (-2639.170) (-2634.705) [-2640.872] * [-2636.010] (-2635.423) (-2643.694) (-2638.554) -- 0:03:20
      70000 -- (-2641.788) [-2638.651] (-2638.572) (-2645.527) * (-2638.017) (-2641.254) [-2641.232] (-2636.785) -- 0:03:19

      Average standard deviation of split frequencies: 0.003335

      70500 -- (-2640.502) [-2634.430] (-2648.989) (-2644.191) * (-2635.828) [-2642.133] (-2647.856) (-2644.503) -- 0:03:17
      71000 -- (-2641.846) (-2641.203) (-2648.883) [-2640.632] * (-2644.559) [-2637.476] (-2646.083) (-2638.461) -- 0:03:16
      71500 -- [-2636.739] (-2646.556) (-2642.706) (-2636.208) * (-2639.572) (-2640.082) (-2641.732) [-2642.868] -- 0:03:14
      72000 -- (-2639.298) (-2634.288) (-2639.120) [-2636.150] * (-2641.016) [-2640.811] (-2644.001) (-2645.201) -- 0:03:13
      72500 -- (-2637.159) (-2639.530) (-2638.700) [-2636.793] * (-2643.597) (-2640.845) [-2639.371] (-2638.463) -- 0:03:11
      73000 -- (-2641.390) [-2639.644] (-2642.735) (-2639.064) * (-2638.154) [-2640.761] (-2642.561) (-2641.416) -- 0:03:10
      73500 -- (-2641.978) [-2641.459] (-2636.722) (-2641.054) * (-2639.318) (-2646.460) (-2641.089) [-2639.728] -- 0:03:09
      74000 -- [-2641.146] (-2641.504) (-2638.515) (-2644.726) * (-2634.800) (-2638.753) [-2641.865] (-2643.152) -- 0:03:07
      74500 -- (-2650.125) (-2645.973) (-2639.080) [-2637.236] * (-2638.804) [-2641.640] (-2643.196) (-2643.327) -- 0:03:18
      75000 -- (-2639.010) [-2640.111] (-2637.816) (-2640.390) * (-2641.167) (-2637.412) [-2637.432] (-2644.162) -- 0:03:17

      Average standard deviation of split frequencies: 0.003101

      75500 -- (-2645.182) (-2647.062) (-2639.204) [-2642.319] * (-2642.199) (-2638.697) (-2645.524) [-2649.090] -- 0:03:15
      76000 -- (-2637.874) (-2642.805) (-2643.534) [-2641.272] * (-2642.944) [-2639.732] (-2642.483) (-2645.473) -- 0:03:14
      76500 -- (-2637.903) [-2632.558] (-2641.228) (-2641.305) * (-2636.019) [-2641.313] (-2637.986) (-2640.083) -- 0:03:13
      77000 -- (-2634.760) [-2636.431] (-2637.961) (-2637.597) * [-2635.671] (-2647.030) (-2650.571) (-2637.489) -- 0:03:11
      77500 -- (-2639.270) (-2642.925) [-2637.332] (-2641.028) * (-2641.707) [-2637.864] (-2644.411) (-2635.879) -- 0:03:10
      78000 -- [-2645.772] (-2636.484) (-2644.739) (-2635.152) * [-2641.065] (-2642.279) (-2640.699) (-2642.557) -- 0:03:09
      78500 -- (-2641.023) (-2637.092) [-2641.271] (-2647.332) * (-2640.118) (-2642.156) [-2645.959] (-2645.440) -- 0:03:07
      79000 -- (-2637.519) (-2640.935) (-2641.463) [-2647.432] * (-2643.339) (-2644.178) (-2636.630) [-2638.450] -- 0:03:06
      79500 -- [-2636.601] (-2645.483) (-2649.546) (-2641.358) * (-2649.539) (-2645.785) [-2636.838] (-2636.293) -- 0:03:16
      80000 -- [-2636.147] (-2648.961) (-2640.604) (-2639.729) * (-2635.229) [-2637.714] (-2637.967) (-2636.746) -- 0:03:15

      Average standard deviation of split frequencies: 0.002922

      80500 -- [-2636.707] (-2646.234) (-2643.548) (-2641.489) * (-2639.880) [-2635.055] (-2646.231) (-2636.380) -- 0:03:14
      81000 -- (-2639.839) (-2646.307) (-2640.712) [-2641.871] * [-2637.549] (-2637.492) (-2643.436) (-2642.597) -- 0:03:12
      81500 -- (-2641.613) [-2644.073] (-2654.185) (-2643.485) * [-2636.789] (-2642.071) (-2641.063) (-2643.744) -- 0:03:11
      82000 -- (-2636.159) [-2640.751] (-2651.502) (-2637.475) * (-2642.396) [-2640.646] (-2644.182) (-2643.630) -- 0:03:10
      82500 -- (-2639.713) [-2637.664] (-2645.282) (-2636.283) * (-2641.684) (-2640.451) (-2637.891) [-2640.195] -- 0:03:09
      83000 -- (-2641.445) (-2639.439) (-2640.245) [-2633.898] * (-2640.591) (-2643.625) (-2635.118) [-2639.388] -- 0:03:07
      83500 -- (-2639.217) (-2636.714) [-2640.623] (-2638.021) * [-2642.318] (-2651.060) (-2636.744) (-2644.990) -- 0:03:06
      84000 -- (-2637.887) [-2638.008] (-2639.487) (-2655.728) * (-2638.069) (-2644.288) [-2639.083] (-2642.735) -- 0:03:16
      84500 -- [-2639.053] (-2642.995) (-2644.977) (-2645.818) * (-2645.028) (-2641.817) [-2639.017] (-2643.021) -- 0:03:15
      85000 -- (-2635.881) (-2643.183) [-2636.592] (-2650.577) * [-2637.383] (-2637.478) (-2643.924) (-2644.032) -- 0:03:13

      Average standard deviation of split frequencies: 0.002741

      85500 -- (-2636.855) (-2646.225) [-2635.971] (-2647.218) * (-2640.045) (-2635.884) [-2639.420] (-2643.431) -- 0:03:12
      86000 -- [-2637.986] (-2652.084) (-2641.984) (-2643.455) * (-2641.418) (-2638.189) [-2635.229] (-2638.147) -- 0:03:11
      86500 -- (-2640.324) [-2650.135] (-2638.752) (-2648.885) * (-2642.727) (-2637.819) [-2635.507] (-2639.064) -- 0:03:10
      87000 -- (-2639.681) (-2646.999) [-2638.543] (-2649.270) * [-2639.873] (-2637.503) (-2635.710) (-2639.224) -- 0:03:08
      87500 -- (-2639.077) (-2642.483) [-2635.597] (-2645.704) * [-2646.333] (-2636.560) (-2643.526) (-2635.114) -- 0:03:07
      88000 -- [-2640.313] (-2650.280) (-2646.487) (-2646.434) * (-2637.657) [-2633.748] (-2638.874) (-2636.389) -- 0:03:06
      88500 -- (-2639.829) (-2649.887) [-2639.218] (-2641.149) * (-2642.821) (-2638.154) [-2637.533] (-2642.232) -- 0:03:05
      89000 -- (-2646.468) (-2644.182) (-2641.977) [-2637.533] * (-2644.125) [-2640.363] (-2636.385) (-2649.412) -- 0:03:14
      89500 -- (-2640.391) (-2636.752) (-2635.844) [-2640.457] * (-2638.375) (-2647.665) (-2636.297) [-2644.965] -- 0:03:13
      90000 -- (-2638.318) (-2640.334) (-2634.736) [-2637.126] * [-2640.699] (-2637.909) (-2637.622) (-2644.505) -- 0:03:12

      Average standard deviation of split frequencies: 0.002600

      90500 -- (-2641.615) (-2639.763) [-2633.472] (-2637.088) * (-2639.785) (-2639.653) [-2644.889] (-2643.331) -- 0:03:10
      91000 -- (-2641.060) (-2645.520) [-2635.874] (-2641.851) * [-2636.114] (-2640.398) (-2635.190) (-2644.388) -- 0:03:09
      91500 -- (-2638.566) (-2638.773) [-2638.618] (-2640.535) * (-2647.228) (-2640.596) [-2639.360] (-2646.041) -- 0:03:08
      92000 -- [-2646.732] (-2639.810) (-2639.048) (-2639.284) * (-2636.895) [-2634.255] (-2641.055) (-2643.866) -- 0:03:07
      92500 -- (-2637.384) (-2638.142) (-2641.212) [-2635.870] * (-2645.991) [-2639.638] (-2638.184) (-2644.061) -- 0:03:06
      93000 -- (-2639.710) (-2640.559) [-2640.037] (-2638.535) * (-2649.295) (-2641.430) [-2636.768] (-2647.571) -- 0:03:05
      93500 -- (-2645.803) (-2638.313) [-2638.134] (-2640.421) * [-2640.192] (-2635.537) (-2636.224) (-2637.293) -- 0:03:04
      94000 -- (-2645.653) (-2641.241) (-2642.744) [-2636.396] * (-2648.844) [-2637.097] (-2645.936) (-2638.978) -- 0:03:12
      94500 -- (-2646.623) [-2639.293] (-2640.994) (-2639.969) * (-2641.580) (-2646.867) [-2638.806] (-2640.105) -- 0:03:11
      95000 -- (-2642.863) (-2643.080) [-2637.497] (-2639.852) * (-2638.949) [-2636.101] (-2637.272) (-2636.381) -- 0:03:10

      Average standard deviation of split frequencies: 0.002455

      95500 -- [-2641.385] (-2639.806) (-2639.599) (-2636.810) * (-2638.753) [-2637.034] (-2634.174) (-2640.859) -- 0:03:09
      96000 -- (-2642.120) (-2638.623) [-2637.727] (-2635.373) * [-2634.325] (-2635.254) (-2640.501) (-2641.310) -- 0:03:08
      96500 -- (-2642.496) (-2639.023) (-2643.627) [-2636.775] * (-2634.923) (-2643.245) (-2642.930) [-2633.325] -- 0:03:07
      97000 -- (-2642.689) [-2642.991] (-2649.233) (-2647.777) * (-2637.091) [-2643.534] (-2643.264) (-2637.453) -- 0:03:06
      97500 -- [-2638.366] (-2640.368) (-2638.114) (-2638.410) * (-2641.795) (-2648.616) (-2638.286) [-2642.488] -- 0:03:05
      98000 -- (-2641.889) [-2640.878] (-2642.742) (-2644.848) * (-2638.760) [-2653.891] (-2642.631) (-2641.333) -- 0:03:04
      98500 -- (-2639.403) [-2636.776] (-2638.770) (-2642.571) * (-2639.587) (-2649.437) [-2636.163] (-2635.664) -- 0:03:12
      99000 -- (-2639.025) [-2637.523] (-2641.605) (-2635.029) * [-2642.609] (-2645.150) (-2636.598) (-2643.770) -- 0:03:11
      99500 -- (-2642.859) (-2638.457) (-2633.596) [-2637.261] * (-2638.252) (-2651.632) (-2646.393) [-2638.236] -- 0:03:10
      100000 -- [-2639.694] (-2640.124) (-2637.973) (-2637.237) * (-2637.535) (-2645.168) (-2645.059) [-2635.551] -- 0:03:09

      Average standard deviation of split frequencies: 0.002341

      100500 -- (-2634.353) [-2647.189] (-2640.600) (-2634.753) * (-2636.275) (-2648.074) [-2635.276] (-2638.847) -- 0:03:07
      101000 -- (-2636.538) [-2649.197] (-2639.552) (-2638.304) * (-2637.145) [-2642.092] (-2639.447) (-2638.339) -- 0:03:06
      101500 -- (-2648.791) (-2645.952) [-2631.929] (-2642.253) * (-2649.263) (-2643.282) (-2645.147) [-2641.514] -- 0:03:05
      102000 -- (-2642.758) (-2641.981) (-2636.707) [-2637.855] * (-2639.661) [-2641.426] (-2643.478) (-2639.654) -- 0:03:04
      102500 -- (-2643.366) (-2638.798) (-2639.284) [-2640.175] * (-2642.683) (-2640.674) [-2640.647] (-2643.637) -- 0:03:03
      103000 -- (-2644.888) (-2639.078) [-2643.592] (-2640.624) * (-2635.973) (-2639.909) (-2637.767) [-2636.628] -- 0:03:02
      103500 -- [-2639.221] (-2634.603) (-2640.807) (-2643.394) * (-2633.132) [-2641.738] (-2637.430) (-2641.091) -- 0:03:10
      104000 -- [-2635.639] (-2641.988) (-2637.792) (-2639.339) * [-2639.570] (-2641.968) (-2639.851) (-2645.322) -- 0:03:09
      104500 -- (-2638.984) (-2639.368) [-2638.413] (-2638.108) * (-2638.374) [-2638.258] (-2642.833) (-2637.377) -- 0:03:08
      105000 -- (-2640.517) (-2642.467) (-2636.172) [-2641.515] * (-2641.269) [-2641.744] (-2642.922) (-2644.181) -- 0:03:07

      Average standard deviation of split frequencies: 0.002224

      105500 -- (-2638.876) [-2638.675] (-2644.910) (-2641.746) * (-2640.297) [-2639.603] (-2639.645) (-2644.772) -- 0:03:06
      106000 -- (-2641.069) (-2634.638) (-2639.401) [-2636.658] * (-2638.335) (-2641.455) (-2644.707) [-2636.173] -- 0:03:05
      106500 -- [-2636.942] (-2638.086) (-2643.463) (-2637.044) * (-2638.082) [-2644.780] (-2640.328) (-2637.573) -- 0:03:04
      107000 -- (-2638.804) (-2642.314) [-2640.237] (-2647.023) * (-2639.982) (-2637.967) [-2643.474] (-2638.557) -- 0:03:03
      107500 -- [-2639.886] (-2637.943) (-2641.913) (-2637.998) * (-2642.505) (-2636.104) (-2639.622) [-2642.163] -- 0:03:02
      108000 -- (-2636.206) [-2637.709] (-2639.880) (-2637.304) * (-2634.548) [-2638.468] (-2640.979) (-2637.519) -- 0:03:09
      108500 -- (-2640.645) (-2641.059) (-2637.156) [-2642.635] * [-2636.972] (-2636.007) (-2646.472) (-2638.128) -- 0:03:08
      109000 -- (-2638.448) (-2644.435) (-2635.445) [-2643.905] * [-2640.172] (-2638.622) (-2635.961) (-2636.667) -- 0:03:08
      109500 -- (-2641.415) (-2635.461) (-2648.059) [-2639.311] * [-2640.918] (-2643.195) (-2636.651) (-2641.672) -- 0:03:07
      110000 -- [-2638.120] (-2640.706) (-2639.253) (-2637.520) * (-2637.871) (-2636.226) [-2635.372] (-2644.069) -- 0:03:06

      Average standard deviation of split frequencies: 0.002130

      110500 -- [-2639.009] (-2647.922) (-2637.750) (-2632.227) * [-2641.505] (-2640.141) (-2636.716) (-2641.726) -- 0:03:05
      111000 -- [-2640.049] (-2653.107) (-2640.362) (-2641.304) * (-2642.044) [-2642.985] (-2637.206) (-2640.301) -- 0:03:04
      111500 -- (-2632.952) (-2647.888) [-2642.548] (-2637.790) * [-2637.868] (-2638.151) (-2638.328) (-2638.565) -- 0:03:03
      112000 -- (-2641.916) (-2654.404) (-2643.949) [-2636.217] * (-2634.034) [-2639.784] (-2642.258) (-2638.814) -- 0:03:02
      112500 -- [-2636.453] (-2644.530) (-2643.895) (-2635.711) * (-2640.129) [-2640.743] (-2643.366) (-2636.082) -- 0:03:01
      113000 -- (-2644.235) (-2638.431) [-2641.751] (-2638.424) * (-2648.486) (-2637.212) (-2648.366) [-2639.166] -- 0:03:08
      113500 -- (-2642.945) (-2635.994) (-2640.715) [-2633.224] * (-2637.732) (-2636.986) (-2645.099) [-2645.362] -- 0:03:07
      114000 -- (-2648.412) (-2639.888) [-2638.868] (-2641.525) * (-2642.015) [-2634.118] (-2643.292) (-2648.657) -- 0:03:06
      114500 -- (-2649.906) (-2640.639) (-2639.137) [-2639.255] * (-2638.394) (-2636.391) [-2635.935] (-2646.172) -- 0:03:05
      115000 -- (-2650.416) (-2640.771) (-2638.042) [-2637.258] * (-2644.985) [-2637.017] (-2644.211) (-2638.593) -- 0:03:04

      Average standard deviation of split frequencies: 0.002032

      115500 -- [-2643.445] (-2637.382) (-2638.104) (-2637.104) * (-2649.798) (-2637.764) [-2644.050] (-2642.540) -- 0:03:03
      116000 -- (-2641.345) (-2637.841) (-2643.492) [-2634.926] * (-2640.400) (-2642.799) [-2636.550] (-2639.641) -- 0:03:02
      116500 -- (-2639.605) (-2645.589) (-2638.079) [-2638.042] * (-2642.456) (-2640.093) [-2641.243] (-2641.876) -- 0:03:02
      117000 -- [-2643.672] (-2656.845) (-2647.399) (-2646.858) * [-2640.478] (-2641.473) (-2641.672) (-2642.868) -- 0:03:01
      117500 -- (-2645.400) (-2649.987) [-2643.181] (-2635.457) * (-2645.188) (-2641.687) (-2638.196) [-2641.023] -- 0:03:00
      118000 -- [-2640.154] (-2646.121) (-2637.247) (-2641.507) * (-2648.076) [-2637.093] (-2642.806) (-2642.854) -- 0:03:06
      118500 -- [-2640.349] (-2639.526) (-2639.629) (-2641.241) * (-2640.372) [-2636.988] (-2640.655) (-2638.703) -- 0:03:05
      119000 -- (-2638.951) (-2639.253) [-2636.717] (-2639.530) * (-2652.233) (-2642.297) [-2642.534] (-2641.639) -- 0:03:05
      119500 -- (-2645.350) [-2634.619] (-2638.584) (-2640.584) * (-2647.150) [-2639.286] (-2639.666) (-2640.562) -- 0:03:04
      120000 -- [-2640.570] (-2640.888) (-2645.207) (-2635.114) * (-2639.615) (-2640.641) [-2636.086] (-2641.839) -- 0:03:03

      Average standard deviation of split frequencies: 0.001953

      120500 -- (-2644.213) (-2639.081) [-2634.825] (-2636.976) * (-2635.289) [-2638.011] (-2636.574) (-2635.159) -- 0:03:02
      121000 -- (-2645.246) (-2643.016) (-2640.263) [-2639.115] * (-2635.985) [-2636.674] (-2646.446) (-2639.271) -- 0:03:01
      121500 -- (-2635.657) [-2639.511] (-2638.490) (-2640.754) * (-2639.866) [-2642.811] (-2639.487) (-2637.638) -- 0:03:00
      122000 -- (-2634.093) (-2643.213) (-2636.705) [-2638.708] * (-2640.189) (-2641.918) (-2637.355) [-2641.352] -- 0:02:59
      122500 -- (-2636.019) (-2639.578) [-2639.234] (-2640.521) * (-2643.838) [-2642.721] (-2642.275) (-2644.936) -- 0:02:59
      123000 -- (-2651.320) (-2643.167) [-2644.381] (-2642.146) * [-2639.451] (-2636.359) (-2638.707) (-2643.043) -- 0:03:05
      123500 -- [-2637.490] (-2639.215) (-2639.499) (-2641.582) * (-2641.297) (-2639.924) [-2637.445] (-2639.979) -- 0:03:04
      124000 -- [-2639.308] (-2640.359) (-2638.683) (-2644.696) * (-2635.968) (-2637.793) [-2641.498] (-2643.252) -- 0:03:03
      124500 -- (-2640.311) (-2636.595) [-2635.786] (-2637.701) * [-2638.026] (-2639.712) (-2639.364) (-2642.743) -- 0:03:02
      125000 -- (-2639.296) (-2639.239) [-2644.739] (-2639.921) * (-2643.965) (-2637.006) [-2636.947] (-2637.325) -- 0:03:02

      Average standard deviation of split frequencies: 0.001871

      125500 -- [-2639.500] (-2644.045) (-2643.655) (-2641.130) * (-2638.239) (-2645.893) [-2643.240] (-2644.245) -- 0:03:01
      126000 -- [-2638.081] (-2645.087) (-2638.783) (-2650.325) * [-2642.727] (-2654.549) (-2655.306) (-2637.578) -- 0:03:00
      126500 -- (-2641.768) (-2639.971) [-2634.803] (-2648.059) * [-2638.117] (-2648.464) (-2640.460) (-2639.222) -- 0:02:59
      127000 -- (-2640.366) (-2637.388) [-2635.377] (-2638.209) * (-2637.655) (-2643.475) [-2639.559] (-2642.432) -- 0:02:58
      127500 -- (-2633.854) (-2645.245) [-2641.428] (-2649.161) * [-2639.378] (-2642.326) (-2640.436) (-2647.428) -- 0:03:04
      128000 -- [-2639.133] (-2644.400) (-2643.689) (-2647.308) * (-2635.328) (-2644.086) [-2642.422] (-2637.030) -- 0:03:03
      128500 -- [-2632.814] (-2638.725) (-2648.350) (-2645.552) * (-2638.323) (-2638.318) (-2638.216) [-2638.447] -- 0:03:03
      129000 -- (-2638.725) (-2640.735) (-2644.050) [-2635.531] * [-2638.560] (-2641.599) (-2639.599) (-2637.026) -- 0:03:02
      129500 -- (-2645.931) (-2640.083) (-2641.624) [-2639.389] * (-2638.449) [-2643.375] (-2637.310) (-2643.176) -- 0:03:01
      130000 -- (-2646.189) [-2639.402] (-2639.628) (-2641.669) * (-2641.538) (-2636.839) (-2634.403) [-2636.377] -- 0:03:00

      Average standard deviation of split frequencies: 0.001804

      130500 -- [-2640.041] (-2637.744) (-2640.764) (-2635.821) * (-2643.085) (-2635.885) [-2638.020] (-2637.981) -- 0:02:59
      131000 -- (-2646.530) [-2636.654] (-2644.065) (-2635.697) * (-2633.264) [-2639.176] (-2639.496) (-2640.266) -- 0:02:59
      131500 -- (-2648.333) (-2643.632) (-2651.918) [-2636.906] * [-2641.028] (-2643.842) (-2641.416) (-2643.600) -- 0:02:58
      132000 -- (-2642.595) [-2635.919] (-2644.372) (-2639.501) * (-2644.725) (-2638.889) [-2638.967] (-2639.719) -- 0:02:57
      132500 -- (-2637.483) (-2639.972) [-2644.364] (-2641.523) * (-2643.813) (-2647.825) [-2635.969] (-2645.852) -- 0:03:03
      133000 -- [-2642.045] (-2641.571) (-2646.386) (-2646.213) * [-2638.773] (-2638.360) (-2646.299) (-2649.110) -- 0:03:02
      133500 -- (-2642.325) (-2652.620) [-2636.781] (-2644.314) * (-2636.903) [-2643.405] (-2636.348) (-2636.543) -- 0:03:01
      134000 -- (-2641.711) (-2643.353) [-2641.948] (-2644.222) * [-2642.147] (-2638.086) (-2636.647) (-2639.508) -- 0:03:00
      134500 -- [-2641.423] (-2645.052) (-2639.372) (-2638.933) * [-2640.195] (-2638.317) (-2643.967) (-2641.219) -- 0:03:00
      135000 -- [-2642.234] (-2645.268) (-2641.046) (-2646.152) * (-2636.739) (-2637.607) (-2646.652) [-2641.750] -- 0:02:59

      Average standard deviation of split frequencies: 0.001733

      135500 -- (-2642.726) [-2638.905] (-2641.837) (-2639.447) * (-2637.152) (-2644.880) [-2647.612] (-2642.823) -- 0:02:58
      136000 -- (-2641.386) [-2643.828] (-2643.364) (-2646.459) * (-2635.980) [-2638.055] (-2647.399) (-2638.382) -- 0:02:57
      136500 -- (-2639.191) [-2638.005] (-2639.729) (-2647.810) * (-2637.041) (-2640.192) [-2641.656] (-2643.849) -- 0:02:57
      137000 -- [-2640.698] (-2639.505) (-2637.608) (-2642.862) * (-2641.184) (-2640.121) [-2639.547] (-2640.086) -- 0:03:02
      137500 -- (-2641.419) (-2638.127) (-2638.891) [-2641.780] * [-2641.914] (-2644.203) (-2644.806) (-2637.651) -- 0:03:01
      138000 -- (-2645.765) [-2639.005] (-2640.896) (-2639.707) * (-2646.216) (-2638.167) (-2646.504) [-2636.336] -- 0:03:01
      138500 -- [-2637.140] (-2638.839) (-2640.553) (-2637.890) * [-2634.763] (-2643.424) (-2650.851) (-2636.100) -- 0:03:00
      139000 -- [-2640.122] (-2639.209) (-2642.125) (-2638.074) * (-2641.301) (-2640.859) (-2640.205) [-2639.181] -- 0:02:59
      139500 -- (-2647.174) [-2636.465] (-2636.723) (-2639.937) * (-2643.515) [-2641.326] (-2645.540) (-2641.538) -- 0:02:58
      140000 -- (-2641.000) [-2640.975] (-2637.835) (-2634.283) * (-2638.421) [-2635.229] (-2638.952) (-2649.492) -- 0:02:58

      Average standard deviation of split frequencies: 0.001676

      140500 -- (-2640.945) (-2645.308) (-2641.756) [-2637.927] * [-2643.375] (-2639.119) (-2636.223) (-2640.845) -- 0:02:57
      141000 -- (-2643.233) (-2639.408) (-2641.622) [-2638.726] * (-2639.467) (-2645.482) (-2637.568) [-2636.825] -- 0:02:56
      141500 -- [-2641.219] (-2636.938) (-2641.730) (-2639.195) * (-2638.520) (-2638.130) (-2638.907) [-2635.142] -- 0:02:55
      142000 -- (-2648.154) (-2638.892) [-2650.937] (-2638.154) * [-2642.753] (-2638.834) (-2646.622) (-2637.154) -- 0:03:01
      142500 -- [-2643.039] (-2637.411) (-2646.755) (-2638.171) * [-2634.073] (-2635.795) (-2645.068) (-2643.496) -- 0:03:00
      143000 -- (-2643.267) (-2647.237) [-2642.697] (-2641.406) * (-2642.971) [-2644.371] (-2642.233) (-2645.463) -- 0:02:59
      143500 -- (-2644.562) (-2646.014) (-2638.781) [-2639.783] * (-2639.662) [-2639.651] (-2644.865) (-2649.382) -- 0:02:59
      144000 -- (-2646.189) [-2641.638] (-2636.301) (-2643.430) * [-2638.303] (-2639.878) (-2645.013) (-2650.994) -- 0:02:58
      144500 -- (-2652.471) [-2645.275] (-2641.118) (-2640.403) * (-2640.838) (-2644.104) (-2642.579) [-2648.266] -- 0:02:57
      145000 -- (-2643.021) [-2641.692] (-2648.217) (-2640.547) * [-2649.618] (-2641.649) (-2639.587) (-2646.266) -- 0:02:56

      Average standard deviation of split frequencies: 0.001614

      145500 -- (-2642.004) (-2638.861) (-2646.330) [-2641.991] * (-2646.405) (-2644.269) [-2644.456] (-2642.498) -- 0:02:56
      146000 -- (-2641.629) (-2644.098) (-2646.386) [-2636.365] * (-2651.282) (-2643.825) (-2640.590) [-2642.179] -- 0:02:55
      146500 -- (-2645.051) [-2647.485] (-2640.871) (-2647.798) * (-2645.340) [-2637.057] (-2644.955) (-2644.608) -- 0:03:00
      147000 -- (-2634.022) (-2643.638) [-2638.688] (-2642.006) * (-2640.175) [-2636.995] (-2641.433) (-2638.728) -- 0:02:59
      147500 -- (-2642.769) [-2638.573] (-2645.330) (-2634.698) * (-2640.381) [-2647.997] (-2638.963) (-2642.705) -- 0:02:59
      148000 -- (-2654.191) (-2641.599) (-2639.329) [-2640.148] * [-2637.811] (-2646.828) (-2640.761) (-2639.685) -- 0:02:58
      148500 -- (-2657.787) (-2639.957) [-2638.190] (-2639.612) * [-2639.302] (-2645.187) (-2642.550) (-2644.610) -- 0:02:57
      149000 -- [-2639.209] (-2637.170) (-2638.650) (-2637.478) * (-2646.539) [-2639.279] (-2636.458) (-2639.904) -- 0:02:57
      149500 -- (-2640.396) (-2636.458) [-2637.276] (-2641.283) * [-2637.924] (-2640.080) (-2645.136) (-2639.706) -- 0:02:56
      150000 -- (-2638.704) (-2638.902) (-2646.137) [-2642.244] * (-2644.388) [-2637.399] (-2639.087) (-2643.302) -- 0:02:55

      Average standard deviation of split frequencies: 0.001564

      150500 -- [-2637.224] (-2643.556) (-2642.817) (-2648.150) * (-2638.750) (-2646.910) (-2640.700) [-2634.577] -- 0:02:54
      151000 -- [-2643.260] (-2636.431) (-2640.388) (-2642.443) * (-2636.927) (-2640.170) (-2646.869) [-2639.456] -- 0:02:54
      151500 -- (-2641.725) (-2637.514) [-2640.085] (-2654.054) * (-2638.688) [-2639.044] (-2643.341) (-2647.341) -- 0:02:59
      152000 -- (-2640.043) [-2640.583] (-2645.919) (-2645.416) * (-2638.524) (-2636.898) [-2640.590] (-2642.288) -- 0:02:58
      152500 -- (-2637.387) (-2637.628) [-2635.715] (-2646.854) * (-2639.035) (-2634.879) [-2639.930] (-2643.375) -- 0:02:57
      153000 -- (-2645.633) (-2637.821) (-2637.547) [-2642.602] * (-2634.126) [-2640.508] (-2638.419) (-2640.676) -- 0:02:57
      153500 -- [-2636.565] (-2641.124) (-2641.083) (-2640.959) * (-2640.962) (-2653.297) (-2643.508) [-2638.975] -- 0:02:56
      154000 -- (-2638.505) [-2635.680] (-2639.281) (-2643.446) * (-2636.401) (-2637.633) (-2640.483) [-2640.479] -- 0:02:55
      154500 -- (-2644.099) [-2641.777] (-2648.613) (-2641.114) * (-2647.127) (-2642.842) (-2636.433) [-2638.511] -- 0:02:55
      155000 -- (-2639.401) [-2638.403] (-2646.891) (-2642.806) * (-2642.540) (-2646.163) [-2639.824] (-2642.289) -- 0:02:54

      Average standard deviation of split frequencies: 0.001511

      155500 -- (-2640.679) [-2638.779] (-2641.011) (-2639.660) * [-2637.300] (-2635.863) (-2638.038) (-2633.076) -- 0:02:53
      156000 -- (-2639.041) (-2644.736) [-2634.641] (-2637.642) * (-2642.631) (-2642.512) (-2644.526) [-2636.282] -- 0:02:58
      156500 -- (-2641.314) (-2642.488) (-2640.933) [-2644.352] * (-2639.368) (-2650.268) [-2642.464] (-2638.983) -- 0:02:57
      157000 -- [-2636.312] (-2637.396) (-2637.036) (-2639.907) * (-2639.666) (-2642.329) (-2642.642) [-2638.645] -- 0:02:57
      157500 -- (-2641.858) (-2639.390) [-2638.444] (-2636.527) * (-2642.904) (-2644.101) (-2645.339) [-2637.582] -- 0:02:56
      158000 -- (-2637.377) [-2640.143] (-2638.171) (-2637.923) * (-2638.504) (-2644.517) [-2637.122] (-2645.021) -- 0:02:55
      158500 -- (-2640.613) (-2639.299) (-2640.804) [-2644.222] * (-2636.095) [-2638.267] (-2640.577) (-2640.620) -- 0:02:55
      159000 -- [-2635.379] (-2635.803) (-2641.252) (-2641.074) * (-2641.104) [-2644.583] (-2637.876) (-2636.590) -- 0:02:54
      159500 -- (-2640.137) [-2638.821] (-2642.944) (-2638.915) * [-2636.928] (-2638.575) (-2642.656) (-2632.028) -- 0:02:53
      160000 -- (-2639.502) (-2639.998) [-2640.775] (-2637.377) * (-2643.220) (-2637.070) [-2641.269] (-2636.266) -- 0:02:53

      Average standard deviation of split frequencies: 0.001467

      160500 -- (-2644.529) [-2635.061] (-2648.545) (-2638.519) * (-2642.543) (-2641.529) [-2634.361] (-2640.155) -- 0:02:52
      161000 -- (-2638.790) [-2639.234] (-2644.346) (-2637.063) * (-2637.739) (-2640.803) [-2634.547] (-2644.647) -- 0:02:57
      161500 -- (-2639.361) (-2637.810) (-2644.303) [-2644.217] * (-2639.266) (-2638.939) [-2635.031] (-2649.800) -- 0:02:56
      162000 -- (-2640.689) (-2642.465) (-2640.154) [-2644.187] * [-2636.008] (-2635.281) (-2646.854) (-2641.038) -- 0:02:55
      162500 -- (-2636.855) (-2647.470) [-2640.527] (-2639.880) * [-2637.885] (-2647.189) (-2641.924) (-2644.683) -- 0:02:55
      163000 -- [-2639.117] (-2643.897) (-2648.152) (-2639.374) * (-2647.124) [-2634.890] (-2638.117) (-2646.444) -- 0:02:54
      163500 -- [-2642.507] (-2642.432) (-2654.135) (-2642.757) * (-2641.348) (-2642.574) (-2639.647) [-2637.793] -- 0:02:53
      164000 -- (-2639.758) (-2641.487) (-2642.081) [-2642.406] * (-2644.694) (-2642.181) [-2640.494] (-2649.808) -- 0:02:53
      164500 -- [-2641.217] (-2640.017) (-2648.166) (-2644.986) * [-2639.678] (-2642.006) (-2637.502) (-2640.332) -- 0:02:52
      165000 -- (-2658.525) [-2637.622] (-2652.718) (-2638.539) * (-2639.616) [-2635.761] (-2636.824) (-2643.787) -- 0:02:52

      Average standard deviation of split frequencies: 0.001420

      165500 -- (-2641.660) (-2641.262) (-2635.236) [-2638.571] * (-2641.419) [-2635.513] (-2641.468) (-2637.102) -- 0:02:51
      166000 -- [-2643.414] (-2635.513) (-2638.807) (-2642.370) * [-2642.359] (-2635.955) (-2638.488) (-2642.833) -- 0:02:55
      166500 -- (-2641.785) (-2639.560) [-2635.734] (-2641.299) * (-2643.389) (-2644.510) [-2642.752] (-2639.000) -- 0:02:55
      167000 -- (-2643.632) (-2640.865) [-2647.893] (-2636.813) * (-2641.763) [-2642.929] (-2644.065) (-2641.281) -- 0:02:54
      167500 -- (-2642.522) [-2637.193] (-2636.929) (-2643.368) * (-2639.279) (-2635.311) (-2642.066) [-2640.402] -- 0:02:53
      168000 -- (-2640.582) [-2637.796] (-2645.981) (-2638.611) * (-2647.234) [-2635.835] (-2645.060) (-2639.809) -- 0:02:53
      168500 -- (-2639.131) (-2648.211) (-2642.871) [-2637.828] * (-2639.291) [-2641.039] (-2648.264) (-2638.935) -- 0:02:52
      169000 -- (-2641.912) (-2635.787) [-2641.976] (-2639.953) * (-2647.311) (-2643.093) [-2639.640] (-2641.681) -- 0:02:52
      169500 -- (-2642.237) [-2638.867] (-2642.033) (-2644.386) * (-2640.338) (-2640.569) (-2636.945) [-2645.560] -- 0:02:51
      170000 -- [-2632.931] (-2638.257) (-2641.987) (-2637.160) * [-2637.740] (-2642.677) (-2635.385) (-2644.216) -- 0:02:50

      Average standard deviation of split frequencies: 0.001381

      170500 -- (-2639.538) [-2644.139] (-2637.750) (-2642.746) * (-2640.452) [-2638.911] (-2639.461) (-2635.420) -- 0:02:55
      171000 -- (-2640.323) (-2643.863) [-2642.796] (-2640.041) * [-2637.406] (-2646.706) (-2637.178) (-2640.974) -- 0:02:54
      171500 -- (-2642.571) (-2648.616) (-2648.425) [-2640.641] * (-2640.094) (-2636.409) (-2640.965) [-2636.272] -- 0:02:53
      172000 -- [-2638.266] (-2640.810) (-2647.892) (-2638.756) * (-2644.134) (-2647.308) (-2641.351) [-2638.861] -- 0:02:53
      172500 -- (-2641.457) [-2638.719] (-2646.913) (-2639.881) * (-2641.196) (-2649.003) [-2637.232] (-2637.608) -- 0:02:52
      173000 -- (-2637.176) [-2636.419] (-2643.953) (-2635.354) * [-2639.320] (-2636.807) (-2642.816) (-2641.060) -- 0:02:52
      173500 -- [-2639.739] (-2636.433) (-2652.489) (-2640.965) * (-2649.074) (-2634.979) [-2639.393] (-2645.334) -- 0:02:51
      174000 -- (-2640.913) (-2647.693) (-2648.452) [-2636.123] * (-2644.218) [-2641.922] (-2636.960) (-2640.705) -- 0:02:50
      174500 -- (-2635.806) [-2636.962] (-2643.811) (-2634.183) * (-2639.393) [-2638.712] (-2650.098) (-2640.897) -- 0:02:50
      175000 -- (-2640.914) (-2636.335) (-2644.356) [-2638.165] * (-2643.946) (-2639.048) (-2649.736) [-2637.164] -- 0:02:49

      Average standard deviation of split frequencies: 0.001339

      175500 -- (-2645.286) [-2638.180] (-2639.793) (-2641.543) * (-2640.341) (-2638.334) [-2646.038] (-2639.929) -- 0:02:53
      176000 -- (-2654.524) [-2633.968] (-2646.166) (-2640.887) * (-2641.513) (-2641.088) (-2642.367) [-2643.245] -- 0:02:53
      176500 -- [-2638.199] (-2637.074) (-2636.718) (-2646.563) * (-2638.192) [-2639.040] (-2644.185) (-2638.703) -- 0:02:52
      177000 -- (-2636.834) (-2636.806) [-2640.317] (-2650.492) * [-2641.895] (-2641.113) (-2648.207) (-2646.919) -- 0:02:52
      177500 -- (-2639.964) [-2639.842] (-2644.336) (-2640.612) * (-2636.392) (-2646.383) (-2644.489) [-2643.642] -- 0:02:51
      178000 -- (-2642.874) (-2638.891) (-2649.846) [-2642.731] * [-2637.828] (-2638.088) (-2641.322) (-2638.993) -- 0:02:50
      178500 -- (-2641.352) (-2638.305) (-2643.062) [-2639.160] * (-2633.211) [-2640.858] (-2637.475) (-2643.539) -- 0:02:50
      179000 -- (-2646.307) [-2643.252] (-2645.340) (-2638.083) * (-2638.042) (-2641.769) [-2632.652] (-2645.941) -- 0:02:49
      179500 -- (-2647.056) [-2639.915] (-2644.925) (-2645.958) * (-2641.778) (-2640.067) [-2643.381] (-2639.556) -- 0:02:49
      180000 -- (-2637.525) (-2639.344) [-2637.595] (-2640.332) * (-2636.571) [-2644.718] (-2636.566) (-2644.375) -- 0:02:53

      Average standard deviation of split frequencies: 0.001305

      180500 -- (-2637.178) [-2635.716] (-2638.066) (-2637.981) * (-2650.566) (-2641.087) [-2636.631] (-2639.573) -- 0:02:52
      181000 -- (-2639.317) [-2639.780] (-2637.095) (-2642.829) * (-2636.888) [-2645.067] (-2638.631) (-2646.304) -- 0:02:51
      181500 -- (-2640.704) (-2637.253) (-2638.377) [-2635.736] * (-2646.441) [-2644.862] (-2637.193) (-2642.741) -- 0:02:51
      182000 -- [-2640.501] (-2643.279) (-2654.186) (-2641.268) * (-2642.104) (-2641.867) (-2641.114) [-2640.682] -- 0:02:50
      182500 -- (-2642.568) (-2642.725) [-2639.562] (-2638.117) * [-2636.224] (-2645.652) (-2636.732) (-2643.797) -- 0:02:50
      183000 -- (-2646.921) (-2637.103) (-2645.573) [-2640.019] * (-2638.329) [-2639.575] (-2640.802) (-2644.440) -- 0:02:49
      183500 -- (-2639.612) [-2637.538] (-2643.245) (-2635.108) * (-2635.303) [-2638.882] (-2637.833) (-2637.392) -- 0:02:49
      184000 -- [-2642.016] (-2637.528) (-2641.053) (-2636.541) * [-2636.304] (-2645.898) (-2642.139) (-2647.470) -- 0:02:48
      184500 -- (-2644.008) (-2643.262) (-2642.781) [-2634.456] * (-2640.365) [-2636.854] (-2637.739) (-2637.687) -- 0:02:47
      185000 -- [-2645.642] (-2640.929) (-2643.693) (-2640.606) * [-2642.290] (-2644.797) (-2633.190) (-2643.032) -- 0:02:51

      Average standard deviation of split frequencies: 0.001267

      185500 -- [-2642.813] (-2637.664) (-2637.332) (-2636.141) * [-2643.468] (-2640.060) (-2643.227) (-2641.278) -- 0:02:51
      186000 -- [-2636.140] (-2647.383) (-2644.664) (-2633.829) * [-2640.461] (-2639.997) (-2639.489) (-2650.880) -- 0:02:50
      186500 -- (-2639.578) (-2643.790) (-2640.485) [-2642.123] * [-2638.502] (-2638.675) (-2636.838) (-2636.418) -- 0:02:50
      187000 -- (-2640.871) [-2642.294] (-2638.905) (-2643.544) * [-2637.635] (-2638.693) (-2638.584) (-2637.780) -- 0:02:49
      187500 -- (-2646.670) (-2645.209) [-2638.445] (-2636.482) * [-2644.220] (-2640.731) (-2645.279) (-2636.570) -- 0:02:49
      188000 -- (-2646.872) [-2637.490] (-2643.882) (-2639.002) * (-2637.684) [-2648.053] (-2643.279) (-2644.096) -- 0:02:48
      188500 -- (-2643.017) (-2640.069) (-2646.352) [-2640.354] * (-2634.566) (-2636.807) (-2636.502) [-2635.692] -- 0:02:47
      189000 -- (-2646.099) (-2642.452) (-2638.061) [-2636.156] * [-2635.037] (-2636.847) (-2637.184) (-2639.413) -- 0:02:47
      189500 -- [-2648.755] (-2645.264) (-2649.386) (-2636.927) * (-2644.585) (-2641.157) (-2642.577) [-2648.086] -- 0:02:51
      190000 -- (-2637.359) (-2641.628) [-2639.604] (-2635.130) * (-2638.156) (-2634.622) [-2636.741] (-2644.775) -- 0:02:50

      Average standard deviation of split frequencies: 0.001236

      190500 -- (-2641.079) (-2641.643) [-2638.144] (-2638.070) * (-2641.181) [-2640.256] (-2639.134) (-2650.764) -- 0:02:49
      191000 -- [-2637.919] (-2639.660) (-2642.021) (-2640.187) * [-2636.846] (-2641.368) (-2644.616) (-2643.590) -- 0:02:49
      191500 -- [-2637.994] (-2640.959) (-2641.801) (-2641.723) * (-2636.959) (-2638.795) [-2642.854] (-2649.639) -- 0:02:48
      192000 -- (-2644.848) [-2641.407] (-2642.003) (-2642.372) * (-2639.433) [-2642.285] (-2644.927) (-2642.380) -- 0:02:48
      192500 -- (-2639.091) (-2642.716) (-2644.841) [-2640.058] * [-2641.064] (-2642.681) (-2640.465) (-2648.282) -- 0:02:47
      193000 -- (-2643.692) (-2639.342) [-2642.931] (-2641.880) * (-2644.282) [-2643.400] (-2640.481) (-2638.568) -- 0:02:47
      193500 -- (-2643.985) (-2637.660) [-2634.596] (-2643.512) * [-2636.683] (-2639.143) (-2647.820) (-2636.415) -- 0:02:46
      194000 -- [-2638.091] (-2640.839) (-2639.087) (-2648.004) * [-2644.688] (-2638.694) (-2640.730) (-2635.169) -- 0:02:46
      194500 -- (-2645.944) (-2637.733) (-2646.852) [-2636.839] * (-2638.283) (-2640.332) (-2643.634) [-2639.360] -- 0:02:49
      195000 -- (-2647.077) (-2638.492) [-2640.437] (-2643.929) * (-2642.027) [-2640.247] (-2638.784) (-2642.183) -- 0:02:49

      Average standard deviation of split frequencies: 0.001203

      195500 -- (-2636.229) (-2638.545) [-2640.068] (-2643.385) * [-2638.539] (-2636.271) (-2640.716) (-2642.022) -- 0:02:48
      196000 -- (-2638.923) (-2643.222) [-2637.475] (-2636.345) * (-2644.577) [-2640.523] (-2640.593) (-2641.486) -- 0:02:48
      196500 -- (-2642.030) (-2641.323) [-2640.295] (-2636.867) * (-2635.719) (-2639.877) [-2644.134] (-2645.593) -- 0:02:47
      197000 -- (-2648.963) [-2642.119] (-2645.697) (-2643.044) * [-2635.263] (-2637.016) (-2638.957) (-2639.601) -- 0:02:47
      197500 -- (-2644.248) (-2642.507) (-2637.524) [-2643.608] * (-2637.313) (-2645.281) [-2639.330] (-2642.685) -- 0:02:46
      198000 -- (-2637.147) (-2635.506) (-2645.345) [-2646.887] * (-2639.502) [-2644.108] (-2642.949) (-2643.470) -- 0:02:46
      198500 -- (-2649.653) [-2640.341] (-2643.533) (-2643.609) * [-2638.436] (-2646.551) (-2644.190) (-2640.349) -- 0:02:45
      199000 -- (-2648.439) (-2634.214) [-2649.099] (-2646.543) * (-2642.955) (-2642.092) (-2640.570) [-2642.945] -- 0:02:49
      199500 -- (-2643.929) (-2640.933) (-2635.676) [-2639.447] * (-2642.073) [-2641.222] (-2637.127) (-2634.293) -- 0:02:48
      200000 -- (-2644.461) [-2637.621] (-2639.966) (-2637.130) * (-2639.842) (-2647.529) [-2639.034] (-2637.687) -- 0:02:48

      Average standard deviation of split frequencies: 0.001175

      200500 -- (-2639.129) [-2640.151] (-2640.737) (-2639.709) * [-2637.598] (-2647.947) (-2642.622) (-2639.986) -- 0:02:47
      201000 -- [-2634.814] (-2642.053) (-2637.807) (-2637.361) * (-2639.506) [-2637.333] (-2648.344) (-2636.330) -- 0:02:46
      201500 -- [-2637.825] (-2641.906) (-2637.077) (-2641.972) * (-2642.747) [-2641.010] (-2647.472) (-2636.571) -- 0:02:46
      202000 -- [-2643.123] (-2639.527) (-2643.432) (-2642.679) * (-2634.936) (-2645.877) (-2641.131) [-2638.003] -- 0:02:45
      202500 -- (-2641.988) (-2642.800) (-2640.524) [-2644.566] * (-2637.708) (-2646.167) [-2640.742] (-2638.927) -- 0:02:45
      203000 -- [-2642.237] (-2644.409) (-2641.507) (-2641.999) * (-2637.414) [-2644.211] (-2643.501) (-2643.146) -- 0:02:44
      203500 -- (-2644.719) (-2636.962) (-2638.424) [-2638.674] * (-2642.192) (-2639.019) [-2641.180] (-2639.309) -- 0:02:44
      204000 -- (-2644.959) [-2635.701] (-2639.255) (-2639.957) * (-2640.849) (-2636.579) (-2641.412) [-2636.006] -- 0:02:47
      204500 -- (-2640.299) [-2638.036] (-2649.006) (-2638.387) * (-2642.181) (-2641.404) [-2637.293] (-2637.353) -- 0:02:47
      205000 -- [-2637.447] (-2638.671) (-2637.889) (-2645.156) * (-2637.750) [-2643.312] (-2644.750) (-2636.420) -- 0:02:46

      Average standard deviation of split frequencies: 0.001144

      205500 -- (-2641.626) (-2644.648) [-2643.434] (-2642.405) * (-2641.537) (-2642.689) (-2646.819) [-2637.974] -- 0:02:46
      206000 -- (-2639.941) [-2654.306] (-2643.104) (-2642.070) * (-2640.687) (-2638.292) [-2643.542] (-2646.820) -- 0:02:45
      206500 -- (-2636.635) (-2640.729) (-2643.465) [-2637.739] * [-2634.311] (-2635.926) (-2632.870) (-2643.292) -- 0:02:45
      207000 -- (-2645.304) (-2639.628) (-2641.612) [-2640.099] * (-2635.574) [-2643.096] (-2640.029) (-2637.710) -- 0:02:44
      207500 -- (-2638.564) [-2636.851] (-2647.894) (-2638.197) * (-2641.580) (-2638.359) (-2641.331) [-2641.355] -- 0:02:44
      208000 -- [-2642.512] (-2648.399) (-2639.279) (-2639.633) * [-2641.099] (-2643.452) (-2637.935) (-2637.796) -- 0:02:43
      208500 -- [-2639.951] (-2642.435) (-2643.679) (-2643.894) * (-2641.778) (-2640.485) [-2637.277] (-2636.263) -- 0:02:47
      209000 -- (-2640.195) [-2639.247] (-2647.040) (-2637.703) * (-2640.610) (-2643.518) [-2636.134] (-2649.242) -- 0:02:46
      209500 -- (-2644.413) [-2637.649] (-2638.057) (-2634.663) * (-2642.243) [-2649.005] (-2638.202) (-2637.702) -- 0:02:46
      210000 -- (-2644.018) [-2636.903] (-2639.313) (-2644.437) * [-2637.340] (-2646.709) (-2639.756) (-2642.467) -- 0:02:45

      Average standard deviation of split frequencies: 0.001119

      210500 -- [-2639.002] (-2640.529) (-2641.418) (-2640.533) * (-2640.331) [-2638.240] (-2643.642) (-2639.080) -- 0:02:45
      211000 -- (-2635.855) [-2640.182] (-2645.094) (-2640.679) * (-2640.501) (-2637.794) [-2642.355] (-2645.505) -- 0:02:44
      211500 -- (-2649.431) (-2641.839) (-2643.761) [-2637.589] * (-2636.757) (-2643.690) (-2637.776) [-2638.230] -- 0:02:44
      212000 -- (-2643.635) (-2643.228) (-2638.472) [-2635.171] * [-2642.433] (-2637.492) (-2638.829) (-2638.693) -- 0:02:43
      212500 -- [-2639.482] (-2646.297) (-2648.027) (-2638.906) * (-2636.754) (-2642.743) (-2637.787) [-2635.306] -- 0:02:43
      213000 -- (-2642.820) [-2642.578] (-2640.235) (-2650.483) * (-2637.291) (-2634.406) (-2640.474) [-2636.796] -- 0:02:42
      213500 -- [-2637.101] (-2641.538) (-2644.133) (-2639.339) * (-2645.460) (-2635.982) (-2640.932) [-2638.402] -- 0:02:45
      214000 -- [-2637.681] (-2646.189) (-2636.778) (-2640.883) * (-2636.008) (-2639.391) (-2640.480) [-2637.749] -- 0:02:45
      214500 -- [-2641.001] (-2637.561) (-2641.757) (-2636.665) * (-2637.070) (-2637.173) (-2638.573) [-2641.604] -- 0:02:44
      215000 -- (-2638.449) (-2642.602) (-2645.554) [-2636.201] * (-2636.785) (-2641.764) [-2635.244] (-2640.423) -- 0:02:44

      Average standard deviation of split frequencies: 0.001091

      215500 -- (-2641.617) (-2635.729) (-2641.752) [-2637.720] * (-2636.308) (-2647.130) [-2637.357] (-2650.291) -- 0:02:43
      216000 -- (-2636.572) (-2642.403) [-2646.754] (-2643.415) * [-2639.411] (-2642.292) (-2636.328) (-2637.949) -- 0:02:43
      216500 -- (-2643.262) (-2635.920) (-2635.563) [-2639.145] * [-2638.296] (-2643.795) (-2636.821) (-2638.483) -- 0:02:42
      217000 -- [-2643.405] (-2639.475) (-2639.972) (-2636.503) * [-2641.575] (-2649.166) (-2636.808) (-2640.678) -- 0:02:42
      217500 -- (-2642.904) (-2641.746) [-2635.328] (-2640.814) * (-2648.476) (-2649.928) (-2640.014) [-2635.075] -- 0:02:41
      218000 -- (-2645.175) (-2638.336) [-2639.505] (-2636.911) * (-2640.304) (-2641.561) [-2634.397] (-2642.160) -- 0:02:41
      218500 -- (-2638.565) (-2635.081) [-2636.134] (-2639.901) * (-2639.965) (-2642.476) [-2637.629] (-2635.261) -- 0:02:44
      219000 -- [-2643.244] (-2638.122) (-2641.431) (-2639.841) * (-2642.514) (-2638.418) [-2633.144] (-2640.719) -- 0:02:44
      219500 -- (-2636.810) [-2642.920] (-2645.643) (-2644.404) * (-2642.100) [-2637.715] (-2638.546) (-2640.890) -- 0:02:43
      220000 -- [-2648.557] (-2639.690) (-2637.174) (-2649.929) * (-2637.702) (-2636.794) [-2635.813] (-2644.382) -- 0:02:43

      Average standard deviation of split frequencies: 0.001068

      220500 -- (-2639.476) (-2642.029) (-2647.407) [-2636.252] * [-2641.722] (-2636.715) (-2636.438) (-2641.923) -- 0:02:42
      221000 -- (-2638.120) [-2635.137] (-2642.060) (-2640.629) * (-2640.026) (-2640.027) [-2637.067] (-2638.971) -- 0:02:42
      221500 -- [-2638.245] (-2642.716) (-2641.648) (-2636.200) * (-2640.790) (-2637.587) [-2635.228] (-2643.289) -- 0:02:41
      222000 -- (-2637.455) [-2641.012] (-2643.968) (-2641.343) * (-2641.608) (-2640.103) (-2639.455) [-2641.906] -- 0:02:41
      222500 -- (-2637.384) (-2637.935) (-2636.569) [-2636.792] * [-2636.682] (-2636.108) (-2638.014) (-2643.929) -- 0:02:40
      223000 -- (-2640.935) [-2639.416] (-2643.331) (-2645.893) * (-2639.528) (-2637.044) [-2641.259] (-2646.614) -- 0:02:43
      223500 -- (-2645.223) [-2634.921] (-2642.537) (-2645.905) * [-2641.769] (-2635.556) (-2642.103) (-2648.549) -- 0:02:43
      224000 -- (-2642.152) (-2635.609) [-2645.235] (-2639.595) * (-2635.800) (-2639.609) (-2635.809) [-2637.278] -- 0:02:42
      224500 -- (-2646.415) (-2645.828) (-2642.207) [-2640.931] * (-2643.091) (-2640.424) (-2645.133) [-2637.835] -- 0:02:42
      225000 -- (-2635.418) (-2640.522) [-2640.075] (-2648.231) * [-2642.637] (-2638.353) (-2640.025) (-2640.682) -- 0:02:41

      Average standard deviation of split frequencies: 0.001043

      225500 -- (-2637.185) (-2645.456) [-2642.199] (-2643.569) * [-2639.850] (-2639.233) (-2636.714) (-2642.376) -- 0:02:41
      226000 -- (-2639.239) (-2642.020) (-2647.941) [-2637.222] * (-2639.141) (-2648.100) (-2638.268) [-2644.274] -- 0:02:40
      226500 -- [-2641.384] (-2637.865) (-2641.383) (-2635.526) * (-2644.408) (-2646.958) [-2642.931] (-2637.247) -- 0:02:40
      227000 -- (-2641.300) (-2643.769) (-2639.148) [-2636.058] * [-2647.936] (-2645.378) (-2640.824) (-2641.906) -- 0:02:40
      227500 -- (-2637.199) (-2643.808) [-2636.988] (-2641.350) * (-2641.333) (-2640.478) (-2634.394) [-2641.176] -- 0:02:39
      228000 -- (-2637.575) (-2639.569) [-2637.864] (-2640.059) * (-2646.501) (-2644.610) (-2641.816) [-2638.560] -- 0:02:42
      228500 -- (-2638.252) (-2646.736) (-2641.083) [-2636.457] * [-2645.910] (-2643.881) (-2643.958) (-2643.347) -- 0:02:42
      229000 -- (-2639.638) (-2641.603) [-2637.407] (-2642.018) * [-2644.240] (-2642.637) (-2645.035) (-2639.082) -- 0:02:41
      229500 -- (-2643.620) (-2638.620) (-2635.032) [-2644.090] * (-2643.524) (-2643.310) (-2641.422) [-2639.135] -- 0:02:41
      230000 -- (-2641.557) (-2638.239) [-2644.181] (-2640.272) * (-2643.672) (-2643.277) (-2639.137) [-2642.289] -- 0:02:40

      Average standard deviation of split frequencies: 0.001022

      230500 -- (-2644.814) (-2638.516) (-2643.272) [-2639.904] * (-2652.338) (-2641.883) [-2634.889] (-2645.819) -- 0:02:40
      231000 -- (-2640.845) (-2637.066) [-2640.836] (-2641.338) * (-2650.688) (-2634.742) [-2639.759] (-2644.756) -- 0:02:39
      231500 -- (-2639.871) (-2641.338) (-2639.142) [-2634.428] * (-2643.933) (-2639.083) (-2641.852) [-2638.327] -- 0:02:39
      232000 -- (-2640.204) (-2640.830) (-2639.509) [-2634.806] * [-2641.745] (-2638.128) (-2634.761) (-2644.899) -- 0:02:38
      232500 -- (-2642.387) (-2640.149) [-2639.703] (-2641.907) * (-2638.239) [-2638.558] (-2636.205) (-2644.850) -- 0:02:38
      233000 -- (-2650.417) (-2637.727) (-2637.658) [-2638.775] * [-2639.127] (-2644.764) (-2641.537) (-2641.897) -- 0:02:41
      233500 -- (-2652.385) [-2639.323] (-2648.531) (-2639.638) * (-2636.629) [-2642.647] (-2638.761) (-2637.680) -- 0:02:40
      234000 -- (-2648.344) (-2640.670) (-2639.073) [-2645.386] * (-2641.601) (-2639.844) (-2639.543) [-2639.719] -- 0:02:40
      234500 -- (-2644.014) (-2638.711) (-2644.567) [-2642.795] * (-2641.673) [-2646.928] (-2642.244) (-2642.051) -- 0:02:39
      235000 -- [-2641.397] (-2648.232) (-2638.193) (-2640.601) * (-2639.316) [-2637.704] (-2640.318) (-2638.043) -- 0:02:39

      Average standard deviation of split frequencies: 0.000999

      235500 -- (-2647.860) (-2643.180) [-2637.150] (-2640.352) * (-2640.740) (-2642.699) [-2633.012] (-2642.998) -- 0:02:39
      236000 -- (-2643.089) (-2639.431) (-2645.522) [-2636.403] * (-2640.914) [-2638.757] (-2640.187) (-2635.845) -- 0:02:38
      236500 -- (-2647.772) (-2647.359) [-2638.267] (-2635.223) * (-2640.134) [-2642.970] (-2638.701) (-2637.217) -- 0:02:38
      237000 -- [-2637.173] (-2646.214) (-2637.378) (-2642.686) * (-2639.293) [-2639.020] (-2640.442) (-2646.929) -- 0:02:37
      237500 -- (-2642.953) (-2642.487) (-2640.113) [-2638.974] * (-2637.992) [-2637.788] (-2640.148) (-2640.591) -- 0:02:40
      238000 -- (-2647.174) [-2639.850] (-2644.382) (-2645.117) * (-2642.185) [-2640.335] (-2640.350) (-2643.076) -- 0:02:40
      238500 -- (-2643.200) (-2642.355) [-2639.230] (-2643.105) * (-2640.155) (-2640.349) (-2640.119) [-2635.496] -- 0:02:39
      239000 -- (-2639.286) [-2636.574] (-2635.861) (-2640.042) * (-2639.172) [-2640.303] (-2636.112) (-2642.685) -- 0:02:39
      239500 -- (-2641.929) (-2644.264) [-2637.073] (-2653.209) * (-2639.592) (-2640.631) [-2643.699] (-2641.597) -- 0:02:38
      240000 -- (-2642.697) [-2637.746] (-2639.819) (-2650.307) * (-2638.369) (-2636.989) (-2650.328) [-2640.711] -- 0:02:38

      Average standard deviation of split frequencies: 0.000979

      240500 -- (-2641.752) [-2638.328] (-2639.176) (-2642.491) * (-2640.282) [-2643.568] (-2647.213) (-2642.017) -- 0:02:37
      241000 -- (-2642.836) (-2635.760) (-2641.840) [-2641.107] * (-2637.925) [-2646.684] (-2641.050) (-2640.623) -- 0:02:37
      241500 -- (-2635.868) (-2640.019) [-2637.227] (-2643.801) * [-2637.118] (-2645.466) (-2642.061) (-2636.894) -- 0:02:37
      242000 -- [-2642.102] (-2639.246) (-2643.005) (-2644.755) * (-2640.292) (-2641.689) [-2640.851] (-2636.248) -- 0:02:36
      242500 -- (-2644.443) (-2639.973) [-2640.044] (-2644.863) * [-2635.683] (-2639.728) (-2637.563) (-2640.813) -- 0:02:39
      243000 -- (-2638.163) [-2638.343] (-2638.411) (-2641.513) * (-2636.459) [-2635.072] (-2653.115) (-2641.078) -- 0:02:38
      243500 -- [-2635.376] (-2645.403) (-2652.532) (-2641.411) * [-2634.854] (-2642.055) (-2646.039) (-2638.226) -- 0:02:38
      244000 -- (-2638.140) [-2639.445] (-2640.335) (-2637.746) * [-2642.332] (-2638.989) (-2645.691) (-2639.328) -- 0:02:38
      244500 -- (-2640.160) (-2639.858) [-2634.021] (-2640.622) * (-2639.142) (-2639.971) (-2635.647) [-2636.018] -- 0:02:37
      245000 -- (-2638.107) (-2640.309) [-2638.499] (-2644.827) * (-2642.340) (-2638.958) (-2640.687) [-2638.446] -- 0:02:37

      Average standard deviation of split frequencies: 0.000958

      245500 -- [-2640.359] (-2641.073) (-2634.649) (-2645.173) * (-2636.943) (-2644.886) (-2638.657) [-2635.926] -- 0:02:36
      246000 -- (-2638.352) (-2643.422) [-2637.377] (-2652.039) * (-2637.771) (-2639.876) (-2643.126) [-2638.941] -- 0:02:36
      246500 -- (-2637.372) [-2640.269] (-2644.299) (-2638.916) * (-2634.347) [-2647.213] (-2641.091) (-2638.272) -- 0:02:35
      247000 -- (-2632.728) (-2642.909) [-2639.323] (-2641.098) * (-2634.610) (-2645.707) (-2637.307) [-2638.806] -- 0:02:35
      247500 -- (-2645.129) [-2639.220] (-2643.603) (-2646.207) * (-2635.675) (-2648.040) (-2639.283) [-2636.024] -- 0:02:38
      248000 -- (-2647.909) [-2642.428] (-2645.854) (-2653.418) * [-2637.916] (-2640.363) (-2643.731) (-2639.785) -- 0:02:37
      248500 -- [-2640.893] (-2636.853) (-2649.542) (-2642.078) * (-2635.658) [-2637.874] (-2648.479) (-2644.796) -- 0:02:37
      249000 -- (-2638.273) [-2640.644] (-2641.238) (-2642.304) * [-2637.559] (-2641.371) (-2640.581) (-2638.846) -- 0:02:36
      249500 -- (-2638.228) (-2638.676) (-2640.885) [-2634.945] * (-2633.169) (-2637.263) (-2637.866) [-2637.541] -- 0:02:36
      250000 -- (-2651.647) (-2645.925) [-2638.224] (-2638.600) * (-2639.102) (-2641.027) [-2640.569] (-2639.406) -- 0:02:36

      Average standard deviation of split frequencies: 0.000000

      250500 -- (-2643.249) (-2645.614) (-2638.707) [-2642.990] * (-2639.922) [-2640.525] (-2642.100) (-2638.642) -- 0:02:35
      251000 -- (-2634.399) [-2652.298] (-2639.273) (-2643.215) * (-2641.302) (-2649.904) [-2642.633] (-2640.965) -- 0:02:35
      251500 -- (-2639.579) [-2635.403] (-2638.914) (-2635.964) * (-2635.503) (-2639.604) (-2641.578) [-2639.664] -- 0:02:34
      252000 -- [-2639.595] (-2635.322) (-2636.820) (-2642.729) * [-2639.233] (-2646.323) (-2639.293) (-2643.952) -- 0:02:37
      252500 -- [-2638.100] (-2637.458) (-2632.523) (-2643.471) * [-2642.091] (-2642.312) (-2638.701) (-2641.585) -- 0:02:36
      253000 -- [-2637.039] (-2640.949) (-2635.183) (-2648.024) * [-2637.474] (-2646.444) (-2635.893) (-2643.591) -- 0:02:36
      253500 -- (-2636.212) (-2643.447) [-2640.178] (-2644.659) * [-2637.337] (-2640.445) (-2636.988) (-2642.955) -- 0:02:36
      254000 -- (-2640.647) (-2645.091) [-2635.923] (-2650.334) * (-2641.377) [-2640.618] (-2642.226) (-2636.572) -- 0:02:35
      254500 -- [-2644.322] (-2642.354) (-2640.687) (-2643.458) * (-2638.861) (-2638.676) (-2636.765) [-2639.166] -- 0:02:35
      255000 -- [-2639.848] (-2640.461) (-2642.238) (-2660.788) * (-2641.494) [-2639.743] (-2638.536) (-2636.475) -- 0:02:34

      Average standard deviation of split frequencies: 0.000000

      255500 -- (-2649.089) [-2639.388] (-2637.647) (-2641.142) * (-2641.955) (-2642.641) [-2634.406] (-2640.257) -- 0:02:34
      256000 -- (-2644.103) (-2642.524) (-2640.896) [-2645.545] * (-2648.271) [-2639.110] (-2642.253) (-2636.868) -- 0:02:34
      256500 -- [-2639.779] (-2640.778) (-2644.107) (-2643.552) * (-2642.324) (-2640.015) [-2633.467] (-2638.151) -- 0:02:33
      257000 -- (-2636.446) (-2645.799) [-2638.745] (-2634.081) * (-2642.790) [-2640.521] (-2641.208) (-2644.800) -- 0:02:36
      257500 -- (-2632.171) (-2640.848) [-2636.782] (-2639.621) * (-2645.463) (-2642.809) (-2639.549) [-2639.829] -- 0:02:35
      258000 -- (-2638.910) (-2641.236) (-2638.609) [-2637.599] * (-2643.948) [-2639.073] (-2642.031) (-2639.192) -- 0:02:35
      258500 -- (-2640.214) [-2638.437] (-2637.284) (-2633.468) * [-2639.333] (-2643.406) (-2644.974) (-2645.649) -- 0:02:34
      259000 -- (-2640.126) (-2637.040) [-2639.050] (-2639.445) * (-2648.614) (-2644.919) [-2638.009] (-2644.333) -- 0:02:34
      259500 -- (-2638.397) (-2638.927) [-2639.143] (-2640.258) * [-2639.921] (-2640.279) (-2639.640) (-2645.302) -- 0:02:34
      260000 -- [-2643.419] (-2641.660) (-2648.327) (-2638.537) * (-2640.613) (-2647.892) [-2641.121] (-2636.728) -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      260500 -- (-2637.843) [-2642.583] (-2645.156) (-2635.049) * (-2640.633) (-2641.352) [-2639.056] (-2643.744) -- 0:02:33
      261000 -- (-2640.851) [-2637.634] (-2637.276) (-2642.315) * (-2643.732) [-2647.047] (-2637.009) (-2646.562) -- 0:02:32
      261500 -- [-2643.664] (-2644.146) (-2642.636) (-2640.733) * (-2644.660) (-2658.889) [-2637.240] (-2637.762) -- 0:02:32
      262000 -- (-2644.208) (-2646.155) [-2643.516] (-2640.538) * (-2639.665) (-2650.337) (-2640.522) [-2642.894] -- 0:02:34
      262500 -- (-2640.764) (-2639.579) [-2642.537] (-2639.835) * [-2634.722] (-2647.615) (-2645.402) (-2637.886) -- 0:02:34
      263000 -- [-2637.676] (-2639.713) (-2644.359) (-2642.578) * (-2636.359) (-2647.152) (-2637.580) [-2638.889] -- 0:02:34
      263500 -- (-2637.736) [-2633.472] (-2637.547) (-2639.062) * [-2642.646] (-2646.025) (-2637.207) (-2638.769) -- 0:02:33
      264000 -- (-2638.811) [-2640.479] (-2633.079) (-2645.012) * (-2639.879) (-2644.756) [-2636.938] (-2646.227) -- 0:02:33
      264500 -- (-2647.909) (-2642.328) (-2640.447) [-2642.959] * (-2643.498) [-2642.083] (-2640.601) (-2640.892) -- 0:02:32
      265000 -- [-2640.906] (-2641.603) (-2636.978) (-2643.288) * (-2636.896) [-2654.531] (-2635.102) (-2641.779) -- 0:02:32

      Average standard deviation of split frequencies: 0.000000

      265500 -- (-2643.932) [-2641.143] (-2645.444) (-2639.637) * [-2641.156] (-2643.056) (-2649.409) (-2640.676) -- 0:02:32
      266000 -- (-2643.239) (-2640.492) [-2643.597] (-2646.683) * (-2640.571) (-2641.612) (-2636.365) [-2638.035] -- 0:02:34
      266500 -- [-2639.232] (-2636.336) (-2647.330) (-2642.984) * (-2641.813) [-2634.449] (-2642.044) (-2636.357) -- 0:02:34
      267000 -- (-2638.297) [-2641.408] (-2645.352) (-2640.859) * [-2635.501] (-2640.282) (-2639.217) (-2635.843) -- 0:02:33
      267500 -- (-2644.023) (-2642.345) [-2644.307] (-2644.334) * [-2635.189] (-2638.824) (-2640.035) (-2641.835) -- 0:02:33
      268000 -- (-2642.747) (-2644.324) [-2640.654] (-2636.869) * (-2640.302) (-2637.487) (-2647.602) [-2638.689] -- 0:02:32
      268500 -- (-2639.143) (-2650.793) (-2639.212) [-2642.752] * (-2643.382) (-2635.492) (-2636.684) [-2645.446] -- 0:02:32
      269000 -- [-2639.694] (-2648.910) (-2639.879) (-2644.668) * [-2635.656] (-2638.456) (-2637.303) (-2636.828) -- 0:02:32
      269500 -- (-2648.346) [-2641.564] (-2644.403) (-2641.896) * (-2642.929) [-2638.210] (-2638.163) (-2639.859) -- 0:02:31
      270000 -- (-2634.243) (-2640.701) (-2637.225) [-2639.325] * [-2641.310] (-2647.613) (-2646.372) (-2637.304) -- 0:02:31

      Average standard deviation of split frequencies: 0.000000

      270500 -- (-2641.493) (-2644.997) (-2636.164) [-2641.657] * [-2636.125] (-2639.381) (-2647.488) (-2644.918) -- 0:02:31
      271000 -- (-2648.624) (-2639.590) (-2652.256) [-2647.728] * (-2636.233) [-2643.417] (-2640.904) (-2641.216) -- 0:02:33
      271500 -- [-2640.133] (-2642.484) (-2640.894) (-2646.603) * (-2637.181) [-2638.555] (-2639.963) (-2636.864) -- 0:02:32
      272000 -- (-2638.367) [-2640.761] (-2639.852) (-2636.422) * (-2640.542) (-2643.149) (-2643.356) [-2637.279] -- 0:02:32
      272500 -- (-2640.642) (-2641.164) [-2646.636] (-2646.296) * (-2642.203) (-2641.347) [-2641.368] (-2638.639) -- 0:02:32
      273000 -- (-2642.849) [-2640.598] (-2639.278) (-2649.519) * (-2643.784) (-2636.378) (-2638.835) [-2634.705] -- 0:02:31
      273500 -- (-2646.336) (-2647.309) [-2639.564] (-2640.124) * [-2637.568] (-2639.937) (-2643.428) (-2640.213) -- 0:02:31
      274000 -- (-2645.365) (-2639.845) [-2638.691] (-2644.710) * (-2644.250) (-2638.643) (-2644.278) [-2634.122] -- 0:02:31
      274500 -- (-2643.588) [-2636.124] (-2636.940) (-2655.224) * [-2640.946] (-2636.921) (-2643.025) (-2639.657) -- 0:02:30
      275000 -- (-2641.166) (-2636.385) [-2639.267] (-2647.389) * (-2644.519) (-2642.902) [-2636.766] (-2637.608) -- 0:02:30

      Average standard deviation of split frequencies: 0.000000

      275500 -- (-2643.677) (-2638.679) [-2641.132] (-2642.284) * (-2639.671) [-2641.423] (-2634.396) (-2644.467) -- 0:02:32
      276000 -- [-2646.107] (-2648.256) (-2643.659) (-2639.971) * (-2641.050) [-2638.601] (-2635.195) (-2642.843) -- 0:02:32
      276500 -- (-2641.615) [-2640.218] (-2640.409) (-2640.260) * (-2639.775) (-2639.256) [-2640.754] (-2641.390) -- 0:02:31
      277000 -- [-2643.070] (-2646.810) (-2634.621) (-2643.345) * [-2642.136] (-2633.979) (-2644.639) (-2644.070) -- 0:02:31
      277500 -- (-2640.286) (-2648.686) [-2641.360] (-2636.812) * (-2637.766) [-2636.981] (-2648.606) (-2640.793) -- 0:02:31
      278000 -- (-2639.024) (-2643.441) (-2638.938) [-2639.756] * [-2635.655] (-2643.844) (-2647.932) (-2637.021) -- 0:02:30
      278500 -- (-2645.823) (-2640.818) [-2648.977] (-2633.392) * (-2639.762) (-2638.824) (-2648.037) [-2633.559] -- 0:02:30
      279000 -- (-2648.069) (-2641.672) [-2640.283] (-2637.860) * (-2639.783) (-2641.655) (-2650.606) [-2642.518] -- 0:02:29
      279500 -- (-2637.062) [-2635.162] (-2641.777) (-2636.990) * (-2636.840) (-2643.555) (-2646.948) [-2643.082] -- 0:02:29
      280000 -- (-2640.363) [-2639.331] (-2636.971) (-2641.631) * [-2638.394] (-2643.223) (-2644.475) (-2645.473) -- 0:02:29

      Average standard deviation of split frequencies: 0.000000

      280500 -- (-2642.172) (-2635.709) (-2640.001) [-2640.465] * (-2644.102) (-2639.915) (-2638.469) [-2642.441] -- 0:02:31
      281000 -- (-2653.626) (-2635.430) (-2636.333) [-2639.837] * (-2635.429) (-2636.703) (-2643.222) [-2643.049] -- 0:02:30
      281500 -- (-2644.593) [-2638.223] (-2638.547) (-2642.765) * (-2641.805) (-2642.020) [-2638.601] (-2642.535) -- 0:02:30
      282000 -- (-2638.068) (-2634.486) (-2642.375) [-2638.500] * (-2649.503) (-2644.189) (-2638.745) [-2636.031] -- 0:02:30
      282500 -- (-2639.688) (-2647.181) (-2638.226) [-2636.989] * (-2641.867) [-2636.876] (-2637.051) (-2645.579) -- 0:02:29
      283000 -- [-2639.587] (-2651.206) (-2641.524) (-2642.917) * (-2647.348) [-2637.380] (-2638.679) (-2639.505) -- 0:02:29
      283500 -- [-2639.584] (-2637.699) (-2640.575) (-2641.087) * (-2644.940) (-2638.392) [-2635.682] (-2640.704) -- 0:02:29
      284000 -- (-2636.652) (-2641.771) [-2638.766] (-2641.200) * (-2641.217) (-2640.430) (-2640.163) [-2640.574] -- 0:02:28
      284500 -- (-2644.972) (-2640.036) [-2643.437] (-2637.275) * [-2642.499] (-2644.808) (-2636.289) (-2639.942) -- 0:02:28
      285000 -- [-2634.710] (-2639.454) (-2639.180) (-2636.143) * (-2644.535) (-2637.407) (-2642.295) [-2635.345] -- 0:02:30

      Average standard deviation of split frequencies: 0.000000

      285500 -- (-2634.491) [-2639.002] (-2645.455) (-2639.184) * (-2645.292) (-2640.584) (-2644.440) [-2635.456] -- 0:02:30
      286000 -- (-2640.349) [-2642.118] (-2643.729) (-2637.626) * (-2641.084) [-2642.519] (-2635.922) (-2646.546) -- 0:02:29
      286500 -- [-2637.201] (-2638.545) (-2644.756) (-2645.589) * [-2636.840] (-2640.716) (-2637.315) (-2637.885) -- 0:02:29
      287000 -- [-2639.020] (-2642.149) (-2640.031) (-2645.172) * (-2640.037) (-2641.213) (-2640.658) [-2640.278] -- 0:02:29
      287500 -- (-2639.410) (-2643.927) [-2636.635] (-2642.405) * (-2640.680) [-2644.539] (-2647.034) (-2635.253) -- 0:02:28
      288000 -- [-2640.372] (-2642.138) (-2638.601) (-2642.737) * [-2639.023] (-2640.413) (-2641.538) (-2641.321) -- 0:02:28
      288500 -- (-2641.201) [-2637.421] (-2633.973) (-2645.693) * (-2647.864) [-2644.535] (-2652.689) (-2637.440) -- 0:02:27
      289000 -- (-2649.130) (-2645.166) (-2639.696) [-2638.777] * [-2643.998] (-2638.585) (-2636.476) (-2636.058) -- 0:02:27
      289500 -- (-2647.220) (-2641.782) [-2634.081] (-2641.301) * [-2637.535] (-2638.830) (-2641.690) (-2641.112) -- 0:02:29
      290000 -- (-2641.050) (-2640.256) (-2641.391) [-2637.494] * [-2638.227] (-2637.558) (-2641.135) (-2639.503) -- 0:02:29

      Average standard deviation of split frequencies: 0.000000

      290500 -- (-2642.289) [-2637.589] (-2637.644) (-2639.818) * (-2640.927) (-2634.815) (-2641.097) [-2638.558] -- 0:02:28
      291000 -- [-2639.312] (-2642.670) (-2637.391) (-2644.499) * (-2639.417) (-2635.729) [-2643.372] (-2643.003) -- 0:02:28
      291500 -- [-2641.662] (-2642.507) (-2639.747) (-2651.488) * [-2638.614] (-2650.687) (-2637.452) (-2640.643) -- 0:02:28
      292000 -- (-2635.665) (-2641.565) [-2644.471] (-2636.250) * [-2634.354] (-2643.021) (-2639.508) (-2642.770) -- 0:02:27
      292500 -- (-2644.151) [-2642.465] (-2636.998) (-2644.209) * [-2638.853] (-2648.225) (-2634.445) (-2647.929) -- 0:02:27
      293000 -- (-2639.171) (-2644.707) (-2642.045) [-2634.024] * (-2639.473) (-2644.671) [-2634.691] (-2641.288) -- 0:02:27
      293500 -- [-2640.192] (-2650.813) (-2640.861) (-2638.308) * [-2638.737] (-2638.277) (-2638.743) (-2643.799) -- 0:02:26
      294000 -- (-2640.535) (-2644.154) [-2644.596] (-2635.903) * (-2638.756) [-2635.707] (-2635.937) (-2646.537) -- 0:02:26
      294500 -- (-2639.025) (-2643.045) [-2640.680] (-2640.217) * (-2640.604) [-2632.171] (-2643.104) (-2640.295) -- 0:02:28
      295000 -- (-2640.568) [-2643.629] (-2646.395) (-2633.058) * [-2642.302] (-2641.891) (-2641.294) (-2641.206) -- 0:02:28

      Average standard deviation of split frequencies: 0.000000

      295500 -- (-2642.893) (-2637.100) (-2643.248) [-2641.774] * (-2644.542) (-2638.182) [-2638.356] (-2641.178) -- 0:02:27
      296000 -- (-2637.397) (-2643.815) (-2634.554) [-2639.085] * [-2640.051] (-2638.257) (-2637.543) (-2641.636) -- 0:02:27
      296500 -- [-2645.258] (-2640.723) (-2636.060) (-2646.606) * (-2637.783) [-2638.085] (-2638.239) (-2644.760) -- 0:02:27
      297000 -- (-2642.043) [-2637.714] (-2635.127) (-2640.895) * (-2635.575) (-2639.486) (-2640.831) [-2639.287] -- 0:02:26
      297500 -- (-2638.200) (-2635.644) [-2636.164] (-2643.899) * (-2636.062) (-2643.047) (-2640.413) [-2639.315] -- 0:02:26
      298000 -- (-2641.544) (-2637.522) (-2642.795) [-2635.925] * (-2645.134) (-2636.381) (-2641.609) [-2640.780] -- 0:02:26
      298500 -- (-2640.895) (-2635.430) [-2639.574] (-2641.288) * (-2644.694) [-2636.104] (-2640.989) (-2639.419) -- 0:02:25
      299000 -- [-2637.252] (-2643.816) (-2636.908) (-2645.303) * (-2639.950) (-2644.020) (-2648.656) [-2641.330] -- 0:02:27
      299500 -- (-2633.796) (-2642.786) [-2638.295] (-2641.187) * [-2636.156] (-2646.605) (-2645.062) (-2640.304) -- 0:02:27
      300000 -- [-2636.369] (-2645.101) (-2641.421) (-2640.741) * (-2635.015) (-2641.198) (-2642.562) [-2639.552] -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      300500 -- (-2646.322) (-2639.444) [-2640.949] (-2640.659) * (-2638.739) (-2641.478) [-2640.631] (-2640.950) -- 0:02:26
      301000 -- (-2642.961) (-2645.085) [-2639.051] (-2637.705) * [-2637.952] (-2638.068) (-2637.634) (-2646.248) -- 0:02:26
      301500 -- (-2647.013) [-2640.731] (-2645.316) (-2646.298) * (-2639.665) (-2642.749) [-2635.817] (-2639.553) -- 0:02:25
      302000 -- (-2638.801) [-2637.672] (-2639.592) (-2639.077) * [-2634.495] (-2639.912) (-2642.400) (-2639.247) -- 0:02:25
      302500 -- (-2635.539) [-2641.729] (-2642.570) (-2633.917) * [-2639.437] (-2650.873) (-2640.179) (-2643.818) -- 0:02:25
      303000 -- (-2640.267) [-2638.184] (-2641.885) (-2638.803) * (-2635.641) [-2639.384] (-2640.809) (-2634.472) -- 0:02:24
      303500 -- (-2633.755) (-2634.647) (-2643.079) [-2648.468] * [-2639.208] (-2643.339) (-2642.130) (-2642.007) -- 0:02:24
      304000 -- [-2639.326] (-2636.955) (-2637.242) (-2653.944) * (-2640.018) (-2641.646) (-2646.211) [-2636.670] -- 0:02:26
      304500 -- (-2641.752) (-2646.101) (-2642.663) [-2638.344] * (-2638.875) [-2637.672] (-2643.186) (-2645.793) -- 0:02:26
      305000 -- (-2642.645) [-2636.245] (-2638.835) (-2639.842) * (-2638.862) (-2642.611) (-2644.591) [-2641.261] -- 0:02:25

      Average standard deviation of split frequencies: 0.000000

      305500 -- (-2641.928) (-2645.369) [-2637.896] (-2642.194) * (-2639.881) [-2642.273] (-2642.000) (-2641.790) -- 0:02:25
      306000 -- (-2642.862) (-2638.863) (-2642.068) [-2640.409] * (-2641.785) (-2643.032) [-2637.862] (-2639.989) -- 0:02:25
      306500 -- (-2644.755) (-2642.598) (-2639.671) [-2646.795] * (-2636.881) (-2654.066) [-2637.957] (-2643.704) -- 0:02:24
      307000 -- (-2641.614) (-2643.819) [-2645.399] (-2648.852) * (-2640.309) (-2642.930) (-2638.686) [-2643.589] -- 0:02:24
      307500 -- (-2636.443) (-2642.642) [-2641.593] (-2640.164) * (-2639.247) (-2639.653) (-2636.376) [-2640.233] -- 0:02:24
      308000 -- (-2643.625) [-2638.023] (-2642.362) (-2638.006) * (-2638.428) (-2642.897) [-2635.795] (-2640.137) -- 0:02:23
      308500 -- (-2637.783) (-2638.194) (-2645.405) [-2636.110] * (-2640.512) (-2641.397) [-2636.182] (-2640.536) -- 0:02:25
      309000 -- (-2638.049) (-2635.041) (-2643.860) [-2638.054] * (-2646.478) (-2642.526) [-2640.890] (-2645.157) -- 0:02:25
      309500 -- [-2636.539] (-2641.153) (-2645.016) (-2639.961) * [-2633.131] (-2643.070) (-2634.442) (-2641.608) -- 0:02:25
      310000 -- (-2636.762) (-2642.059) (-2643.697) [-2640.422] * [-2638.248] (-2636.515) (-2638.136) (-2643.826) -- 0:02:24

      Average standard deviation of split frequencies: 0.000000

      310500 -- (-2636.335) (-2644.099) (-2644.178) [-2638.234] * (-2648.074) (-2644.774) (-2639.772) [-2644.793] -- 0:02:24
      311000 -- (-2645.776) (-2635.678) (-2641.340) [-2640.144] * [-2638.226] (-2642.968) (-2641.559) (-2641.824) -- 0:02:24
      311500 -- (-2637.428) [-2641.279] (-2636.433) (-2647.037) * (-2638.252) [-2635.688] (-2644.290) (-2637.958) -- 0:02:23
      312000 -- (-2636.896) (-2648.581) [-2635.925] (-2643.325) * (-2642.057) (-2635.773) (-2644.079) [-2639.787] -- 0:02:23
      312500 -- (-2643.426) [-2642.011] (-2637.916) (-2638.341) * (-2643.679) (-2643.902) [-2643.507] (-2642.511) -- 0:02:23
      313000 -- (-2646.900) (-2646.976) (-2643.638) [-2633.824] * (-2639.055) (-2635.317) (-2651.720) [-2639.520] -- 0:02:24
      313500 -- (-2652.208) (-2640.541) [-2638.412] (-2638.048) * [-2639.303] (-2639.671) (-2654.187) (-2644.267) -- 0:02:24
      314000 -- [-2641.190] (-2639.370) (-2640.035) (-2645.134) * (-2639.725) [-2642.525] (-2643.827) (-2639.099) -- 0:02:24
      314500 -- [-2645.356] (-2638.780) (-2637.827) (-2643.257) * [-2637.351] (-2634.799) (-2639.420) (-2643.845) -- 0:02:23
      315000 -- (-2647.473) (-2635.807) [-2634.748] (-2645.752) * [-2642.752] (-2643.987) (-2642.494) (-2640.111) -- 0:02:23

      Average standard deviation of split frequencies: 0.000000

      315500 -- [-2647.344] (-2641.510) (-2634.077) (-2645.134) * (-2646.396) (-2634.615) (-2646.212) [-2638.346] -- 0:02:23
      316000 -- [-2640.142] (-2642.186) (-2636.640) (-2649.932) * (-2638.901) (-2637.462) [-2639.430] (-2635.839) -- 0:02:22
      316500 -- [-2642.377] (-2637.291) (-2639.560) (-2638.003) * (-2638.254) [-2637.702] (-2644.500) (-2640.392) -- 0:02:22
      317000 -- [-2642.664] (-2649.756) (-2642.854) (-2639.578) * (-2637.974) (-2639.260) (-2640.952) [-2645.691] -- 0:02:22
      317500 -- (-2639.039) (-2639.735) [-2641.733] (-2639.987) * (-2643.055) (-2639.556) [-2638.668] (-2642.797) -- 0:02:21
      318000 -- (-2640.074) (-2638.885) [-2644.590] (-2643.397) * (-2644.400) (-2637.280) [-2640.396] (-2640.856) -- 0:02:23
      318500 -- (-2647.628) [-2636.344] (-2652.642) (-2637.033) * (-2641.149) [-2645.285] (-2641.766) (-2645.079) -- 0:02:23
      319000 -- [-2641.551] (-2637.041) (-2641.315) (-2638.164) * (-2638.730) (-2639.356) (-2638.513) [-2635.778] -- 0:02:23
      319500 -- [-2643.660] (-2638.856) (-2646.143) (-2644.625) * [-2640.200] (-2643.001) (-2638.621) (-2638.770) -- 0:02:22
      320000 -- (-2637.717) (-2639.129) [-2641.933] (-2638.631) * (-2643.480) (-2642.110) [-2636.992] (-2640.241) -- 0:02:22

      Average standard deviation of split frequencies: 0.000000

      320500 -- [-2640.141] (-2641.680) (-2644.859) (-2635.749) * (-2640.451) (-2641.262) (-2640.729) [-2641.404] -- 0:02:22
      321000 -- (-2642.655) (-2640.264) [-2641.197] (-2638.513) * (-2645.978) [-2637.552] (-2638.802) (-2641.788) -- 0:02:21
      321500 -- (-2635.836) (-2635.471) (-2638.629) [-2637.296] * (-2634.783) (-2637.978) [-2638.598] (-2639.559) -- 0:02:21
      322000 -- (-2634.572) (-2632.006) [-2640.358] (-2646.855) * (-2639.240) [-2639.137] (-2642.260) (-2642.742) -- 0:02:21
      322500 -- (-2638.633) [-2637.413] (-2639.487) (-2651.189) * [-2636.893] (-2642.172) (-2644.914) (-2639.566) -- 0:02:22
      323000 -- [-2636.891] (-2641.555) (-2636.093) (-2642.873) * [-2637.238] (-2637.556) (-2639.747) (-2640.429) -- 0:02:22
      323500 -- (-2640.762) [-2639.560] (-2644.047) (-2635.664) * (-2639.762) (-2643.188) (-2644.295) [-2639.334] -- 0:02:22
      324000 -- [-2645.699] (-2640.903) (-2639.844) (-2640.058) * (-2644.531) [-2638.183] (-2643.891) (-2640.571) -- 0:02:21
      324500 -- [-2642.615] (-2639.803) (-2641.847) (-2639.247) * (-2635.874) (-2635.733) [-2639.601] (-2639.334) -- 0:02:21
      325000 -- (-2640.810) (-2644.103) (-2639.956) [-2642.708] * (-2648.382) (-2643.664) [-2639.461] (-2645.404) -- 0:02:21

      Average standard deviation of split frequencies: 0.000000

      325500 -- (-2641.004) [-2639.085] (-2643.167) (-2639.295) * (-2639.959) (-2642.081) [-2638.335] (-2642.963) -- 0:02:20
      326000 -- (-2641.234) [-2638.441] (-2638.990) (-2640.161) * (-2644.484) (-2644.602) (-2637.810) [-2638.181] -- 0:02:20
      326500 -- (-2637.571) (-2632.499) [-2643.839] (-2642.049) * (-2636.265) (-2637.264) [-2637.063] (-2641.069) -- 0:02:20
      327000 -- (-2645.042) (-2640.889) [-2641.909] (-2645.250) * (-2639.837) (-2641.120) (-2641.824) [-2639.597] -- 0:02:19
      327500 -- [-2642.223] (-2645.031) (-2641.358) (-2644.925) * (-2641.622) (-2636.815) [-2642.530] (-2647.329) -- 0:02:21
      328000 -- [-2640.191] (-2636.725) (-2644.584) (-2639.844) * (-2645.287) (-2641.628) (-2643.775) [-2641.522] -- 0:02:21
      328500 -- [-2636.832] (-2640.029) (-2639.401) (-2643.800) * (-2639.964) (-2639.425) [-2635.239] (-2646.378) -- 0:02:21
      329000 -- [-2636.935] (-2640.714) (-2644.270) (-2636.726) * (-2640.058) (-2642.929) (-2640.224) [-2643.728] -- 0:02:20
      329500 -- (-2637.589) (-2654.572) [-2645.023] (-2643.219) * (-2638.065) (-2640.578) (-2644.972) [-2644.698] -- 0:02:20
      330000 -- (-2636.105) [-2637.599] (-2640.664) (-2642.266) * (-2636.748) (-2638.485) (-2648.416) [-2638.847] -- 0:02:20

      Average standard deviation of split frequencies: 0.000000

      330500 -- (-2637.261) (-2640.272) (-2640.546) [-2637.816] * [-2642.614] (-2637.607) (-2639.350) (-2641.726) -- 0:02:19
      331000 -- (-2643.821) [-2637.529] (-2635.612) (-2645.708) * (-2645.203) [-2634.772] (-2640.467) (-2639.828) -- 0:02:19
      331500 -- (-2638.381) [-2641.382] (-2643.087) (-2636.428) * [-2640.228] (-2644.615) (-2641.709) (-2643.913) -- 0:02:19
      332000 -- (-2646.693) [-2635.814] (-2638.517) (-2640.721) * (-2638.344) (-2645.434) (-2637.110) [-2634.833] -- 0:02:20
      332500 -- (-2642.617) (-2641.802) (-2637.749) [-2646.117] * (-2639.457) [-2638.506] (-2645.561) (-2642.614) -- 0:02:20
      333000 -- (-2641.587) [-2637.853] (-2642.371) (-2644.443) * (-2642.048) [-2638.291] (-2647.537) (-2639.399) -- 0:02:20
      333500 -- (-2648.606) (-2636.905) (-2641.861) [-2642.955] * (-2638.804) (-2635.181) [-2639.236] (-2634.466) -- 0:02:19
      334000 -- (-2655.465) [-2636.307] (-2640.351) (-2642.048) * (-2643.265) (-2639.027) (-2639.019) [-2638.677] -- 0:02:19
      334500 -- (-2640.548) [-2644.526] (-2646.541) (-2641.422) * (-2653.358) [-2643.281] (-2643.344) (-2637.778) -- 0:02:19
      335000 -- (-2640.449) (-2640.468) (-2637.298) [-2636.741] * [-2642.815] (-2635.934) (-2640.568) (-2641.021) -- 0:02:18

      Average standard deviation of split frequencies: 0.000000

      335500 -- (-2638.274) (-2636.869) (-2637.528) [-2638.160] * [-2636.408] (-2645.648) (-2644.628) (-2638.021) -- 0:02:18
      336000 -- (-2642.548) [-2634.171] (-2645.534) (-2648.769) * (-2642.488) (-2642.541) [-2637.136] (-2649.532) -- 0:02:18
      336500 -- (-2634.191) (-2640.998) [-2639.893] (-2643.236) * (-2634.735) (-2644.633) (-2640.377) [-2638.936] -- 0:02:19
      337000 -- [-2637.228] (-2634.759) (-2640.274) (-2639.885) * (-2637.774) [-2644.317] (-2641.627) (-2639.915) -- 0:02:19
      337500 -- (-2644.341) (-2643.429) [-2636.812] (-2642.234) * (-2640.745) (-2642.173) (-2635.984) [-2635.710] -- 0:02:19
      338000 -- (-2636.806) (-2637.101) [-2636.428] (-2637.085) * (-2644.364) (-2640.946) (-2637.835) [-2637.059] -- 0:02:19
      338500 -- (-2640.457) (-2636.716) [-2638.246] (-2641.097) * [-2635.447] (-2640.590) (-2636.751) (-2643.729) -- 0:02:18
      339000 -- (-2642.077) (-2640.753) [-2636.462] (-2640.047) * [-2641.648] (-2639.872) (-2637.750) (-2648.058) -- 0:02:18
      339500 -- [-2640.792] (-2641.678) (-2641.751) (-2638.342) * (-2644.741) (-2638.870) (-2642.554) [-2639.415] -- 0:02:18
      340000 -- (-2641.404) [-2643.824] (-2638.810) (-2641.454) * [-2641.986] (-2638.707) (-2641.260) (-2646.226) -- 0:02:17

      Average standard deviation of split frequencies: 0.000000

      340500 -- (-2639.458) (-2643.232) (-2637.914) [-2635.722] * (-2648.065) [-2632.970] (-2648.362) (-2634.761) -- 0:02:17
      341000 -- (-2642.126) [-2638.425] (-2639.408) (-2643.656) * (-2641.154) (-2635.982) (-2642.240) [-2641.349] -- 0:02:17
      341500 -- [-2646.017] (-2638.469) (-2638.900) (-2635.621) * (-2640.551) (-2646.424) [-2640.137] (-2641.460) -- 0:02:18
      342000 -- (-2639.321) (-2640.451) (-2638.274) [-2636.724] * (-2645.304) (-2642.948) (-2636.237) [-2644.499] -- 0:02:18
      342500 -- (-2638.934) (-2639.938) (-2640.070) [-2636.328] * (-2639.687) [-2640.243] (-2639.960) (-2638.251) -- 0:02:18
      343000 -- [-2638.247] (-2641.976) (-2642.198) (-2642.285) * (-2641.686) (-2634.480) [-2638.063] (-2639.557) -- 0:02:17
      343500 -- (-2640.542) (-2642.925) [-2638.332] (-2642.670) * (-2652.272) [-2636.789] (-2641.355) (-2635.801) -- 0:02:17
      344000 -- (-2641.218) [-2637.709] (-2640.721) (-2635.429) * (-2643.705) (-2645.163) (-2644.077) [-2653.283] -- 0:02:17
      344500 -- (-2634.780) (-2636.024) (-2641.080) [-2637.227] * (-2640.553) (-2637.499) [-2633.752] (-2639.634) -- 0:02:16
      345000 -- (-2641.978) [-2640.477] (-2644.531) (-2636.094) * (-2646.571) [-2639.018] (-2636.572) (-2641.325) -- 0:02:16

      Average standard deviation of split frequencies: 0.000000

      345500 -- [-2639.225] (-2641.989) (-2644.473) (-2642.358) * (-2643.032) (-2642.629) [-2636.048] (-2646.604) -- 0:02:16
      346000 -- (-2645.088) (-2635.920) [-2635.425] (-2638.273) * (-2643.357) [-2637.831] (-2640.566) (-2642.687) -- 0:02:17
      346500 -- (-2640.733) [-2638.900] (-2639.116) (-2638.674) * (-2634.500) (-2637.066) [-2636.131] (-2638.576) -- 0:02:17
      347000 -- (-2637.665) (-2634.916) (-2646.216) [-2635.818] * (-2637.955) (-2637.195) (-2640.895) [-2638.593] -- 0:02:17
      347500 -- (-2638.950) (-2636.849) [-2645.738] (-2650.587) * [-2638.002] (-2641.258) (-2641.644) (-2639.485) -- 0:02:17
      348000 -- (-2635.920) (-2639.299) (-2638.163) [-2643.281] * (-2638.280) (-2645.270) (-2640.661) [-2640.868] -- 0:02:16
      348500 -- (-2638.273) [-2636.865] (-2640.455) (-2640.294) * (-2640.605) (-2638.927) (-2638.944) [-2637.590] -- 0:02:16
      349000 -- (-2641.855) [-2636.208] (-2634.812) (-2652.288) * (-2646.316) [-2638.488] (-2640.629) (-2634.598) -- 0:02:16
      349500 -- [-2637.336] (-2634.653) (-2644.162) (-2642.746) * (-2642.502) [-2642.216] (-2640.906) (-2638.718) -- 0:02:15
      350000 -- (-2643.179) (-2638.138) [-2636.068] (-2638.604) * (-2643.140) (-2645.306) (-2644.684) [-2639.718] -- 0:02:15

      Average standard deviation of split frequencies: 0.000000

      350500 -- (-2644.923) (-2633.164) (-2640.416) [-2647.928] * (-2645.051) (-2644.263) (-2642.204) [-2640.533] -- 0:02:15
      351000 -- (-2650.941) [-2638.032] (-2650.655) (-2647.065) * (-2639.795) (-2644.965) [-2644.303] (-2643.994) -- 0:02:16
      351500 -- (-2640.552) (-2640.250) [-2637.694] (-2644.625) * (-2639.635) (-2638.380) [-2637.277] (-2647.358) -- 0:02:16
      352000 -- (-2639.005) (-2638.221) [-2636.521] (-2639.288) * (-2645.766) (-2640.776) (-2646.527) [-2645.030] -- 0:02:16
      352500 -- (-2645.206) (-2641.633) (-2645.848) [-2640.775] * (-2648.756) (-2646.743) [-2640.787] (-2638.784) -- 0:02:15
      353000 -- [-2643.121] (-2641.611) (-2637.531) (-2641.074) * (-2646.732) (-2641.574) (-2638.011) [-2637.436] -- 0:02:15
      353500 -- (-2647.140) (-2635.755) [-2638.387] (-2638.919) * (-2635.794) (-2637.875) (-2639.304) [-2636.031] -- 0:02:15
      354000 -- (-2644.240) (-2649.139) [-2636.467] (-2645.387) * [-2641.555] (-2641.271) (-2642.206) (-2637.760) -- 0:02:15
      354500 -- (-2645.051) [-2641.305] (-2649.586) (-2640.438) * (-2639.944) (-2637.823) [-2638.064] (-2642.392) -- 0:02:14
      355000 -- (-2638.013) (-2644.913) [-2636.311] (-2639.658) * (-2639.318) (-2640.827) (-2636.446) [-2639.523] -- 0:02:14

      Average standard deviation of split frequencies: 0.000000

      355500 -- (-2638.041) (-2643.373) [-2640.844] (-2637.399) * (-2645.492) (-2641.696) [-2639.604] (-2639.675) -- 0:02:15
      356000 -- (-2640.280) (-2642.335) [-2641.685] (-2647.341) * [-2640.904] (-2645.835) (-2640.092) (-2637.585) -- 0:02:15
      356500 -- [-2637.127] (-2647.791) (-2645.937) (-2636.308) * (-2636.276) (-2647.376) (-2640.015) [-2637.113] -- 0:02:15
      357000 -- (-2645.897) [-2640.089] (-2642.560) (-2638.164) * (-2639.188) (-2642.309) (-2639.893) [-2643.863] -- 0:02:15
      357500 -- (-2639.214) (-2641.859) (-2637.388) [-2638.347] * (-2642.649) (-2639.086) [-2650.938] (-2639.114) -- 0:02:14
      358000 -- [-2641.025] (-2646.235) (-2636.081) (-2638.310) * (-2633.075) (-2637.461) [-2636.616] (-2639.140) -- 0:02:14
      358500 -- (-2639.880) [-2639.784] (-2635.479) (-2637.733) * [-2634.458] (-2638.925) (-2639.976) (-2641.072) -- 0:02:14
      359000 -- (-2641.963) [-2638.265] (-2639.687) (-2637.266) * (-2639.714) (-2640.293) [-2638.411] (-2642.948) -- 0:02:13
      359500 -- (-2641.064) [-2636.057] (-2637.521) (-2644.054) * (-2637.993) (-2640.443) [-2636.063] (-2640.664) -- 0:02:13
      360000 -- (-2636.558) (-2640.885) (-2644.972) [-2640.634] * [-2636.899] (-2640.803) (-2640.189) (-2640.757) -- 0:02:15

      Average standard deviation of split frequencies: 0.000000

      360500 -- [-2635.156] (-2645.441) (-2641.148) (-2640.400) * (-2646.832) (-2640.609) [-2638.239] (-2638.214) -- 0:02:14
      361000 -- (-2637.660) (-2643.325) [-2640.933] (-2639.909) * (-2641.209) (-2639.101) [-2637.380] (-2644.003) -- 0:02:14
      361500 -- (-2642.075) (-2647.090) (-2641.375) [-2639.517] * [-2640.282] (-2636.030) (-2646.813) (-2642.545) -- 0:02:14
      362000 -- (-2634.345) (-2639.059) (-2641.777) [-2633.934] * (-2645.752) (-2641.162) [-2639.101] (-2647.070) -- 0:02:13
      362500 -- [-2638.332] (-2634.747) (-2638.460) (-2645.683) * (-2636.425) (-2637.089) [-2639.232] (-2639.977) -- 0:02:13
      363000 -- (-2635.673) [-2640.075] (-2645.208) (-2637.389) * (-2636.721) (-2643.907) [-2639.669] (-2641.598) -- 0:02:13
      363500 -- (-2639.251) (-2644.671) (-2641.186) [-2640.764] * (-2641.956) (-2635.898) [-2638.664] (-2640.737) -- 0:02:13
      364000 -- (-2640.393) [-2640.041] (-2647.331) (-2637.563) * [-2640.282] (-2643.714) (-2641.096) (-2642.456) -- 0:02:12
      364500 -- (-2642.738) [-2638.522] (-2646.648) (-2644.780) * (-2637.036) [-2635.625] (-2640.099) (-2644.397) -- 0:02:12
      365000 -- (-2641.963) (-2637.494) (-2646.712) [-2642.568] * (-2643.008) (-2643.910) [-2637.863] (-2645.234) -- 0:02:13

      Average standard deviation of split frequencies: 0.000000

      365500 -- (-2646.910) (-2639.853) [-2645.454] (-2639.075) * (-2641.638) [-2636.192] (-2640.444) (-2638.329) -- 0:02:13
      366000 -- (-2639.415) (-2642.636) [-2640.620] (-2643.487) * [-2639.229] (-2642.675) (-2650.701) (-2641.952) -- 0:02:13
      366500 -- (-2638.088) [-2638.282] (-2638.062) (-2643.024) * [-2635.068] (-2641.762) (-2650.064) (-2644.846) -- 0:02:13
      367000 -- (-2636.580) [-2638.031] (-2642.413) (-2642.185) * (-2642.022) [-2640.548] (-2639.574) (-2642.450) -- 0:02:12
      367500 -- [-2637.872] (-2638.003) (-2647.072) (-2642.661) * (-2641.484) (-2638.267) [-2639.703] (-2641.716) -- 0:02:12
      368000 -- (-2640.098) (-2644.960) (-2640.267) [-2644.769] * (-2645.049) (-2637.868) [-2639.266] (-2640.187) -- 0:02:12
      368500 -- (-2640.275) [-2646.831] (-2639.698) (-2640.291) * (-2640.583) (-2641.984) (-2639.198) [-2633.072] -- 0:02:11
      369000 -- [-2638.095] (-2644.003) (-2640.414) (-2649.590) * [-2636.031] (-2639.994) (-2643.935) (-2636.254) -- 0:02:11
      369500 -- [-2633.655] (-2636.766) (-2644.483) (-2648.156) * (-2639.355) [-2646.229] (-2639.315) (-2647.433) -- 0:02:11
      370000 -- (-2636.957) (-2641.008) [-2638.917] (-2643.347) * (-2641.210) (-2644.751) [-2638.367] (-2641.053) -- 0:02:12

      Average standard deviation of split frequencies: 0.000000

      370500 -- (-2641.479) [-2637.946] (-2637.253) (-2643.409) * (-2637.672) (-2652.678) (-2633.800) [-2637.517] -- 0:02:12
      371000 -- (-2642.562) (-2639.139) (-2644.209) [-2640.527] * [-2644.983] (-2636.131) (-2642.443) (-2642.489) -- 0:02:12
      371500 -- (-2642.567) (-2638.752) (-2641.835) [-2638.597] * (-2645.131) [-2638.019] (-2644.375) (-2652.045) -- 0:02:11
      372000 -- (-2641.030) [-2636.890] (-2642.744) (-2639.394) * (-2639.184) [-2636.817] (-2640.897) (-2646.367) -- 0:02:11
      372500 -- (-2641.468) (-2638.872) (-2647.206) [-2638.518] * (-2639.684) (-2641.427) (-2649.851) [-2639.192] -- 0:02:11
      373000 -- (-2645.022) (-2639.706) [-2644.032] (-2642.178) * (-2637.324) (-2639.667) (-2644.250) [-2636.574] -- 0:02:11
      373500 -- (-2640.127) [-2638.359] (-2646.428) (-2648.540) * (-2641.525) (-2646.375) (-2640.813) [-2641.351] -- 0:02:10
      374000 -- (-2650.007) (-2645.328) (-2646.236) [-2641.278] * (-2640.356) (-2642.437) [-2643.237] (-2638.065) -- 0:02:10
      374500 -- (-2640.688) (-2641.217) [-2640.366] (-2648.225) * (-2639.655) (-2639.817) (-2641.026) [-2636.118] -- 0:02:11
      375000 -- (-2641.341) (-2639.635) (-2647.188) [-2640.193] * (-2645.128) (-2639.826) [-2644.327] (-2636.702) -- 0:02:11

      Average standard deviation of split frequencies: 0.000000

      375500 -- (-2645.147) (-2640.774) (-2638.592) [-2644.993] * (-2643.004) (-2639.626) (-2637.662) [-2639.864] -- 0:02:11
      376000 -- (-2640.155) (-2645.794) (-2643.271) [-2640.331] * (-2645.164) [-2637.736] (-2640.032) (-2646.912) -- 0:02:11
      376500 -- (-2651.189) [-2643.562] (-2638.150) (-2643.731) * (-2638.555) (-2640.305) [-2638.037] (-2644.853) -- 0:02:10
      377000 -- (-2641.382) (-2651.840) [-2638.202] (-2639.918) * (-2638.821) (-2644.255) (-2642.476) [-2642.408] -- 0:02:10
      377500 -- (-2639.541) (-2642.006) [-2642.472] (-2636.293) * (-2638.041) [-2640.453] (-2641.136) (-2634.402) -- 0:02:10
      378000 -- (-2637.608) (-2645.553) [-2641.088] (-2639.563) * (-2638.129) (-2644.952) (-2641.712) [-2641.711] -- 0:02:09
      378500 -- (-2639.157) [-2638.493] (-2640.965) (-2639.480) * (-2636.623) [-2639.503] (-2642.718) (-2641.381) -- 0:02:09
      379000 -- (-2641.738) (-2640.072) (-2639.602) [-2658.068] * (-2638.537) (-2639.493) (-2646.517) [-2644.220] -- 0:02:11
      379500 -- (-2642.251) (-2639.515) (-2638.446) [-2637.277] * (-2637.742) [-2638.212] (-2642.830) (-2638.888) -- 0:02:10
      380000 -- [-2634.668] (-2638.166) (-2648.489) (-2642.505) * [-2637.553] (-2650.752) (-2634.106) (-2636.929) -- 0:02:10

      Average standard deviation of split frequencies: 0.000000

      380500 -- [-2636.283] (-2640.949) (-2634.868) (-2640.227) * (-2637.489) (-2638.282) (-2637.667) [-2636.468] -- 0:02:10
      381000 -- (-2634.233) (-2633.821) [-2643.729] (-2639.961) * (-2644.055) [-2641.845] (-2644.598) (-2635.598) -- 0:02:09
      381500 -- (-2645.190) [-2634.427] (-2636.209) (-2638.009) * (-2641.252) (-2636.278) (-2640.498) [-2635.354] -- 0:02:09
      382000 -- (-2642.909) (-2641.086) (-2638.669) [-2637.001] * [-2636.285] (-2641.239) (-2637.673) (-2639.443) -- 0:02:09
      382500 -- (-2640.792) (-2641.811) (-2640.740) [-2635.222] * (-2640.838) (-2639.602) [-2641.900] (-2640.440) -- 0:02:09
      383000 -- (-2642.724) [-2643.956] (-2639.901) (-2647.257) * (-2634.640) [-2641.927] (-2639.109) (-2643.436) -- 0:02:08
      383500 -- [-2647.381] (-2643.049) (-2638.884) (-2636.906) * (-2644.137) (-2644.592) [-2640.024] (-2643.161) -- 0:02:08
      384000 -- [-2636.797] (-2647.973) (-2642.817) (-2642.095) * [-2639.102] (-2642.437) (-2638.370) (-2638.424) -- 0:02:09
      384500 -- (-2635.232) (-2648.465) (-2639.158) [-2636.033] * [-2638.419] (-2643.347) (-2636.656) (-2639.721) -- 0:02:09
      385000 -- (-2638.557) (-2660.180) (-2641.749) [-2638.342] * [-2640.744] (-2641.404) (-2637.765) (-2642.452) -- 0:02:09

      Average standard deviation of split frequencies: 0.000000

      385500 -- (-2648.069) (-2649.849) [-2639.741] (-2640.413) * (-2639.665) (-2642.355) (-2639.074) [-2633.537] -- 0:02:09
      386000 -- (-2633.825) (-2655.055) (-2640.648) [-2643.470] * (-2642.602) [-2636.184] (-2640.887) (-2640.484) -- 0:02:08
      386500 -- (-2637.930) (-2643.108) [-2636.818] (-2644.855) * (-2642.204) (-2641.307) [-2639.346] (-2641.867) -- 0:02:08
      387000 -- [-2643.183] (-2642.157) (-2641.058) (-2641.338) * (-2640.629) (-2642.144) (-2640.596) [-2637.809] -- 0:02:08
      387500 -- [-2638.753] (-2657.374) (-2634.791) (-2647.248) * (-2642.621) (-2637.866) (-2645.989) [-2635.129] -- 0:02:08
      388000 -- (-2642.348) (-2641.591) [-2643.682] (-2647.323) * [-2639.143] (-2649.385) (-2648.216) (-2640.718) -- 0:02:07
      388500 -- [-2639.842] (-2643.196) (-2638.089) (-2644.223) * [-2635.396] (-2637.074) (-2639.073) (-2642.195) -- 0:02:09
      389000 -- (-2639.020) (-2641.905) (-2642.277) [-2639.446] * [-2640.104] (-2646.524) (-2637.944) (-2637.371) -- 0:02:08
      389500 -- (-2637.156) (-2646.221) (-2640.295) [-2648.504] * (-2633.918) (-2646.440) [-2634.595] (-2645.805) -- 0:02:08
      390000 -- [-2639.697] (-2637.826) (-2642.618) (-2635.547) * [-2637.170] (-2645.552) (-2638.955) (-2637.030) -- 0:02:08

      Average standard deviation of split frequencies: 0.000000

      390500 -- [-2638.873] (-2638.984) (-2646.401) (-2644.090) * (-2637.999) (-2635.317) (-2637.831) [-2637.465] -- 0:02:07
      391000 -- [-2641.692] (-2644.242) (-2638.318) (-2644.225) * [-2639.620] (-2637.232) (-2640.183) (-2646.732) -- 0:02:07
      391500 -- (-2644.846) (-2646.129) (-2638.759) [-2633.970] * (-2638.412) (-2645.258) [-2638.629] (-2638.072) -- 0:02:07
      392000 -- (-2639.543) [-2635.453] (-2644.115) (-2644.712) * [-2637.807] (-2648.857) (-2641.049) (-2640.697) -- 0:02:07
      392500 -- (-2647.916) (-2639.609) (-2645.137) [-2636.604] * (-2641.060) (-2645.147) (-2635.859) [-2647.660] -- 0:02:06
      393000 -- (-2641.476) [-2639.169] (-2636.785) (-2645.373) * [-2634.750] (-2640.115) (-2638.077) (-2640.922) -- 0:02:06
      393500 -- [-2643.424] (-2645.088) (-2638.455) (-2642.715) * (-2640.827) [-2638.617] (-2640.968) (-2645.863) -- 0:02:07
      394000 -- (-2643.209) (-2638.322) [-2640.921] (-2637.036) * (-2644.593) (-2638.950) (-2643.495) [-2638.543] -- 0:02:07
      394500 -- (-2641.440) (-2652.390) (-2640.690) [-2639.648] * (-2643.424) (-2639.547) [-2644.738] (-2645.990) -- 0:02:07
      395000 -- [-2641.848] (-2643.422) (-2640.826) (-2641.483) * (-2633.163) [-2641.554] (-2640.654) (-2643.021) -- 0:02:07

      Average standard deviation of split frequencies: 0.000000

      395500 -- [-2638.435] (-2647.989) (-2635.908) (-2643.179) * [-2637.530] (-2633.724) (-2636.936) (-2636.393) -- 0:02:06
      396000 -- (-2634.884) (-2641.966) (-2642.004) [-2642.880] * (-2642.281) [-2643.559] (-2644.099) (-2637.405) -- 0:02:06
      396500 -- [-2636.789] (-2638.431) (-2643.415) (-2641.207) * [-2635.474] (-2639.763) (-2636.593) (-2634.166) -- 0:02:06
      397000 -- (-2637.337) (-2637.837) (-2643.838) [-2640.596] * [-2634.441] (-2641.559) (-2641.458) (-2636.174) -- 0:02:06
      397500 -- (-2637.122) (-2637.290) (-2649.333) [-2643.788] * (-2643.036) (-2636.368) [-2636.270] (-2641.410) -- 0:02:05
      398000 -- [-2640.258] (-2644.718) (-2645.652) (-2639.851) * (-2633.833) [-2638.992] (-2636.598) (-2645.495) -- 0:02:07
      398500 -- (-2639.099) (-2641.335) [-2642.014] (-2642.473) * (-2636.760) (-2647.020) (-2638.624) [-2642.213] -- 0:02:06
      399000 -- [-2639.020] (-2641.185) (-2639.865) (-2643.926) * (-2644.499) [-2636.512] (-2642.558) (-2642.652) -- 0:02:06
      399500 -- (-2640.741) [-2638.304] (-2641.470) (-2641.020) * (-2642.801) [-2635.968] (-2642.673) (-2637.912) -- 0:02:06
      400000 -- (-2640.848) (-2638.145) [-2633.754] (-2640.168) * [-2642.003] (-2642.772) (-2641.063) (-2635.945) -- 0:02:06

      Average standard deviation of split frequencies: 0.000000

      400500 -- (-2640.158) (-2634.966) [-2639.856] (-2640.575) * (-2646.867) (-2643.622) (-2648.894) [-2636.154] -- 0:02:05
      401000 -- (-2641.190) [-2644.129] (-2644.667) (-2639.756) * [-2640.975] (-2645.364) (-2636.745) (-2640.982) -- 0:02:05
      401500 -- [-2639.936] (-2636.345) (-2639.053) (-2642.892) * (-2642.505) [-2635.676] (-2641.554) (-2639.571) -- 0:02:05
      402000 -- (-2641.336) (-2636.235) [-2638.908] (-2636.062) * (-2638.458) (-2638.708) (-2643.418) [-2640.571] -- 0:02:04
      402500 -- (-2638.106) (-2640.314) (-2650.666) [-2637.465] * (-2643.526) [-2640.870] (-2642.238) (-2645.728) -- 0:02:04
      403000 -- (-2637.101) (-2637.678) (-2656.780) [-2646.426] * (-2637.509) [-2643.044] (-2636.474) (-2646.729) -- 0:02:05
      403500 -- [-2636.304] (-2638.771) (-2642.615) (-2652.889) * (-2637.124) (-2644.711) (-2640.833) [-2644.811] -- 0:02:05
      404000 -- (-2642.835) [-2641.726] (-2642.957) (-2638.556) * (-2640.472) (-2647.373) [-2640.813] (-2639.488) -- 0:02:05
      404500 -- (-2640.914) (-2643.899) (-2645.519) [-2641.071] * [-2643.720] (-2636.427) (-2640.217) (-2635.940) -- 0:02:05
      405000 -- [-2640.100] (-2641.369) (-2639.854) (-2641.841) * (-2640.296) (-2634.647) [-2640.660] (-2638.325) -- 0:02:04

      Average standard deviation of split frequencies: 0.000000

      405500 -- (-2637.020) (-2644.912) [-2643.241] (-2644.948) * (-2636.661) (-2639.259) (-2641.606) [-2636.574] -- 0:02:04
      406000 -- (-2635.133) (-2642.258) (-2644.060) [-2638.124] * (-2639.948) (-2648.823) (-2645.191) [-2633.475] -- 0:02:04
      406500 -- (-2634.651) [-2634.748] (-2643.968) (-2644.715) * (-2642.669) (-2637.961) (-2647.158) [-2637.995] -- 0:02:04
      407000 -- (-2638.185) [-2640.230] (-2641.098) (-2644.144) * (-2644.033) [-2635.502] (-2645.935) (-2637.298) -- 0:02:03
      407500 -- (-2643.274) (-2638.645) [-2639.062] (-2637.838) * (-2641.331) [-2638.236] (-2644.286) (-2642.113) -- 0:02:05
      408000 -- (-2645.923) (-2637.443) (-2642.742) [-2641.817] * (-2635.901) (-2641.476) (-2650.050) [-2640.976] -- 0:02:04
      408500 -- [-2640.575] (-2640.772) (-2642.812) (-2643.989) * [-2641.550] (-2642.539) (-2645.288) (-2648.549) -- 0:02:04
      409000 -- [-2641.184] (-2643.163) (-2637.666) (-2639.348) * (-2636.290) (-2640.352) [-2643.712] (-2640.917) -- 0:02:04
      409500 -- (-2644.325) (-2639.193) [-2636.861] (-2651.267) * (-2643.429) (-2636.949) [-2635.871] (-2640.066) -- 0:02:04
      410000 -- [-2642.601] (-2637.067) (-2637.919) (-2641.422) * (-2637.807) (-2640.739) [-2641.145] (-2646.532) -- 0:02:03

      Average standard deviation of split frequencies: 0.000000

      410500 -- (-2641.256) [-2636.431] (-2635.901) (-2639.914) * (-2638.616) (-2644.642) (-2639.492) [-2636.230] -- 0:02:03
      411000 -- (-2637.298) (-2637.516) (-2637.828) [-2646.360] * (-2653.672) (-2640.398) (-2635.834) [-2637.288] -- 0:02:03
      411500 -- (-2634.569) [-2639.107] (-2643.553) (-2640.509) * (-2636.830) (-2633.915) (-2640.842) [-2638.856] -- 0:02:02
      412000 -- (-2636.852) (-2634.592) (-2637.202) [-2638.050] * (-2640.456) [-2638.455] (-2646.315) (-2635.294) -- 0:02:04
      412500 -- [-2639.376] (-2640.531) (-2637.702) (-2645.049) * (-2642.320) [-2645.784] (-2636.946) (-2638.929) -- 0:02:03
      413000 -- (-2638.196) (-2645.924) [-2639.600] (-2639.320) * [-2640.027] (-2638.567) (-2635.640) (-2636.728) -- 0:02:03
      413500 -- [-2634.922] (-2643.134) (-2638.064) (-2635.869) * (-2641.215) (-2638.721) (-2637.998) [-2638.484] -- 0:02:03
      414000 -- (-2634.083) (-2647.901) (-2643.208) [-2643.598] * (-2641.426) (-2637.643) (-2640.263) [-2642.857] -- 0:02:03
      414500 -- (-2641.382) (-2640.383) [-2633.614] (-2639.739) * (-2643.058) [-2636.425] (-2637.117) (-2640.759) -- 0:02:02
      415000 -- (-2639.813) (-2635.965) (-2641.220) [-2645.488] * (-2639.138) (-2641.106) [-2639.182] (-2642.153) -- 0:02:02

      Average standard deviation of split frequencies: 0.000000

      415500 -- (-2637.464) [-2636.245] (-2645.945) (-2644.820) * (-2638.899) [-2638.714] (-2636.929) (-2640.163) -- 0:02:02
      416000 -- (-2640.769) (-2642.317) (-2646.333) [-2642.084] * (-2642.009) (-2639.268) (-2638.063) [-2640.378] -- 0:02:02
      416500 -- (-2644.751) [-2640.407] (-2636.454) (-2640.581) * (-2639.543) [-2638.767] (-2636.261) (-2643.762) -- 0:02:01
      417000 -- (-2640.509) [-2635.143] (-2638.167) (-2638.588) * [-2637.031] (-2645.326) (-2639.438) (-2636.304) -- 0:02:03
      417500 -- (-2638.858) (-2638.192) [-2641.216] (-2636.624) * (-2641.476) (-2641.116) (-2644.850) [-2637.815] -- 0:02:02
      418000 -- (-2640.582) (-2637.261) (-2638.187) [-2640.394] * (-2645.744) (-2637.107) (-2645.362) [-2639.861] -- 0:02:02
      418500 -- (-2639.744) (-2637.062) [-2638.284] (-2636.294) * [-2642.019] (-2643.919) (-2638.847) (-2644.077) -- 0:02:02
      419000 -- (-2637.915) (-2649.748) (-2633.806) [-2645.664] * (-2637.382) (-2635.126) [-2641.357] (-2639.147) -- 0:02:02
      419500 -- (-2643.481) [-2643.773] (-2637.663) (-2643.146) * (-2644.993) (-2643.064) [-2640.073] (-2639.664) -- 0:02:01
      420000 -- (-2641.234) (-2640.556) (-2643.674) [-2641.095] * (-2648.721) (-2637.778) [-2637.463] (-2639.792) -- 0:02:01

      Average standard deviation of split frequencies: 0.000000

      420500 -- (-2643.717) (-2639.519) (-2636.947) [-2640.638] * (-2642.640) [-2639.370] (-2641.551) (-2640.909) -- 0:02:01
      421000 -- [-2648.401] (-2637.457) (-2641.753) (-2639.488) * [-2640.365] (-2647.221) (-2639.868) (-2645.526) -- 0:02:01
      421500 -- (-2642.768) (-2639.023) [-2635.803] (-2637.940) * [-2641.795] (-2644.125) (-2638.704) (-2637.389) -- 0:02:02
      422000 -- (-2633.977) (-2638.040) (-2637.646) [-2640.243] * [-2642.870] (-2647.282) (-2640.138) (-2637.947) -- 0:02:01
      422500 -- (-2643.768) (-2643.857) (-2642.002) [-2637.443] * (-2640.792) (-2645.051) [-2636.481] (-2634.598) -- 0:02:01
      423000 -- [-2646.418] (-2642.936) (-2641.146) (-2646.111) * (-2638.057) (-2643.203) (-2640.478) [-2638.922] -- 0:02:01
      423500 -- [-2639.170] (-2638.084) (-2640.145) (-2645.895) * (-2635.463) (-2641.223) (-2641.936) [-2640.364] -- 0:02:01
      424000 -- (-2641.210) [-2639.500] (-2641.311) (-2642.646) * (-2642.908) (-2636.556) [-2639.863] (-2639.535) -- 0:02:00
      424500 -- [-2642.920] (-2645.736) (-2647.124) (-2646.063) * (-2633.986) (-2644.156) (-2644.247) [-2639.044] -- 0:02:00
      425000 -- (-2640.865) [-2639.680] (-2638.539) (-2643.203) * (-2635.012) [-2644.967] (-2643.415) (-2643.651) -- 0:02:00

      Average standard deviation of split frequencies: 0.000000

      425500 -- (-2645.217) (-2641.202) [-2640.516] (-2645.012) * (-2641.915) [-2640.952] (-2644.573) (-2639.352) -- 0:02:00
      426000 -- (-2636.163) [-2639.729] (-2647.437) (-2639.266) * (-2646.302) (-2638.443) [-2641.529] (-2640.752) -- 0:01:59
      426500 -- (-2642.509) (-2638.655) (-2637.878) [-2643.464] * (-2638.597) (-2639.925) [-2641.111] (-2642.938) -- 0:02:01
      427000 -- (-2641.866) [-2640.825] (-2638.637) (-2638.587) * [-2637.832] (-2641.530) (-2647.476) (-2647.261) -- 0:02:00
      427500 -- [-2641.739] (-2641.589) (-2637.119) (-2641.009) * [-2636.881] (-2637.522) (-2641.089) (-2643.327) -- 0:02:00
      428000 -- (-2641.195) [-2641.757] (-2643.140) (-2650.327) * (-2636.985) (-2640.272) (-2642.427) [-2638.593] -- 0:02:00
      428500 -- (-2640.913) (-2649.494) [-2638.658] (-2637.546) * [-2633.463] (-2637.717) (-2637.215) (-2638.062) -- 0:02:00
      429000 -- (-2637.111) (-2640.915) [-2637.542] (-2645.228) * (-2642.431) [-2638.929] (-2643.840) (-2643.112) -- 0:01:59
      429500 -- (-2638.386) (-2640.941) [-2640.296] (-2639.787) * (-2638.313) [-2636.338] (-2637.550) (-2646.042) -- 0:01:59
      430000 -- (-2639.119) (-2638.584) [-2649.658] (-2636.680) * (-2637.894) [-2634.519] (-2639.833) (-2639.842) -- 0:01:59

      Average standard deviation of split frequencies: 0.000000

      430500 -- [-2648.449] (-2634.759) (-2636.447) (-2641.191) * (-2644.042) (-2638.430) (-2636.747) [-2644.166] -- 0:01:59
      431000 -- (-2643.753) (-2635.199) [-2637.954] (-2640.263) * (-2646.517) (-2636.615) (-2637.336) [-2640.850] -- 0:02:00
      431500 -- (-2642.535) [-2636.657] (-2638.817) (-2639.397) * [-2640.316] (-2646.440) (-2640.478) (-2640.705) -- 0:01:59
      432000 -- (-2640.357) [-2637.835] (-2639.335) (-2637.631) * (-2639.442) (-2642.461) [-2639.477] (-2638.892) -- 0:01:59
      432500 -- (-2641.097) (-2634.800) [-2642.161] (-2640.582) * [-2636.727] (-2638.215) (-2638.128) (-2645.385) -- 0:01:59
      433000 -- (-2636.693) (-2648.444) [-2647.083] (-2640.684) * (-2639.790) (-2635.577) [-2637.485] (-2641.951) -- 0:01:59
      433500 -- (-2642.028) [-2638.454] (-2643.553) (-2639.184) * (-2638.355) [-2636.856] (-2645.349) (-2647.843) -- 0:01:58
      434000 -- (-2639.423) (-2645.256) (-2643.002) [-2637.651] * (-2641.614) (-2634.869) [-2640.061] (-2641.068) -- 0:01:58
      434500 -- (-2645.842) (-2640.005) [-2636.919] (-2643.131) * (-2644.430) (-2637.635) (-2643.995) [-2640.786] -- 0:01:58
      435000 -- (-2637.035) (-2642.600) [-2639.666] (-2644.966) * (-2638.996) [-2639.080] (-2643.389) (-2642.733) -- 0:01:58

      Average standard deviation of split frequencies: 0.000000

      435500 -- (-2641.292) (-2639.769) (-2640.959) [-2642.459] * (-2639.531) [-2649.931] (-2640.651) (-2643.193) -- 0:01:57
      436000 -- [-2644.781] (-2641.635) (-2647.752) (-2636.924) * [-2640.809] (-2646.537) (-2643.812) (-2640.001) -- 0:01:59
      436500 -- (-2635.516) [-2640.756] (-2642.481) (-2642.641) * [-2637.772] (-2638.779) (-2639.300) (-2652.672) -- 0:01:58
      437000 -- [-2641.935] (-2648.075) (-2635.533) (-2639.438) * (-2639.409) (-2639.566) [-2639.778] (-2649.931) -- 0:01:58
      437500 -- [-2643.666] (-2644.906) (-2639.730) (-2641.729) * (-2643.900) (-2644.673) (-2643.231) [-2641.278] -- 0:01:58
      438000 -- [-2638.039] (-2636.042) (-2640.183) (-2638.726) * [-2635.825] (-2636.998) (-2636.529) (-2641.868) -- 0:01:58
      438500 -- [-2643.354] (-2641.540) (-2635.413) (-2642.859) * [-2642.017] (-2644.631) (-2642.187) (-2641.884) -- 0:01:57
      439000 -- (-2639.953) [-2639.732] (-2639.283) (-2636.451) * (-2646.856) (-2637.679) [-2638.220] (-2640.574) -- 0:01:57
      439500 -- (-2642.777) (-2636.914) [-2639.026] (-2637.722) * [-2638.210] (-2638.291) (-2643.259) (-2640.346) -- 0:01:57
      440000 -- [-2638.078] (-2640.355) (-2643.910) (-2641.179) * (-2641.870) (-2637.550) [-2641.391] (-2639.346) -- 0:01:57

      Average standard deviation of split frequencies: 0.000000

      440500 -- [-2639.130] (-2639.020) (-2639.993) (-2641.260) * (-2640.152) (-2633.735) [-2641.998] (-2642.126) -- 0:01:56
      441000 -- (-2646.431) (-2645.433) [-2638.638] (-2638.423) * [-2643.630] (-2643.249) (-2646.010) (-2640.134) -- 0:01:57
      441500 -- (-2637.255) (-2645.893) [-2638.400] (-2636.332) * (-2643.890) (-2641.143) [-2646.731] (-2639.184) -- 0:01:57
      442000 -- (-2635.874) (-2644.749) [-2636.625] (-2643.207) * [-2642.525] (-2639.894) (-2641.801) (-2642.253) -- 0:01:57
      442500 -- [-2637.425] (-2637.923) (-2635.694) (-2647.702) * (-2639.550) (-2635.681) (-2642.253) [-2639.727] -- 0:01:57
      443000 -- (-2636.415) (-2637.542) (-2639.754) [-2639.039] * (-2638.638) (-2642.061) (-2640.413) [-2643.030] -- 0:01:56
      443500 -- (-2638.682) (-2641.570) [-2638.910] (-2639.670) * (-2640.818) (-2649.827) [-2636.430] (-2642.009) -- 0:01:56
      444000 -- (-2637.398) (-2641.219) [-2640.790] (-2639.742) * (-2637.282) (-2637.504) [-2642.760] (-2642.532) -- 0:01:56
      444500 -- (-2634.472) (-2646.193) (-2644.625) [-2639.168] * [-2641.751] (-2640.669) (-2640.472) (-2635.814) -- 0:01:56
      445000 -- [-2639.100] (-2639.278) (-2638.619) (-2640.265) * (-2652.941) (-2638.259) (-2650.889) [-2639.087] -- 0:01:55

      Average standard deviation of split frequencies: 0.000000

      445500 -- (-2640.276) (-2639.296) [-2641.172] (-2643.505) * [-2641.836] (-2644.644) (-2648.265) (-2644.659) -- 0:01:56
      446000 -- (-2636.565) [-2638.695] (-2638.311) (-2641.500) * (-2640.040) [-2642.522] (-2647.550) (-2642.850) -- 0:01:56
      446500 -- [-2636.678] (-2640.430) (-2642.158) (-2638.059) * (-2636.703) (-2638.559) [-2641.493] (-2637.370) -- 0:01:56
      447000 -- (-2639.786) (-2643.936) (-2643.678) [-2644.337] * [-2637.934] (-2639.852) (-2643.080) (-2641.532) -- 0:01:56
      447500 -- (-2644.566) [-2640.253] (-2639.482) (-2641.077) * (-2642.840) (-2641.229) (-2640.344) [-2640.253] -- 0:01:56
      448000 -- (-2645.699) (-2635.923) (-2641.284) [-2639.309] * (-2644.541) (-2637.867) (-2641.211) [-2643.319] -- 0:01:55
      448500 -- [-2639.113] (-2646.460) (-2644.593) (-2640.865) * (-2636.407) (-2641.975) (-2641.018) [-2638.816] -- 0:01:55
      449000 -- [-2640.553] (-2641.406) (-2640.307) (-2635.935) * (-2642.708) (-2641.616) (-2643.800) [-2639.863] -- 0:01:55
      449500 -- [-2637.735] (-2644.807) (-2639.650) (-2648.750) * (-2638.830) (-2639.003) [-2640.957] (-2636.917) -- 0:01:55
      450000 -- (-2637.442) [-2639.247] (-2641.976) (-2639.192) * [-2642.898] (-2636.777) (-2643.895) (-2646.357) -- 0:01:54

      Average standard deviation of split frequencies: 0.000000

      450500 -- (-2640.055) (-2642.607) (-2643.627) [-2638.534] * (-2636.145) (-2641.699) (-2655.256) [-2639.470] -- 0:01:55
      451000 -- (-2641.864) (-2637.581) (-2637.737) [-2641.706] * (-2640.753) (-2639.234) [-2642.275] (-2649.174) -- 0:01:55
      451500 -- [-2644.378] (-2639.854) (-2645.551) (-2638.300) * (-2642.648) (-2639.623) [-2636.532] (-2646.098) -- 0:01:55
      452000 -- (-2635.129) [-2638.101] (-2633.028) (-2640.535) * (-2643.266) [-2643.172] (-2644.882) (-2642.215) -- 0:01:55
      452500 -- (-2641.665) (-2648.360) [-2640.143] (-2635.469) * (-2638.429) [-2636.124] (-2639.162) (-2649.507) -- 0:01:54
      453000 -- (-2642.329) (-2636.384) (-2636.811) [-2639.088] * (-2639.654) [-2635.857] (-2643.069) (-2646.989) -- 0:01:54
      453500 -- (-2649.979) (-2637.179) [-2635.917] (-2643.241) * [-2637.314] (-2639.849) (-2641.685) (-2644.144) -- 0:01:54
      454000 -- (-2642.131) (-2641.652) (-2640.265) [-2636.118] * (-2643.214) (-2635.157) [-2637.306] (-2641.491) -- 0:01:54
      454500 -- (-2637.775) (-2646.985) [-2638.282] (-2635.920) * [-2639.015] (-2640.004) (-2637.062) (-2645.743) -- 0:01:54
      455000 -- [-2637.905] (-2647.231) (-2642.234) (-2640.835) * [-2642.562] (-2641.938) (-2639.776) (-2646.809) -- 0:01:54

      Average standard deviation of split frequencies: 0.000000

      455500 -- [-2641.875] (-2648.825) (-2636.623) (-2641.496) * (-2635.918) (-2641.427) [-2638.611] (-2642.857) -- 0:01:54
      456000 -- (-2646.304) (-2642.258) (-2637.941) [-2638.620] * (-2640.871) [-2637.606] (-2641.898) (-2643.273) -- 0:01:54
      456500 -- (-2639.738) (-2638.439) [-2636.931] (-2639.741) * [-2635.697] (-2640.508) (-2646.589) (-2639.867) -- 0:01:54
      457000 -- (-2642.047) (-2641.054) [-2642.759] (-2641.929) * (-2642.690) (-2641.327) [-2645.890] (-2643.675) -- 0:01:54
      457500 -- (-2646.136) (-2637.113) (-2640.021) [-2633.905] * (-2636.278) (-2639.735) [-2640.801] (-2636.493) -- 0:01:53
      458000 -- (-2643.041) (-2643.777) (-2646.277) [-2638.396] * [-2637.971] (-2638.592) (-2644.400) (-2640.365) -- 0:01:53
      458500 -- (-2638.694) (-2642.598) (-2644.342) [-2639.363] * [-2636.194] (-2636.718) (-2644.846) (-2648.566) -- 0:01:53
      459000 -- (-2641.117) (-2637.998) [-2637.180] (-2633.760) * [-2638.316] (-2640.022) (-2644.708) (-2642.078) -- 0:01:53
      459500 -- [-2642.404] (-2639.125) (-2642.118) (-2641.537) * (-2647.329) [-2634.645] (-2641.954) (-2641.351) -- 0:01:52
      460000 -- (-2642.264) [-2632.530] (-2640.235) (-2642.132) * (-2648.199) [-2639.500] (-2632.633) (-2640.494) -- 0:01:53

      Average standard deviation of split frequencies: 0.000000

      460500 -- (-2639.754) (-2638.884) [-2639.603] (-2643.276) * (-2653.414) (-2641.555) (-2635.829) [-2639.826] -- 0:01:53
      461000 -- (-2643.076) (-2640.296) [-2632.605] (-2644.272) * (-2651.377) (-2643.293) [-2639.368] (-2638.712) -- 0:01:53
      461500 -- (-2642.389) (-2642.586) [-2637.744] (-2642.574) * (-2642.018) (-2637.725) [-2634.495] (-2638.095) -- 0:01:53
      462000 -- [-2641.179] (-2641.858) (-2639.720) (-2638.864) * (-2641.139) (-2641.879) [-2636.613] (-2639.851) -- 0:01:52
      462500 -- [-2638.784] (-2634.789) (-2635.267) (-2643.543) * (-2643.324) [-2643.646] (-2635.162) (-2636.276) -- 0:01:52
      463000 -- [-2640.996] (-2637.045) (-2639.820) (-2646.266) * (-2647.921) (-2643.577) (-2638.766) [-2639.827] -- 0:01:52
      463500 -- (-2640.327) (-2643.099) (-2642.264) [-2645.599] * (-2642.904) (-2648.662) (-2645.375) [-2642.624] -- 0:01:52
      464000 -- (-2636.689) [-2646.029] (-2644.197) (-2642.729) * (-2642.478) (-2648.222) [-2640.859] (-2642.218) -- 0:01:52
      464500 -- [-2635.645] (-2645.339) (-2640.802) (-2638.946) * [-2638.493] (-2645.739) (-2645.861) (-2637.477) -- 0:01:51
      465000 -- (-2637.051) (-2639.255) (-2641.071) [-2640.204] * (-2638.019) (-2643.796) (-2638.914) [-2636.690] -- 0:01:52

      Average standard deviation of split frequencies: 0.000000

      465500 -- (-2636.837) (-2643.618) (-2637.975) [-2639.143] * (-2637.858) (-2636.322) (-2636.219) [-2643.584] -- 0:01:52
      466000 -- (-2637.446) (-2641.215) (-2642.735) [-2637.344] * [-2639.916] (-2642.833) (-2637.641) (-2644.936) -- 0:01:52
      466500 -- (-2635.749) (-2637.352) [-2641.769] (-2639.625) * (-2639.512) [-2635.585] (-2634.447) (-2642.933) -- 0:01:52
      467000 -- [-2637.939] (-2645.790) (-2638.257) (-2641.112) * (-2639.639) (-2641.530) (-2640.737) [-2635.377] -- 0:01:51
      467500 -- [-2638.763] (-2644.858) (-2637.584) (-2640.944) * (-2634.479) (-2637.068) [-2636.213] (-2639.716) -- 0:01:51
      468000 -- [-2640.846] (-2639.872) (-2639.344) (-2638.979) * (-2635.467) [-2638.529] (-2639.422) (-2640.104) -- 0:01:51
      468500 -- (-2642.088) [-2639.707] (-2642.961) (-2639.835) * (-2639.345) [-2639.242] (-2642.926) (-2643.115) -- 0:01:51
      469000 -- [-2651.237] (-2635.737) (-2639.928) (-2645.090) * (-2637.366) [-2638.636] (-2640.770) (-2643.329) -- 0:01:50
      469500 -- (-2643.953) (-2640.325) (-2638.852) [-2645.296] * [-2636.736] (-2637.345) (-2643.511) (-2636.444) -- 0:01:51
      470000 -- (-2649.548) [-2639.655] (-2637.217) (-2645.823) * [-2636.961] (-2643.355) (-2635.255) (-2640.563) -- 0:01:51

      Average standard deviation of split frequencies: 0.000000

      470500 -- (-2650.997) [-2640.399] (-2633.935) (-2639.828) * [-2638.899] (-2647.250) (-2638.496) (-2638.697) -- 0:01:51
      471000 -- (-2645.829) (-2639.198) [-2636.092] (-2639.299) * (-2640.420) (-2646.605) [-2637.306] (-2639.125) -- 0:01:51
      471500 -- (-2638.955) (-2636.585) (-2637.208) [-2640.408] * (-2637.255) (-2640.582) (-2634.728) [-2644.249] -- 0:01:50
      472000 -- [-2641.151] (-2641.223) (-2639.719) (-2638.952) * (-2646.419) [-2643.850] (-2642.639) (-2640.693) -- 0:01:50
      472500 -- (-2641.470) (-2644.401) (-2638.261) [-2639.429] * (-2634.972) [-2637.106] (-2643.598) (-2640.183) -- 0:01:50
      473000 -- (-2645.045) [-2644.287] (-2637.744) (-2634.956) * (-2638.486) (-2640.649) (-2641.287) [-2640.513] -- 0:01:50
      473500 -- [-2644.317] (-2647.077) (-2642.855) (-2644.095) * [-2638.010] (-2640.158) (-2636.843) (-2637.337) -- 0:01:50
      474000 -- (-2639.103) (-2638.197) [-2638.643] (-2639.031) * (-2640.881) (-2639.819) (-2637.901) [-2634.937] -- 0:01:49
      474500 -- (-2643.398) (-2637.437) (-2641.395) [-2642.623] * [-2642.209] (-2639.193) (-2642.297) (-2636.629) -- 0:01:50
      475000 -- [-2639.132] (-2645.729) (-2640.864) (-2634.730) * (-2637.300) [-2637.867] (-2653.779) (-2639.109) -- 0:01:50

      Average standard deviation of split frequencies: 0.000000

      475500 -- (-2643.073) (-2644.884) [-2636.523] (-2643.476) * (-2637.917) (-2636.483) (-2643.712) [-2640.808] -- 0:01:50
      476000 -- (-2642.538) (-2640.165) [-2644.423] (-2639.067) * [-2637.378] (-2641.175) (-2646.232) (-2640.672) -- 0:01:50
      476500 -- (-2636.876) (-2636.269) [-2639.624] (-2642.047) * (-2648.586) (-2647.049) [-2644.051] (-2643.017) -- 0:01:49
      477000 -- [-2633.629] (-2639.668) (-2648.234) (-2646.342) * (-2640.068) [-2638.396] (-2638.565) (-2638.603) -- 0:01:49
      477500 -- (-2640.656) (-2644.147) [-2647.917] (-2641.021) * (-2638.134) [-2637.132] (-2640.022) (-2641.182) -- 0:01:49
      478000 -- (-2641.839) (-2640.621) [-2636.675] (-2634.889) * [-2640.960] (-2642.332) (-2639.438) (-2641.811) -- 0:01:49
      478500 -- (-2638.921) (-2641.906) [-2636.065] (-2643.110) * (-2641.500) [-2639.488] (-2644.249) (-2642.605) -- 0:01:48
      479000 -- (-2645.155) (-2643.197) (-2645.567) [-2639.194] * (-2641.671) (-2646.305) [-2642.495] (-2644.193) -- 0:01:49
      479500 -- (-2646.519) [-2644.828] (-2645.794) (-2642.955) * [-2636.921] (-2642.806) (-2637.493) (-2648.162) -- 0:01:49
      480000 -- (-2639.214) [-2636.885] (-2646.200) (-2640.281) * (-2638.059) [-2638.330] (-2641.167) (-2640.473) -- 0:01:49

      Average standard deviation of split frequencies: 0.000000

      480500 -- (-2640.309) (-2638.316) [-2642.199] (-2644.781) * (-2640.414) [-2640.200] (-2638.119) (-2641.489) -- 0:01:49
      481000 -- [-2634.696] (-2635.591) (-2646.888) (-2640.547) * (-2642.062) [-2642.995] (-2635.373) (-2641.225) -- 0:01:48
      481500 -- [-2636.131] (-2640.941) (-2643.026) (-2642.908) * (-2640.647) (-2643.574) (-2645.393) [-2636.807] -- 0:01:48
      482000 -- [-2642.092] (-2636.478) (-2647.133) (-2644.819) * [-2639.897] (-2648.266) (-2641.717) (-2650.959) -- 0:01:48
      482500 -- (-2635.917) [-2635.511] (-2643.159) (-2648.462) * (-2636.390) [-2639.389] (-2638.309) (-2639.232) -- 0:01:48
      483000 -- [-2638.681] (-2638.022) (-2642.061) (-2640.537) * (-2640.523) (-2636.450) [-2636.923] (-2639.700) -- 0:01:48
      483500 -- (-2639.889) (-2646.886) [-2638.029] (-2641.950) * (-2640.920) [-2639.042] (-2640.240) (-2637.333) -- 0:01:47
      484000 -- (-2639.572) (-2645.848) [-2641.569] (-2646.968) * (-2643.926) [-2635.358] (-2637.946) (-2644.637) -- 0:01:48
      484500 -- (-2641.632) (-2644.897) [-2638.995] (-2655.140) * [-2634.344] (-2639.213) (-2652.903) (-2638.871) -- 0:01:48
      485000 -- (-2642.710) (-2642.106) [-2642.823] (-2641.142) * (-2640.463) (-2644.455) (-2637.667) [-2636.364] -- 0:01:48

      Average standard deviation of split frequencies: 0.000000

      485500 -- (-2642.191) (-2640.769) [-2640.089] (-2650.140) * (-2642.495) [-2648.528] (-2646.935) (-2641.648) -- 0:01:48
      486000 -- (-2639.455) [-2635.939] (-2647.466) (-2638.623) * [-2641.602] (-2642.961) (-2650.298) (-2638.737) -- 0:01:47
      486500 -- (-2642.589) (-2641.209) (-2642.358) [-2643.650] * (-2637.274) (-2643.369) [-2643.683] (-2644.186) -- 0:01:47
      487000 -- (-2636.779) [-2645.374] (-2639.727) (-2642.627) * (-2637.204) (-2639.048) (-2652.633) [-2644.996] -- 0:01:47
      487500 -- (-2636.894) (-2649.082) [-2639.016] (-2639.184) * (-2645.790) (-2636.929) [-2653.991] (-2650.598) -- 0:01:47
      488000 -- (-2641.918) (-2641.010) (-2638.755) [-2641.803] * (-2637.636) [-2638.747] (-2642.222) (-2650.969) -- 0:01:47
      488500 -- [-2640.976] (-2642.760) (-2637.325) (-2644.742) * (-2638.868) [-2639.683] (-2639.273) (-2645.077) -- 0:01:47
      489000 -- (-2643.132) [-2638.641] (-2636.609) (-2646.724) * (-2640.599) (-2640.195) (-2640.556) [-2642.537] -- 0:01:47
      489500 -- [-2639.408] (-2640.833) (-2641.046) (-2641.711) * (-2640.878) [-2639.771] (-2646.165) (-2639.774) -- 0:01:47
      490000 -- (-2637.796) (-2640.166) (-2641.424) [-2646.197] * (-2640.628) (-2639.125) (-2643.242) [-2644.639] -- 0:01:47

      Average standard deviation of split frequencies: 0.000000

      490500 -- (-2638.106) (-2642.187) [-2638.857] (-2639.614) * (-2640.022) [-2636.191] (-2644.040) (-2642.610) -- 0:01:46
      491000 -- (-2638.118) (-2643.836) (-2642.889) [-2637.668] * (-2637.524) (-2641.565) [-2640.083] (-2638.212) -- 0:01:46
      491500 -- (-2642.655) (-2636.958) [-2643.205] (-2639.164) * [-2641.489] (-2638.899) (-2637.827) (-2650.658) -- 0:01:46
      492000 -- (-2649.765) [-2634.912] (-2643.106) (-2640.649) * [-2638.441] (-2651.210) (-2635.039) (-2639.780) -- 0:01:46
      492500 -- (-2642.845) (-2638.088) (-2642.872) [-2641.415] * (-2642.442) (-2644.508) (-2635.248) [-2637.965] -- 0:01:46
      493000 -- [-2648.301] (-2637.910) (-2640.348) (-2638.607) * (-2640.583) (-2637.669) [-2636.807] (-2639.945) -- 0:01:45
      493500 -- (-2643.029) [-2640.736] (-2638.937) (-2639.627) * (-2636.289) (-2639.125) [-2637.983] (-2639.045) -- 0:01:46
      494000 -- (-2642.245) [-2644.071] (-2644.812) (-2641.467) * (-2637.367) (-2639.626) [-2640.068] (-2642.045) -- 0:01:46
      494500 -- (-2639.515) [-2645.489] (-2640.576) (-2637.183) * (-2640.304) [-2639.598] (-2641.960) (-2640.915) -- 0:01:46
      495000 -- [-2637.325] (-2649.932) (-2641.514) (-2637.630) * (-2644.349) (-2638.051) [-2638.698] (-2643.986) -- 0:01:46

      Average standard deviation of split frequencies: 0.000000

      495500 -- (-2637.592) (-2646.798) [-2641.014] (-2646.589) * (-2633.759) [-2639.899] (-2641.617) (-2641.314) -- 0:01:45
      496000 -- (-2639.567) (-2642.085) [-2641.121] (-2636.456) * [-2642.369] (-2642.716) (-2649.325) (-2644.723) -- 0:01:45
      496500 -- (-2641.426) (-2640.568) (-2648.676) [-2635.102] * (-2641.791) (-2647.931) [-2634.951] (-2644.958) -- 0:01:45
      497000 -- (-2641.016) (-2645.399) [-2640.687] (-2634.923) * (-2645.591) [-2648.773] (-2635.791) (-2637.732) -- 0:01:45
      497500 -- [-2640.720] (-2643.686) (-2647.349) (-2638.421) * (-2636.928) (-2643.652) [-2638.990] (-2643.371) -- 0:01:45
      498000 -- [-2638.235] (-2640.933) (-2636.972) (-2642.178) * [-2636.704] (-2645.180) (-2641.073) (-2641.708) -- 0:01:44
      498500 -- (-2642.346) (-2638.129) (-2640.943) [-2645.299] * (-2633.232) [-2640.933] (-2644.354) (-2641.539) -- 0:01:45
      499000 -- [-2643.852] (-2647.606) (-2637.656) (-2638.815) * (-2637.006) [-2636.530] (-2640.068) (-2640.485) -- 0:01:45
      499500 -- (-2640.573) (-2646.876) (-2638.934) [-2644.739] * (-2640.422) (-2642.940) [-2641.891] (-2638.500) -- 0:01:45
      500000 -- [-2642.086] (-2636.433) (-2637.550) (-2639.354) * (-2644.970) (-2639.720) (-2641.956) [-2639.219] -- 0:01:45

      Average standard deviation of split frequencies: 0.000000

      500500 -- [-2640.546] (-2640.071) (-2642.297) (-2638.700) * (-2640.468) (-2634.686) [-2638.782] (-2641.635) -- 0:01:44
      501000 -- (-2640.810) (-2642.937) [-2639.897] (-2640.754) * (-2640.208) [-2639.300] (-2638.624) (-2641.583) -- 0:01:44
      501500 -- [-2638.451] (-2643.767) (-2644.174) (-2634.680) * [-2640.138] (-2639.356) (-2639.928) (-2639.527) -- 0:01:44
      502000 -- (-2637.630) (-2637.764) (-2639.873) [-2638.054] * (-2638.674) [-2637.707] (-2640.228) (-2641.113) -- 0:01:44
      502500 -- (-2640.930) (-2647.137) (-2645.304) [-2635.287] * (-2639.637) (-2640.791) (-2644.326) [-2639.951] -- 0:01:43
      503000 -- (-2639.496) (-2638.213) (-2643.989) [-2635.095] * (-2644.477) (-2639.467) [-2642.680] (-2640.013) -- 0:01:44
      503500 -- (-2641.224) (-2635.599) (-2640.948) [-2637.452] * [-2642.066] (-2646.792) (-2632.796) (-2643.954) -- 0:01:44
      504000 -- (-2643.015) (-2642.232) (-2646.697) [-2638.162] * (-2639.077) (-2646.219) [-2641.313] (-2638.829) -- 0:01:44
      504500 -- (-2641.077) (-2636.863) (-2652.298) [-2638.085] * (-2639.309) [-2634.859] (-2645.450) (-2638.729) -- 0:01:44
      505000 -- [-2638.447] (-2640.139) (-2646.673) (-2646.662) * (-2640.441) [-2643.409] (-2638.168) (-2639.580) -- 0:01:43

      Average standard deviation of split frequencies: 0.000000

      505500 -- [-2638.060] (-2640.551) (-2643.640) (-2637.622) * (-2648.362) (-2639.934) [-2634.338] (-2640.211) -- 0:01:43
      506000 -- (-2641.345) (-2646.428) (-2637.231) [-2636.887] * [-2639.675] (-2637.531) (-2639.252) (-2645.537) -- 0:01:43
      506500 -- (-2648.405) (-2636.350) (-2641.955) [-2641.413] * (-2637.170) [-2636.991] (-2638.486) (-2636.212) -- 0:01:43
      507000 -- (-2647.424) [-2642.412] (-2646.004) (-2646.306) * (-2640.442) [-2636.809] (-2642.663) (-2635.403) -- 0:01:43
      507500 -- [-2638.930] (-2640.925) (-2637.786) (-2637.461) * (-2641.918) (-2637.634) [-2637.243] (-2638.941) -- 0:01:42
      508000 -- (-2638.253) (-2636.685) [-2638.295] (-2640.715) * (-2647.617) (-2639.629) (-2637.856) [-2637.997] -- 0:01:43
      508500 -- [-2638.773] (-2651.754) (-2645.841) (-2634.918) * [-2645.038] (-2645.680) (-2640.257) (-2636.028) -- 0:01:43
      509000 -- (-2635.571) (-2639.599) [-2643.255] (-2638.973) * (-2656.459) (-2639.752) (-2637.715) [-2640.168] -- 0:01:43
      509500 -- (-2637.941) (-2642.523) (-2643.192) [-2634.981] * (-2637.367) (-2638.630) (-2638.085) [-2640.053] -- 0:01:43
      510000 -- (-2638.904) (-2644.454) [-2644.713] (-2643.733) * (-2635.104) (-2640.777) [-2638.886] (-2641.064) -- 0:01:42

      Average standard deviation of split frequencies: 0.000000

      510500 -- [-2640.422] (-2646.714) (-2646.363) (-2648.664) * [-2641.095] (-2641.982) (-2642.461) (-2644.538) -- 0:01:42
      511000 -- (-2635.392) (-2639.393) (-2647.044) [-2638.763] * (-2641.229) (-2638.897) [-2637.765] (-2639.124) -- 0:01:42
      511500 -- (-2638.766) (-2640.193) (-2643.002) [-2641.770] * [-2639.513] (-2635.583) (-2636.740) (-2640.540) -- 0:01:42
      512000 -- [-2638.862] (-2644.823) (-2644.694) (-2638.933) * [-2644.377] (-2647.607) (-2639.195) (-2642.465) -- 0:01:41
      512500 -- (-2640.567) (-2640.263) (-2643.311) [-2638.016] * (-2640.011) (-2641.952) (-2641.477) [-2646.489] -- 0:01:41
      513000 -- (-2640.530) (-2635.943) (-2635.763) [-2644.025] * (-2638.385) (-2637.814) [-2645.760] (-2638.857) -- 0:01:42
      513500 -- (-2646.145) [-2639.999] (-2643.239) (-2642.204) * (-2639.833) (-2643.256) [-2643.392] (-2640.795) -- 0:01:42
      514000 -- (-2641.802) (-2646.353) (-2642.608) [-2636.506] * (-2644.416) (-2638.544) [-2635.487] (-2642.805) -- 0:01:42
      514500 -- [-2639.435] (-2641.288) (-2642.200) (-2642.370) * [-2637.376] (-2645.150) (-2640.705) (-2636.717) -- 0:01:41
      515000 -- [-2640.679] (-2645.544) (-2640.949) (-2647.454) * (-2639.722) (-2645.219) (-2639.723) [-2640.231] -- 0:01:41

      Average standard deviation of split frequencies: 0.000000

      515500 -- (-2642.294) (-2639.475) [-2635.303] (-2641.088) * (-2640.627) (-2641.095) (-2636.037) [-2636.909] -- 0:01:41
      516000 -- (-2642.961) (-2638.395) (-2640.133) [-2639.602] * [-2638.977] (-2641.185) (-2636.815) (-2638.149) -- 0:01:41
      516500 -- (-2646.462) (-2639.958) [-2638.058] (-2641.948) * [-2641.939] (-2638.465) (-2644.671) (-2635.071) -- 0:01:41
      517000 -- [-2643.063] (-2639.824) (-2641.594) (-2634.326) * (-2645.911) (-2643.507) [-2641.355] (-2637.430) -- 0:01:40
      517500 -- (-2642.309) (-2637.202) [-2645.631] (-2640.734) * (-2647.688) (-2635.161) [-2635.540] (-2639.972) -- 0:01:41
      518000 -- [-2640.852] (-2642.787) (-2645.440) (-2639.912) * [-2641.445] (-2643.281) (-2640.389) (-2641.573) -- 0:01:41
      518500 -- (-2637.915) (-2636.883) (-2638.792) [-2640.070] * (-2643.700) [-2635.344] (-2642.762) (-2645.465) -- 0:01:41
      519000 -- [-2638.639] (-2639.883) (-2642.066) (-2645.034) * (-2641.081) (-2640.499) [-2642.886] (-2642.203) -- 0:01:41
      519500 -- (-2637.186) [-2637.666] (-2642.173) (-2643.500) * (-2643.676) [-2645.616] (-2642.667) (-2646.806) -- 0:01:40
      520000 -- [-2639.889] (-2642.021) (-2636.633) (-2640.832) * (-2642.810) (-2644.319) [-2643.550] (-2650.682) -- 0:01:40

      Average standard deviation of split frequencies: 0.000000

      520500 -- [-2637.694] (-2642.598) (-2634.832) (-2641.589) * (-2645.063) [-2644.025] (-2647.340) (-2645.906) -- 0:01:40
      521000 -- (-2636.365) (-2638.749) [-2637.730] (-2648.052) * [-2639.023] (-2639.949) (-2637.434) (-2642.542) -- 0:01:40
      521500 -- (-2636.127) (-2644.070) [-2642.563] (-2645.188) * (-2639.808) [-2643.261] (-2636.256) (-2634.399) -- 0:01:40
      522000 -- (-2636.152) (-2641.116) [-2641.518] (-2647.392) * (-2641.243) (-2637.051) (-2638.423) [-2642.096] -- 0:01:40
      522500 -- (-2634.649) [-2638.878] (-2641.053) (-2647.485) * [-2637.574] (-2640.743) (-2640.150) (-2640.015) -- 0:01:40
      523000 -- (-2638.562) (-2642.130) [-2637.041] (-2639.241) * (-2646.921) (-2640.859) [-2639.896] (-2639.151) -- 0:01:40
      523500 -- [-2635.528] (-2641.992) (-2636.643) (-2644.020) * (-2645.149) [-2639.250] (-2639.946) (-2635.767) -- 0:01:40
      524000 -- [-2638.788] (-2639.840) (-2637.220) (-2638.237) * (-2645.970) (-2641.255) [-2646.753] (-2640.201) -- 0:01:39
      524500 -- [-2640.831] (-2650.278) (-2635.344) (-2636.773) * [-2637.415] (-2642.814) (-2636.638) (-2638.895) -- 0:01:39
      525000 -- (-2639.122) [-2635.109] (-2642.239) (-2640.207) * (-2639.634) [-2637.339] (-2643.508) (-2642.998) -- 0:01:39

      Average standard deviation of split frequencies: 0.000000

      525500 -- (-2641.656) (-2643.940) (-2639.403) [-2636.915] * [-2641.227] (-2639.163) (-2638.763) (-2641.914) -- 0:01:39
      526000 -- (-2637.150) (-2647.082) [-2639.090] (-2636.259) * (-2645.502) (-2640.498) (-2639.422) [-2637.895] -- 0:01:39
      526500 -- (-2639.837) [-2637.242] (-2638.931) (-2635.607) * (-2641.401) (-2642.477) [-2638.210] (-2639.661) -- 0:01:38
      527000 -- (-2638.108) (-2642.200) (-2643.131) [-2634.600] * (-2637.536) (-2636.098) [-2638.529] (-2643.162) -- 0:01:39
      527500 -- (-2638.486) (-2639.668) (-2640.164) [-2638.119] * (-2637.428) (-2642.392) (-2638.660) [-2635.980] -- 0:01:39
      528000 -- (-2636.430) [-2639.156] (-2637.885) (-2640.747) * (-2638.237) (-2640.152) [-2634.458] (-2633.577) -- 0:01:39
      528500 -- [-2644.664] (-2642.381) (-2650.618) (-2638.138) * (-2639.719) [-2637.005] (-2641.085) (-2637.551) -- 0:01:39
      529000 -- (-2642.454) (-2636.835) (-2646.168) [-2637.036] * (-2638.454) (-2637.125) [-2640.459] (-2644.607) -- 0:01:38
      529500 -- (-2638.486) (-2633.973) (-2641.954) [-2642.487] * [-2641.771] (-2642.431) (-2637.316) (-2635.865) -- 0:01:38
      530000 -- [-2641.094] (-2646.472) (-2641.409) (-2645.185) * (-2640.029) (-2639.459) [-2638.026] (-2637.363) -- 0:01:38

      Average standard deviation of split frequencies: 0.000000

      530500 -- (-2638.164) (-2637.652) [-2637.030] (-2644.572) * (-2641.803) [-2634.452] (-2639.406) (-2642.959) -- 0:01:38
      531000 -- [-2639.006] (-2644.748) (-2643.032) (-2643.774) * (-2641.578) (-2639.284) (-2637.731) [-2636.860] -- 0:01:38
      531500 -- (-2636.258) [-2640.689] (-2643.075) (-2640.292) * [-2640.152] (-2643.964) (-2643.255) (-2644.617) -- 0:01:38
      532000 -- (-2636.853) [-2642.763] (-2645.905) (-2640.957) * (-2643.639) (-2643.404) (-2638.557) [-2643.663] -- 0:01:38
      532500 -- (-2640.392) (-2640.030) (-2647.904) [-2640.328] * [-2638.356] (-2644.336) (-2639.388) (-2643.194) -- 0:01:38
      533000 -- (-2640.393) [-2632.654] (-2640.696) (-2643.002) * [-2639.314] (-2641.725) (-2641.133) (-2642.417) -- 0:01:38
      533500 -- (-2642.096) (-2646.551) [-2636.709] (-2641.142) * [-2637.834] (-2637.059) (-2640.078) (-2646.386) -- 0:01:37
      534000 -- (-2647.882) [-2634.729] (-2639.544) (-2636.281) * (-2637.446) (-2636.915) [-2640.418] (-2641.938) -- 0:01:37
      534500 -- (-2640.691) (-2635.861) [-2637.623] (-2641.704) * [-2636.514] (-2635.578) (-2640.583) (-2638.883) -- 0:01:37
      535000 -- (-2646.678) (-2639.173) [-2640.302] (-2637.387) * (-2636.027) (-2641.568) (-2648.942) [-2643.205] -- 0:01:37

      Average standard deviation of split frequencies: 0.000000

      535500 -- (-2648.658) [-2635.104] (-2641.769) (-2643.675) * (-2639.084) (-2639.627) [-2648.568] (-2639.977) -- 0:01:37
      536000 -- (-2644.952) [-2637.594] (-2647.414) (-2639.369) * [-2635.921] (-2642.443) (-2646.202) (-2645.322) -- 0:01:37
      536500 -- (-2641.711) [-2636.291] (-2641.597) (-2635.556) * [-2638.875] (-2644.586) (-2639.782) (-2637.474) -- 0:01:37
      537000 -- (-2640.194) [-2639.923] (-2648.698) (-2640.606) * (-2643.088) (-2635.064) (-2637.822) [-2643.892] -- 0:01:37
      537500 -- (-2644.188) [-2636.925] (-2642.038) (-2637.503) * (-2645.421) (-2641.915) (-2640.731) [-2643.954] -- 0:01:37
      538000 -- (-2643.983) (-2645.190) [-2639.520] (-2635.776) * [-2639.622] (-2650.626) (-2646.081) (-2641.295) -- 0:01:37
      538500 -- (-2650.146) (-2641.383) (-2644.264) [-2635.410] * (-2642.545) [-2642.826] (-2641.064) (-2640.306) -- 0:01:36
      539000 -- (-2638.937) (-2647.369) [-2642.305] (-2643.908) * [-2639.720] (-2637.975) (-2642.684) (-2637.908) -- 0:01:36
      539500 -- [-2641.902] (-2651.951) (-2640.774) (-2645.411) * (-2640.891) (-2643.586) (-2641.229) [-2650.227] -- 0:01:36
      540000 -- (-2645.231) [-2637.736] (-2642.338) (-2655.984) * [-2637.783] (-2640.872) (-2639.130) (-2640.599) -- 0:01:36

      Average standard deviation of split frequencies: 0.000000

      540500 -- [-2634.005] (-2652.946) (-2639.919) (-2645.679) * [-2636.017] (-2641.594) (-2641.214) (-2636.472) -- 0:01:36
      541000 -- (-2638.201) [-2639.864] (-2639.268) (-2647.856) * (-2647.853) [-2637.111] (-2641.967) (-2635.031) -- 0:01:36
      541500 -- (-2636.399) (-2645.215) [-2640.838] (-2640.489) * (-2638.402) (-2641.595) [-2640.129] (-2640.174) -- 0:01:36
      542000 -- [-2636.596] (-2642.423) (-2640.961) (-2643.950) * (-2638.590) (-2634.759) (-2640.624) [-2636.253] -- 0:01:36
      542500 -- (-2638.526) [-2640.447] (-2640.290) (-2659.623) * [-2633.199] (-2638.251) (-2642.356) (-2635.861) -- 0:01:36
      543000 -- [-2640.899] (-2644.194) (-2640.734) (-2648.987) * (-2643.418) [-2636.38