--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Nov 17 15:43:57 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/106/CG30334-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -991.88 -1000.56
2 -992.01 -1001.59
--------------------------------------
TOTAL -991.94 -1001.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.344790 0.003869 0.236055 0.467924 0.339093 1034.14 1081.85 1.000
r(A<->C){all} 0.235404 0.003950 0.122106 0.358438 0.230435 634.98 740.64 1.000
r(A<->G){all} 0.238452 0.003584 0.117628 0.352196 0.235823 664.98 769.66 1.000
r(A<->T){all} 0.158294 0.003493 0.050633 0.272693 0.152395 555.13 610.92 1.000
r(C<->G){all} 0.058448 0.000715 0.008355 0.108863 0.054925 711.11 934.32 1.000
r(C<->T){all} 0.170204 0.002511 0.071580 0.265215 0.166629 742.52 898.72 1.000
r(G<->T){all} 0.139197 0.001937 0.058864 0.228727 0.133619 637.13 796.06 1.000
pi(A){all} 0.172183 0.000281 0.141353 0.205084 0.171470 1173.97 1200.06 1.000
pi(C){all} 0.245360 0.000383 0.206399 0.283324 0.244968 1204.59 1338.55 1.000
pi(G){all} 0.357782 0.000493 0.315657 0.400682 0.356980 1285.57 1309.22 1.000
pi(T){all} 0.224674 0.000372 0.189596 0.263825 0.224057 1019.36 1092.87 1.000
alpha{1,2} 0.175482 0.024678 0.000112 0.446969 0.143566 1034.34 1055.00 1.000
alpha{3} 1.121037 0.368506 0.235638 2.303499 0.982908 1256.08 1378.54 1.000
pinvar{all} 0.218455 0.018306 0.000079 0.457781 0.207204 1149.03 1262.53 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -838.051446
Model 2: PositiveSelection -830.039553
Model 0: one-ratio -844.07368
Model 3: discrete -830.002417
Model 7: beta -838.078527
Model 8: beta&w>1 -830.04008
Model 0 vs 1 12.044467999999824
Model 2 vs 1 16.0237860000002
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)
Pr(w>1) post mean +- SE for w
59 Q 1.000** 48.522
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)
Pr(w>1) post mean +- SE for w
59 Q 0.998** 8.151 +- 2.103
60 G 0.607 5.272 +- 3.902
85 S 0.639 5.496 +- 3.848
Model 8 vs 7 16.07689400000004
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)
Pr(w>1) post mean +- SE for w
59 Q 1.000** 48.372
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)
Pr(w>1) post mean +- SE for w
59 Q 0.999** 7.907 +- 2.175
60 G 0.707 5.786 +- 3.778
85 S 0.745 6.048 +- 3.667
>C1
MSSCRQFNPFYIGPYPERACGDCPYGEYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGGGQGGGGGRGGCGGRGRGGCAPSCGPRGGSWSCGPRPYSPCYQ
FPYGADSCMMCSSGFGCCGQSCRASCYSCCooooooooo
>C2
MSSCGQFNPFYIGPYPDRACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGGGGGGQGCGGGRGGCGGRGRGACAPSCGPRGGSWSCGPRPCSP
CYQFPNGADSCMMCSSGFGCCGQSCRASCYSCCoooooo
>C3
MSSCGQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGQGCGGGRSGCGGRGGCGGRGRGACAPSCGPRGGSWSCGPRPCS
PCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooo
>C4
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGRRCGGGCGGCGGGGRGREGCGGCGGGGRGGCGPSCGPRSGGSSW
CPGYSPYYQSPCGADSCMMCSSGFGCCGQSCRTSCYSCC
>C5
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGGGGRRCGGGGGGCGGRGRGGCGPSCGHRGGSSWGPRYSQYYQS
PCGVDSCMMCSSGFGCCGQSCRTSCYSCCoooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=150
C1 MSSCRQFNPFYIGPYPERACGDCPYGEYSGFTRCGWSGGNGPFGTTFCDS
C2 MSSCGQFNPFYIGPYPDRACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
C3 MSSCGQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
C4 MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
C5 MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
*.** ***********:*********:***********************
C1 RYGGGGG----GGQGGGGGR------GGCGGRGRGGCAPSCGPRGGSWSC
C2 RYGGGGG-GGGGGQGCGGGR------GGCGGRGRGACAPSCGPRGGSWSC
C3 RYGGGGGQGCGGGRSGCGGR------GGCGGRGRGACAPSCGPRGGSWSC
C4 RYGGGGRRCGGGCGGCGGGGRGREGCGGCGGGGRGGCGPSCGPRSGGSSW
C5 RYGGGG---GGGGRRCGGGG------GGCGGRGRGGCGPSCGHR-GGSSW
****** * ** ***** ***.*.**** * *. *
C1 GPRPYSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooooooo-
C2 GPRPCSPCYQFPNGADSCMMCSSGFGCCGQSCRASCYSCCoooooo----
C3 GPRPCSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooo-----
C4 CPG-YSPYYQSPCGADSCMMCSSGFGCCGQSCRTSCYSCC----------
C5 GPR-YSQYYQSPCGVDSCMMCSSGFGCCGQSCRTSCYSCCoooooooooo
* * ** * *.******************:******
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4694]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [4694]--->[4251]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.260 Mb, Max= 30.495 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSSCRQFNPFYIGPYPERACGDCPYGEYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGG----GGQGGGGGR------GGCGGRGRGGCAPSCGPRGGSWSC
GPRPYSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooooooo-
>C2
MSSCGQFNPFYIGPYPDRACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGG-GGGGGQGCGGGR------GGCGGRGRGACAPSCGPRGGSWSC
GPRPCSPCYQFPNGADSCMMCSSGFGCCGQSCRASCYSCCoooooo----
>C3
MSSCGQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGQGCGGGRSGCGGR------GGCGGRGRGACAPSCGPRGGSWSC
GPRPCSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooo-----
>C4
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGRRCGGGCGGCGGGGRGREGCGGCGGGGRGGCGPSCGPRSGGSSW
CPG-YSPYYQSPCGADSCMMCSSGFGCCGQSCRTSCYSCC----------
>C5
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGG---GGGGRRCGGGG------GGCGGRGRGGCGPSCGHR-GGSSW
GPR-YSQYYQSPCGVDSCMMCSSGFGCCGQSCRTSCYSCCoooooooooo
FORMAT of file /tmp/tmp1756401708883576796aln Not Supported[FATAL:T-COFFEE]
>C1
MSSCRQFNPFYIGPYPERACGDCPYGEYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGG----GGQGGGGGR------GGCGGRGRGGCAPSCGPRGGSWSC
GPRPYSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooooooo-
>C2
MSSCGQFNPFYIGPYPDRACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGG-GGGGGQGCGGGR------GGCGGRGRGACAPSCGPRGGSWSC
GPRPCSPCYQFPNGADSCMMCSSGFGCCGQSCRASCYSCCoooooo----
>C3
MSSCGQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGQGCGGGRSGCGGR------GGCGGRGRGACAPSCGPRGGSWSC
GPRPCSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooo-----
>C4
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGRRCGGGCGGCGGGGRGREGCGGCGGGGRGGCGPSCGPRSGGSSW
CPG-YSPYYQSPCGADSCMMCSSGFGCCGQSCRTSCYSCC----------
>C5
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGG---GGGGRRCGGGG------GGCGGRGRGGCGPSCGHR-GGSSW
GPR-YSQYYQSPCGVDSCMMCSSGFGCCGQSCRTSCYSCCoooooooooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:150 S:87 BS:150
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 94.85 C1 C2 94.85
TOP 1 0 94.85 C2 C1 94.85
BOT 0 2 94.81 C1 C3 94.81
TOP 2 0 94.81 C3 C1 94.81
BOT 0 3 85.27 C1 C4 85.27
TOP 3 0 85.27 C4 C1 85.27
BOT 0 4 87.50 C1 C5 87.50
TOP 4 0 87.50 C5 C1 87.50
BOT 1 2 94.93 C2 C3 94.93
TOP 2 1 94.93 C3 C2 94.93
BOT 1 3 83.33 C2 C4 83.33
TOP 3 1 83.33 C4 C2 83.33
BOT 1 4 85.93 C2 C5 85.93
TOP 4 1 85.93 C5 C2 85.93
BOT 2 3 80.45 C3 C4 80.45
TOP 3 2 80.45 C4 C3 80.45
BOT 2 4 85.07 C3 C5 85.07
TOP 4 2 85.07 C5 C3 85.07
BOT 3 4 93.02 C4 C5 93.02
TOP 4 3 93.02 C5 C4 93.02
AVG 0 C1 * 90.61
AVG 1 C2 * 89.76
AVG 2 C3 * 88.82
AVG 3 C4 * 85.52
AVG 4 C5 * 87.88
TOT TOT * 88.52
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCCAGCTGCAGACAGTTCAATCCGTTCTACATTGGACCCTATCCGGA
C2 ATGTCCAGCTGCGGGCAGTTCAATCCGTTCTACATTGGACCCTATCCGGA
C3 ATGTCCAGCTGCGGGCAGTTCAATCCGTTCTACATTGGACCCTATCCGGA
C4 ATGTGCAGCTGCAGACAGTTCAATCCGTTCTACATCGGACCCTATCCGGA
C5 ATGTGCAGCTGCAGACAGTTCAATCCGTTCTACATCGGACCCTATCCGGA
**** *******.*.******************** **************
C1 GCGTGCGTGCGGCGATTGTCCGTATGGCGAGTACTCGGGCTTCACCAGAT
C2 TCGTGCGTGCGGCGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT
C3 GCGTGCGTGCGGCGATTGTCCGTATGGCCAGTATTCGGGCTTCACCAGAT
C4 GCGTGCCTGCGGGGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT
C5 GCGTGCTTGCGGGGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT
***** ***** *************** **** ****************
C1 GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC
C2 GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC
C3 GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC
C4 GCGGATGGAGTGGCGGAAACGGTCCCTTCGGCACCACCTTCTGTGATTCC
C5 GCGGATGGAGCGGCGGAAACGGTCCCTTTGGCACCACCTTCTGTGATTCC
********** *****:***** ***** ***************** ***
C1 CGCTATGGCGGAGGAGGAGGA------------GGCGGCCAAGGCGGTGG
C2 CGCTACGGCGGAGGAGGAGGA---GGAGGAGGAGGAGGCCAAGGCTGTGG
C3 CGCTACGGCGGAGGAGGAGGCCAAGGCTGTGGAGGAGGGAGAAGTGGTTG
C4 CGCTACGGTGGAGGAGGAAGGAGATGTGGAGGCGGCTGTGGTGGATGTGG
C5 CGCTACGGTGGAGGCGGA---------GGAGGAGGAGGAAGGAGATGTGG
***** ** *****.*** **. * . .* ** *
C1 AGGAGGGAGA------------------GGTGGATGTGGAGGCAGAGGCA
C2 AGGAGGGAGA------------------GGTGGTTGTGGAGGCAGAGGCA
C3 TGGAGGGAGA------------------GGTGGTTGTGGAGGCAGAGGCA
C4 AGGAGGAGGTAGAGGTAGAGAAGGATGTGGTGGATGTGGAGGAGGAGGCA
C5 AGGCGGAGGT------------------GGTGGATGTGGAGGAAGAGGCA
:**.**..*: *****:********..******
C1 GAGGTGGTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT
C2 GAGGTGCTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT
C3 GAGGTGCTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT
C4 GAGGTGGTTGTGGTCCATCGTGTGGTCCCCGTAGTGGCGGATCGTCCTGG
C5 GAGGTGGTTGTGGGCCATCGTGTGGTCATCGT---GGCGGATCGTCCTGG
****** ***** ***** *******. *** **. .* ******
C1 GGTCCCCGCCCGTATTCCCCGTGCTATCAATTTCCGTACGGAGCGGACAG
C2 GGTCCCCGCCCGTGTTCCCCGTGCTATCAGTTTCCAAACGGAGCGGACAG
C3 GGTCCCCGGCCGTGTTCCCCGTGCTATCAGTTTCCGTACGGAGCGGACAG
C4 TGTCCCGGC---TATTCCCCGTACTATCAGTCGCCGTGCGGAGCGGACAG
C5 GGTCCCCGC---TATTCCCAGTACTATCAGTCGCCGTGCGGAGTGGACAG
***** * *.*****.**.******.* **.:.***** ******
C1 CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG
C2 CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG
C3 CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG
C4 CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCA
C5 CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCA
*************************************************.
C1 CATCCTGCTACTCCTGCTGC------------------------------
C2 CATCCTGCTACTCCTGCTGC------------------------------
C3 CATCCTGCTACTCCTGCTGC------------------------------
C4 CATCCTGCTACTCCTGCTGC------------------------------
C5 CATCCTGCTACTCCTGCTGC------------------------------
********************
>C1
ATGTCCAGCTGCAGACAGTTCAATCCGTTCTACATTGGACCCTATCCGGA
GCGTGCGTGCGGCGATTGTCCGTATGGCGAGTACTCGGGCTTCACCAGAT
GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC
CGCTATGGCGGAGGAGGAGGA------------GGCGGCCAAGGCGGTGG
AGGAGGGAGA------------------GGTGGATGTGGAGGCAGAGGCA
GAGGTGGTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT
GGTCCCCGCCCGTATTCCCCGTGCTATCAATTTCCGTACGGAGCGGACAG
CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG
CATCCTGCTACTCCTGCTGC------------------------------
>C2
ATGTCCAGCTGCGGGCAGTTCAATCCGTTCTACATTGGACCCTATCCGGA
TCGTGCGTGCGGCGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT
GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC
CGCTACGGCGGAGGAGGAGGA---GGAGGAGGAGGAGGCCAAGGCTGTGG
AGGAGGGAGA------------------GGTGGTTGTGGAGGCAGAGGCA
GAGGTGCTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT
GGTCCCCGCCCGTGTTCCCCGTGCTATCAGTTTCCAAACGGAGCGGACAG
CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG
CATCCTGCTACTCCTGCTGC------------------------------
>C3
ATGTCCAGCTGCGGGCAGTTCAATCCGTTCTACATTGGACCCTATCCGGA
GCGTGCGTGCGGCGATTGTCCGTATGGCCAGTATTCGGGCTTCACCAGAT
GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC
CGCTACGGCGGAGGAGGAGGCCAAGGCTGTGGAGGAGGGAGAAGTGGTTG
TGGAGGGAGA------------------GGTGGTTGTGGAGGCAGAGGCA
GAGGTGCTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT
GGTCCCCGGCCGTGTTCCCCGTGCTATCAGTTTCCGTACGGAGCGGACAG
CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG
CATCCTGCTACTCCTGCTGC------------------------------
>C4
ATGTGCAGCTGCAGACAGTTCAATCCGTTCTACATCGGACCCTATCCGGA
GCGTGCCTGCGGGGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT
GCGGATGGAGTGGCGGAAACGGTCCCTTCGGCACCACCTTCTGTGATTCC
CGCTACGGTGGAGGAGGAAGGAGATGTGGAGGCGGCTGTGGTGGATGTGG
AGGAGGAGGTAGAGGTAGAGAAGGATGTGGTGGATGTGGAGGAGGAGGCA
GAGGTGGTTGTGGTCCATCGTGTGGTCCCCGTAGTGGCGGATCGTCCTGG
TGTCCCGGC---TATTCCCCGTACTATCAGTCGCCGTGCGGAGCGGACAG
CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCA
CATCCTGCTACTCCTGCTGC------------------------------
>C5
ATGTGCAGCTGCAGACAGTTCAATCCGTTCTACATCGGACCCTATCCGGA
GCGTGCTTGCGGGGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT
GCGGATGGAGCGGCGGAAACGGTCCCTTTGGCACCACCTTCTGTGATTCC
CGCTACGGTGGAGGCGGA---------GGAGGAGGAGGAAGGAGATGTGG
AGGCGGAGGT------------------GGTGGATGTGGAGGAAGAGGCA
GAGGTGGTTGTGGGCCATCGTGTGGTCATCGT---GGCGGATCGTCCTGG
GGTCCCCGC---TATTCCCAGTACTATCAGTCGCCGTGCGGAGTGGACAG
CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCA
CATCCTGCTACTCCTGCTGC------------------------------
>C1
MSSCRQFNPFYIGPYPERACGDCPYGEYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGooooGGQGGGGGRooooooGGCGGRGRGGCAPSCGPRGGSWSC
GPRPYSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCC
>C2
MSSCGQFNPFYIGPYPDRACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGoGGGGGQGCGGGRooooooGGCGGRGRGACAPSCGPRGGSWSC
GPRPCSPCYQFPNGADSCMMCSSGFGCCGQSCRASCYSCC
>C3
MSSCGQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGQGCGGGRSGCGGRooooooGGCGGRGRGACAPSCGPRGGSWSC
GPRPCSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCC
>C4
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGRRCGGGCGGCGGGGRGREGCGGCGGGGRGGCGPSCGPRSGGSSW
CPGoYSPYYQSPCGADSCMMCSSGFGCCGQSCRTSCYSCC
>C5
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGoooGGGGRRCGGGGooooooGGCGGRGRGGCGPSCGHRoGGSSW
GPRoYSQYYQSPCGVDSCMMCSSGFGCCGQSCRTSCYSCC
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 450 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479397188
Setting output file names to "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1080390092
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 3884859168
Seed = 74374420
Swapseed = 1479397188
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 27 unique site patterns
Division 2 has 22 unique site patterns
Division 3 has 42 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1207.615297 -- -25.624409
Chain 2 -- -1219.221317 -- -25.624409
Chain 3 -- -1123.211300 -- -25.624409
Chain 4 -- -1202.460183 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1220.103946 -- -25.624409
Chain 2 -- -1190.319594 -- -25.624409
Chain 3 -- -1184.989929 -- -25.624409
Chain 4 -- -1202.460183 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1207.615] (-1219.221) (-1123.211) (-1202.460) * [-1220.104] (-1190.320) (-1184.990) (-1202.460)
500 -- (-1011.814) (-1008.027) [-999.687] (-1002.034) * [-1009.251] (-1004.731) (-1014.217) (-1009.928) -- 0:00:00
1000 -- (-1003.713) (-1002.837) (-996.864) [-996.037] * (-996.983) (-1003.859) [-997.257] (-1009.463) -- 0:16:39
1500 -- (-994.394) (-997.849) [-1003.701] (-994.887) * (-1004.054) (-998.586) [-998.680] (-1004.795) -- 0:11:05
2000 -- (-997.168) (-999.073) [-992.435] (-996.530) * (-998.753) (-991.375) [-1000.931] (-998.019) -- 0:08:19
2500 -- [-995.165] (-997.121) (-998.997) (-991.858) * (-998.586) (-990.569) [-993.515] (-999.938) -- 0:06:39
3000 -- (-994.724) (-994.120) (-997.214) [-991.811] * [-991.986] (-994.769) (-1000.806) (-1001.050) -- 0:05:32
3500 -- (-995.333) [-992.951] (-996.661) (-998.688) * (-996.506) [-1001.993] (-999.627) (-996.952) -- 0:04:44
4000 -- (-995.953) [-991.410] (-998.908) (-995.135) * (-995.865) [-994.448] (-996.590) (-1000.433) -- 0:04:09
4500 -- (-997.255) [-993.542] (-1001.300) (-997.164) * [-990.282] (-992.351) (-994.646) (-993.646) -- 0:03:41
5000 -- (-994.914) (-998.086) [-995.101] (-995.306) * (-993.013) [-995.672] (-999.065) (-996.819) -- 0:03:19
Average standard deviation of split frequencies: 0.000000
5500 -- (-996.057) (-994.889) [-996.662] (-997.031) * [-989.316] (-992.044) (-997.326) (-997.457) -- 0:03:00
6000 -- [-995.833] (-995.938) (-1000.468) (-990.904) * (-997.541) [-994.554] (-994.017) (-995.398) -- 0:05:31
6500 -- [-993.696] (-996.735) (-996.512) (-992.734) * [-997.819] (-990.858) (-995.643) (-993.110) -- 0:05:05
7000 -- (-994.487) [-993.700] (-992.182) (-997.976) * (-993.998) [-995.040] (-989.909) (-996.642) -- 0:04:43
7500 -- (-991.930) (-993.016) [-994.942] (-995.148) * (-996.413) [-991.470] (-997.395) (-995.519) -- 0:04:24
8000 -- (-993.422) [-992.882] (-997.090) (-998.451) * (-994.454) [-994.095] (-994.338) (-991.937) -- 0:04:08
8500 -- (-992.612) (-1004.760) [-997.956] (-997.885) * (-990.791) (-992.134) [-993.932] (-997.850) -- 0:03:53
9000 -- [-991.643] (-992.555) (-1000.748) (-998.358) * (-997.141) (-995.592) [-995.032] (-994.310) -- 0:03:40
9500 -- (-994.425) (-997.239) (-997.603) [-992.226] * [-993.512] (-995.700) (-996.366) (-995.381) -- 0:03:28
10000 -- (-994.524) [-992.229] (-996.473) (-994.802) * [-991.323] (-996.042) (-999.005) (-994.761) -- 0:03:18
Average standard deviation of split frequencies: 0.044194
10500 -- (-1001.476) (-993.748) (-995.916) [-993.919] * [-991.048] (-990.077) (-996.915) (-994.690) -- 0:03:08
11000 -- (-1000.225) [-997.621] (-1001.036) (-993.832) * (-992.344) [-993.078] (-999.819) (-996.781) -- 0:02:59
11500 -- (-1001.237) (-999.832) (-994.988) [-997.802] * (-993.016) [-992.359] (-998.460) (-993.958) -- 0:04:17
12000 -- [-994.260] (-996.394) (-993.213) (-996.450) * (-993.654) (-993.729) [-1000.359] (-993.411) -- 0:04:07
12500 -- [-995.257] (-998.143) (-995.886) (-998.663) * [-994.730] (-993.906) (-991.241) (-992.792) -- 0:03:57
13000 -- (-999.959) [-993.948] (-992.541) (-996.301) * (-995.787) [-993.964] (-1002.187) (-997.758) -- 0:03:47
13500 -- (-993.560) [-992.636] (-991.470) (-995.855) * (-990.401) (-997.774) (-999.238) [-997.241] -- 0:03:39
14000 -- (-995.218) [-992.444] (-995.229) (-996.090) * (-993.970) (-997.480) (-1000.728) [-994.604] -- 0:03:31
14500 -- (-995.860) (-998.961) [-992.156] (-995.944) * (-996.614) (-995.752) [-998.757] (-1001.258) -- 0:03:23
15000 -- (-995.327) [-990.659] (-991.787) (-995.766) * [-992.981] (-1000.374) (-992.998) (-1001.552) -- 0:03:17
Average standard deviation of split frequencies: 0.044194
15500 -- [-989.935] (-992.785) (-994.175) (-998.129) * (-998.792) [-990.645] (-999.971) (-998.051) -- 0:03:10
16000 -- (-990.767) [-991.673] (-995.684) (-996.009) * (-997.807) (-995.952) (-996.982) [-992.667] -- 0:03:04
16500 -- (-995.670) (-990.440) [-993.887] (-999.626) * (-999.311) (-992.026) [-993.938] (-990.912) -- 0:02:58
17000 -- (-996.515) [-996.749] (-992.862) (-1000.100) * (-1006.947) (-993.414) (-996.914) [-993.135] -- 0:03:51
17500 -- [-994.978] (-997.031) (-991.333) (-1006.080) * (-1003.207) (-995.808) (-1005.313) [-993.958] -- 0:03:44
18000 -- [-994.645] (-992.930) (-993.000) (-999.032) * [-994.288] (-990.155) (-999.108) (-999.841) -- 0:03:38
18500 -- (-993.604) [-994.278] (-992.922) (-998.413) * [-992.672] (-1003.344) (-989.352) (-1000.476) -- 0:03:32
19000 -- (-997.182) (-991.415) [-993.081] (-998.282) * (-991.640) (-993.498) [-992.305] (-996.336) -- 0:03:26
19500 -- (-998.933) (-993.537) (-996.570) [-992.607] * (-993.866) (-997.999) (-993.499) [-994.116] -- 0:03:21
20000 -- (-998.168) [-995.058] (-993.383) (-991.261) * [-993.181] (-999.325) (-998.284) (-995.523) -- 0:03:16
Average standard deviation of split frequencies: 0.022810
20500 -- (-993.270) (-990.356) (-997.562) [-993.491] * (-991.489) (-993.913) (-1002.323) [-997.538] -- 0:03:11
21000 -- (-995.350) [-992.460] (-996.958) (-992.781) * (-994.740) [-992.672] (-1000.109) (-999.794) -- 0:03:06
21500 -- (-996.279) [-992.246] (-998.507) (-995.864) * [-993.850] (-993.152) (-998.571) (-999.995) -- 0:03:02
22000 -- (-995.707) (-990.153) [-996.450] (-996.630) * (-995.083) [-990.583] (-1003.363) (-989.909) -- 0:03:42
22500 -- (-1000.704) [-991.361] (-996.360) (-991.797) * (-993.588) [-993.427] (-1000.016) (-989.203) -- 0:03:37
23000 -- (-995.316) [-992.854] (-994.308) (-997.550) * (-998.011) [-991.149] (-1001.809) (-994.242) -- 0:03:32
23500 -- (-1000.745) (-992.978) [-991.011] (-992.783) * (-1001.126) [-995.274] (-993.197) (-994.596) -- 0:03:27
24000 -- (-995.478) [-997.312] (-994.532) (-996.661) * (-997.830) [-994.220] (-993.490) (-997.989) -- 0:03:23
24500 -- (-996.512) [-996.204] (-992.350) (-994.811) * (-1000.086) [-992.127] (-996.704) (-996.300) -- 0:03:19
25000 -- (-992.113) [-997.971] (-991.600) (-997.846) * [-991.846] (-993.798) (-991.174) (-998.916) -- 0:03:15
Average standard deviation of split frequencies: 0.027196
25500 -- [-989.447] (-999.548) (-995.219) (-995.897) * (-994.975) [-995.366] (-997.609) (-995.299) -- 0:03:11
26000 -- (-1001.699) (-999.287) (-994.163) [-993.797] * [-997.137] (-998.086) (-990.533) (-994.969) -- 0:03:07
26500 -- (-994.231) [-993.151] (-994.398) (-993.528) * (-997.235) (-1002.407) (-994.293) [-995.336] -- 0:03:03
27000 -- (-997.451) (-992.530) [-988.461] (-995.509) * [-991.880] (-998.160) (-1001.208) (-995.709) -- 0:03:00
27500 -- [-997.758] (-995.151) (-989.857) (-1001.347) * [-997.693] (-1000.361) (-1004.578) (-997.471) -- 0:03:32
28000 -- (-998.237) (-997.987) [-992.344] (-1000.816) * [-994.239] (-998.206) (-1003.860) (-994.222) -- 0:03:28
28500 -- (-996.412) (-995.006) [-992.494] (-996.946) * (-989.972) (-1003.648) [-998.896] (-992.809) -- 0:03:24
29000 -- [-993.455] (-993.510) (-994.438) (-990.676) * (-999.949) (-996.428) [-998.407] (-991.804) -- 0:03:20
29500 -- (-992.951) (-994.765) (-994.943) [-994.835] * (-995.927) (-1000.868) (-996.161) [-994.727] -- 0:03:17
30000 -- (-1001.331) (-993.537) [-988.462] (-995.391) * (-997.067) (-995.652) [-995.219] (-993.339) -- 0:03:14
Average standard deviation of split frequencies: 0.015372
30500 -- [-999.090] (-1001.507) (-995.680) (-997.657) * (-993.836) (-994.020) [-991.958] (-993.255) -- 0:03:10
31000 -- (-995.284) [-997.352] (-993.927) (-996.225) * [-996.799] (-993.989) (-993.262) (-995.847) -- 0:03:07
31500 -- (-995.531) [-993.789] (-996.587) (-999.627) * (-994.384) (-994.153) [-995.667] (-989.972) -- 0:03:04
32000 -- [-993.797] (-992.325) (-1002.126) (-993.465) * (-995.617) (-1000.644) (-997.818) [-991.042] -- 0:03:01
32500 -- [-990.569] (-997.374) (-1006.114) (-992.469) * (-995.020) (-994.253) (-997.079) [-994.153] -- 0:02:58
33000 -- (-991.257) [-996.035] (-1000.838) (-994.758) * (-990.378) (-997.767) (-995.200) [-992.683] -- 0:03:25
33500 -- (-994.522) (-995.614) (-1000.943) [-992.062] * [-992.892] (-996.454) (-994.613) (-995.660) -- 0:03:21
34000 -- [-997.006] (-999.323) (-992.440) (-999.603) * (-996.935) (-994.189) [-991.863] (-993.521) -- 0:03:18
34500 -- (-994.602) (-997.938) (-997.390) [-994.602] * (-999.111) (-993.822) (-994.629) [-995.012] -- 0:03:15
35000 -- (-991.654) (-995.895) (-996.950) [-996.776] * [-992.218] (-1001.005) (-995.145) (-991.803) -- 0:03:13
Average standard deviation of split frequencies: 0.019642
35500 -- (-990.589) (-998.941) (-999.008) [-995.290] * (-997.957) (-996.520) (-995.811) [-989.305] -- 0:03:10
36000 -- (-992.441) [-998.640] (-998.432) (-993.947) * [-995.817] (-995.852) (-994.108) (-996.781) -- 0:03:07
36500 -- (-996.891) [-994.989] (-999.135) (-1005.413) * (-996.779) (-997.582) (-992.677) [-996.986] -- 0:03:04
37000 -- (-993.445) (-997.687) [-997.739] (-1002.620) * (-993.061) (-997.424) [-992.670] (-996.129) -- 0:03:02
37500 -- (-995.537) (-998.508) [-999.011] (-1003.712) * (-997.177) (-1000.048) [-994.242] (-992.447) -- 0:02:59
38000 -- [-993.014] (-997.814) (-1003.927) (-1002.185) * [-993.798] (-996.662) (-996.591) (-992.633) -- 0:03:22
38500 -- (-995.564) (-1002.744) (-999.200) [-994.542] * [-996.920] (-1001.118) (-997.933) (-994.751) -- 0:03:19
39000 -- (-991.181) (-1001.376) (-1004.416) [-993.637] * [-1000.294] (-996.376) (-997.339) (-999.137) -- 0:03:17
39500 -- (-996.342) (-997.652) (-996.962) [-994.297] * (-1001.530) (-995.195) [-992.227] (-997.715) -- 0:03:14
40000 -- (-994.201) (-998.731) [-996.799] (-990.802) * (-998.625) (-998.265) [-989.798] (-996.248) -- 0:03:12
Average standard deviation of split frequencies: 0.017388
40500 -- (-995.145) (-996.431) (-995.095) [-997.034] * (-993.514) [-999.495] (-994.324) (-990.039) -- 0:03:09
41000 -- (-993.377) (-994.244) (-1000.083) [-995.670] * [-998.527] (-998.880) (-998.324) (-994.856) -- 0:03:07
41500 -- (-992.513) [-995.018] (-999.725) (-995.810) * (-1000.323) (-998.972) [-991.278] (-994.004) -- 0:03:04
42000 -- (-996.317) (-994.874) [-993.033] (-997.981) * (-999.903) (-995.112) [-992.105] (-994.028) -- 0:03:02
42500 -- (-990.256) [-993.248] (-997.075) (-997.089) * (-993.740) [-992.333] (-995.199) (-992.918) -- 0:03:00
43000 -- (-1001.823) [-989.414] (-994.493) (-994.915) * [-994.102] (-994.379) (-992.307) (-997.924) -- 0:02:58
43500 -- [-992.232] (-997.227) (-1004.209) (-994.669) * (-992.354) (-994.123) [-992.781] (-994.815) -- 0:03:17
44000 -- (-999.802) [-995.848] (-1000.725) (-994.054) * (-997.872) (-993.443) [-995.448] (-995.315) -- 0:03:15
44500 -- (-993.076) (-994.167) [-995.980] (-997.889) * (-991.863) (-994.250) [-996.765] (-999.647) -- 0:03:13
45000 -- [-994.097] (-998.649) (-994.829) (-994.735) * [-991.430] (-994.673) (-1000.545) (-993.029) -- 0:03:11
Average standard deviation of split frequencies: 0.015372
45500 -- (-1004.704) (-995.043) [-993.977] (-993.353) * [-990.856] (-992.663) (-996.358) (-994.031) -- 0:03:08
46000 -- [-988.958] (-993.053) (-995.051) (-990.489) * [-989.796] (-997.710) (-998.563) (-991.580) -- 0:03:06
46500 -- [-994.903] (-997.315) (-994.671) (-1000.659) * [-998.277] (-993.290) (-993.757) (-991.973) -- 0:03:04
47000 -- (-996.809) (-993.366) (-993.931) [-992.237] * [-995.267] (-996.653) (-997.288) (-994.349) -- 0:03:02
47500 -- (-996.746) [-992.843] (-999.158) (-995.616) * [-990.786] (-998.584) (-997.635) (-999.277) -- 0:03:00
48000 -- [-993.821] (-994.611) (-997.193) (-997.065) * (-995.073) (-1002.266) (-999.066) [-991.724] -- 0:02:58
48500 -- (-995.353) (-992.525) (-992.844) [-991.273] * [-991.806] (-1001.181) (-996.985) (-988.323) -- 0:03:16
49000 -- (-1000.328) [-991.129] (-991.846) (-997.372) * (-999.005) (-997.180) (-996.670) [-993.136] -- 0:03:14
49500 -- (-998.891) (-992.544) (-994.412) [-990.731] * [-993.115] (-995.704) (-994.037) (-997.310) -- 0:03:12
50000 -- (-996.506) [-993.523] (-993.418) (-995.284) * [-989.908] (-992.808) (-999.674) (-997.809) -- 0:03:10
Average standard deviation of split frequencies: 0.013956
50500 -- (-999.054) (-994.434) (-995.428) [-993.441] * (-993.457) [-994.330] (-993.802) (-992.461) -- 0:03:08
51000 -- (-999.697) (-996.115) (-991.933) [-990.810] * [-990.588] (-990.144) (-997.350) (-996.875) -- 0:03:06
51500 -- (-997.373) [-992.571] (-994.728) (-996.325) * (-992.606) (-994.479) (-994.846) [-995.195] -- 0:03:04
52000 -- (-995.947) [-996.277] (-997.810) (-995.235) * (-997.185) [-994.483] (-997.990) (-996.032) -- 0:03:02
52500 -- (-993.167) [-994.524] (-993.633) (-993.438) * [-993.109] (-993.567) (-993.348) (-1001.335) -- 0:03:00
53000 -- [-991.450] (-994.281) (-994.796) (-994.454) * (-996.272) [-996.245] (-996.954) (-998.279) -- 0:02:58
53500 -- (-991.888) (-994.427) [-990.151] (-995.024) * (-994.882) (-998.701) [-994.894] (-995.458) -- 0:03:14
54000 -- [-993.970] (-994.674) (-992.288) (-991.005) * (-996.502) (-993.580) (-1001.071) [-999.724] -- 0:03:12
54500 -- [-997.418] (-994.692) (-1002.453) (-994.623) * (-998.888) (-989.926) [-1000.095] (-1001.371) -- 0:03:10
55000 -- (-995.215) (-995.776) (-994.583) [-994.754] * (-995.770) (-998.586) [-996.056] (-998.248) -- 0:03:09
Average standard deviation of split frequencies: 0.016836
55500 -- (-994.974) [-994.354] (-991.520) (-990.624) * [-994.925] (-991.496) (-1004.494) (-996.996) -- 0:03:07
56000 -- (-996.535) [-995.974] (-1001.229) (-996.452) * (-989.470) [-993.910] (-995.365) (-994.402) -- 0:03:05
56500 -- (-999.194) [-994.892] (-996.744) (-993.745) * (-991.303) [-993.953] (-999.561) (-996.520) -- 0:03:03
57000 -- (-995.957) [-994.760] (-997.728) (-993.955) * (-995.510) (-994.731) [-994.415] (-993.597) -- 0:03:01
57500 -- (-995.699) [-996.787] (-998.425) (-992.887) * (-996.848) [-990.582] (-993.148) (-992.836) -- 0:03:00
58000 -- (-1002.086) [-992.542] (-995.285) (-993.882) * (-991.611) [-992.816] (-994.722) (-994.453) -- 0:02:58
58500 -- (-995.430) (-1000.112) (-1004.802) [-995.392] * (-992.977) [-992.046] (-995.232) (-999.975) -- 0:02:57
59000 -- (-995.232) (-994.281) (-996.142) [-990.793] * [-991.491] (-993.677) (-991.088) (-993.555) -- 0:03:11
59500 -- (-997.329) (-997.338) (-997.331) [-996.048] * (-996.609) (-995.479) (-997.633) [-992.799] -- 0:03:09
60000 -- (-996.157) [-994.950] (-993.168) (-998.266) * [-991.310] (-1007.632) (-991.192) (-992.361) -- 0:03:08
Average standard deviation of split frequencies: 0.011656
60500 -- (-996.477) (-996.489) (-998.638) [-999.401] * (-996.681) [-992.937] (-996.624) (-999.196) -- 0:03:06
61000 -- (-992.778) [-995.482] (-1000.477) (-996.599) * (-995.184) (-993.604) [-992.459] (-995.693) -- 0:03:04
61500 -- (-994.570) (-1002.381) (-1000.204) [-993.329] * (-991.500) [-995.255] (-996.108) (-1006.438) -- 0:03:03
62000 -- (-993.342) (-999.393) [-992.879] (-995.167) * (-1000.535) (-993.872) [-992.882] (-993.570) -- 0:03:01
62500 -- (-992.122) (-995.241) [-994.316] (-994.086) * (-995.548) [-989.990] (-997.400) (-996.742) -- 0:03:00
63000 -- (-997.922) (-993.790) (-995.661) [-993.061] * [-997.474] (-991.778) (-993.326) (-994.562) -- 0:02:58
63500 -- (-992.573) (-993.772) [-995.002] (-991.649) * (-997.735) (-992.580) (-993.982) [-998.892] -- 0:02:56
64000 -- (-993.238) [-997.570] (-993.575) (-998.145) * (-997.417) [-990.516] (-997.245) (-998.234) -- 0:02:55
64500 -- (-996.192) [-1001.553] (-995.851) (-996.008) * (-995.140) (-993.999) [-993.651] (-995.436) -- 0:03:08
65000 -- (-997.219) (-996.550) [-1001.962] (-994.133) * (-996.493) (-994.085) (-996.359) [-990.294] -- 0:03:07
Average standard deviation of split frequencies: 0.003571
65500 -- (-993.891) (-1004.999) (-993.324) [-993.808] * (-998.072) (-991.639) (-1002.821) [-993.904] -- 0:03:05
66000 -- (-996.087) [-994.755] (-997.833) (-996.646) * [-996.078] (-992.611) (-996.722) (-993.761) -- 0:03:03
66500 -- [-994.993] (-996.017) (-993.506) (-999.465) * (-993.696) (-995.236) [-997.792] (-999.407) -- 0:03:02
67000 -- [-996.957] (-997.734) (-995.075) (-995.469) * (-989.253) [-995.027] (-996.198) (-993.145) -- 0:03:01
67500 -- (-999.384) [-994.680] (-996.078) (-998.204) * (-995.044) (-1004.763) [-991.851] (-1001.228) -- 0:02:59
68000 -- (-999.082) [-993.716] (-997.593) (-1000.302) * [-994.339] (-1008.463) (-993.664) (-1005.800) -- 0:02:58
68500 -- (-997.697) (-994.262) [-992.451] (-996.540) * (-990.040) (-997.704) [-994.107] (-1004.504) -- 0:02:56
69000 -- [-991.080] (-995.837) (-989.037) (-998.798) * [-992.416] (-1001.102) (-990.902) (-994.786) -- 0:02:55
69500 -- (-992.994) [-992.430] (-992.225) (-997.187) * [-993.117] (-992.310) (-998.197) (-998.002) -- 0:03:07
70000 -- (-991.444) [-994.571] (-991.111) (-995.819) * [-991.729] (-998.501) (-1000.613) (-1000.288) -- 0:03:06
Average standard deviation of split frequencies: 0.006671
70500 -- [-992.852] (-994.596) (-994.198) (-996.910) * [-990.568] (-996.018) (-998.308) (-1001.597) -- 0:03:04
71000 -- [-998.551] (-995.091) (-996.887) (-992.583) * (-995.845) [-996.495] (-996.990) (-995.566) -- 0:03:03
71500 -- (-1001.808) [-991.002] (-992.438) (-993.908) * [-995.891] (-991.835) (-1000.644) (-996.875) -- 0:03:01
72000 -- [-992.383] (-999.577) (-995.990) (-995.236) * (-993.436) [-1000.422] (-997.405) (-999.605) -- 0:03:00
72500 -- [-996.564] (-998.723) (-995.614) (-994.241) * [-990.239] (-1001.374) (-999.006) (-997.075) -- 0:02:59
73000 -- (-997.988) (-991.538) [-997.105] (-996.747) * [-995.537] (-1000.104) (-997.276) (-993.291) -- 0:02:57
73500 -- (-992.225) [-995.922] (-993.156) (-998.022) * [-999.002] (-998.502) (-997.188) (-990.396) -- 0:02:56
74000 -- (-1002.290) [-992.480] (-991.785) (-993.315) * [-992.572] (-996.748) (-998.865) (-994.136) -- 0:02:55
74500 -- [-996.526] (-991.822) (-991.204) (-995.563) * [-992.478] (-995.482) (-999.367) (-994.303) -- 0:02:53
75000 -- (-997.565) [-989.968] (-994.122) (-994.539) * (-993.151) [-998.312] (-994.526) (-992.967) -- 0:03:05
Average standard deviation of split frequencies: 0.009304
75500 -- (-996.329) (-992.776) [-994.144] (-1002.608) * (-990.706) [-1000.013] (-994.510) (-996.195) -- 0:03:03
76000 -- (-997.368) (-996.498) [-990.924] (-994.701) * [-990.891] (-994.682) (-999.210) (-999.903) -- 0:03:02
76500 -- (-990.442) (-994.222) [-991.685] (-997.761) * [-990.168] (-996.834) (-994.696) (-996.681) -- 0:03:01
77000 -- (-998.351) (-992.601) [-991.452] (-994.892) * (-992.924) (-992.361) [-999.208] (-991.234) -- 0:02:59
77500 -- (-994.854) (-994.503) [-994.062] (-994.539) * [-992.642] (-993.410) (-999.191) (-998.044) -- 0:02:58
78000 -- (-998.800) (-996.888) [-993.645] (-989.068) * [-996.924] (-997.373) (-994.372) (-995.749) -- 0:02:57
78500 -- (-997.966) (-992.707) (-990.162) [-992.272] * (-992.294) (-1004.043) (-992.170) [-995.891] -- 0:02:56
79000 -- (-992.594) (-999.177) (-991.594) [-994.760] * [-990.695] (-995.995) (-994.232) (-993.567) -- 0:02:54
79500 -- (-1000.616) (-998.994) (-993.032) [-992.125] * [-991.653] (-995.433) (-993.749) (-998.196) -- 0:02:53
80000 -- (-993.378) [-992.416] (-994.122) (-995.659) * (-999.045) (-996.311) [-996.922] (-1004.265) -- 0:02:52
Average standard deviation of split frequencies: 0.008766
80500 -- [-996.916] (-1000.220) (-995.508) (-1000.712) * (-994.660) (-998.671) (-994.917) [-994.178] -- 0:03:02
81000 -- (-997.903) (-995.187) (-989.757) [-995.528] * (-993.283) (-1000.694) (-991.708) [-994.751] -- 0:03:01
81500 -- (-1001.057) [-993.918] (-997.969) (-990.879) * (-994.961) (-998.027) (-997.284) [-995.305] -- 0:03:00
82000 -- (-1003.819) (-999.834) (-1004.882) [-993.296] * (-1000.295) (-998.185) (-1002.242) [-994.530] -- 0:02:59
82500 -- (-1000.810) (-1000.946) (-1000.393) [-992.430] * (-1005.767) (-1000.801) [-994.639] (-997.905) -- 0:02:57
83000 -- [-996.819] (-998.970) (-997.545) (-994.395) * (-1000.761) (-1001.978) [-996.712] (-1003.250) -- 0:02:56
83500 -- (-995.229) (-998.604) (-1002.452) [-993.759] * [-996.007] (-1006.124) (-998.996) (-1002.573) -- 0:02:55
84000 -- (-995.519) (-1002.281) [-994.062] (-1004.070) * (-994.809) (-1002.175) [-999.776] (-1003.005) -- 0:02:54
84500 -- (-996.633) (-998.676) (-997.818) [-991.576] * [-995.545] (-999.168) (-1000.925) (-995.409) -- 0:02:53
85000 -- (-997.408) [-995.952] (-993.671) (-994.129) * (-1001.904) (-1000.597) [-1000.346] (-1004.231) -- 0:02:52
Average standard deviation of split frequencies: 0.010963
85500 -- (-991.433) (-993.009) (-991.258) [-991.822] * [-996.543] (-998.892) (-999.191) (-998.850) -- 0:03:01
86000 -- [-1000.880] (-994.574) (-992.543) (-992.060) * (-993.542) (-1001.283) (-996.295) [-997.486] -- 0:03:00
86500 -- [-993.906] (-991.362) (-994.917) (-1005.177) * (-990.243) [-994.946] (-991.769) (-999.787) -- 0:02:59
87000 -- (-991.717) [-995.253] (-993.905) (-999.534) * (-993.657) [-995.732] (-989.776) (-998.734) -- 0:02:58
87500 -- [-991.824] (-994.170) (-993.003) (-994.977) * (-993.101) [-994.968] (-995.822) (-999.153) -- 0:02:57
88000 -- (-996.065) (-994.201) [-995.584] (-995.893) * (-998.903) (-988.275) (-991.664) [-992.911] -- 0:02:56
88500 -- (-989.704) [-994.223] (-997.867) (-996.410) * (-993.346) [-995.227] (-994.754) (-995.891) -- 0:02:55
89000 -- (-989.794) [-994.644] (-996.230) (-993.555) * (-998.120) [-992.233] (-993.876) (-994.912) -- 0:02:54
89500 -- (-992.755) (-990.065) [-999.924] (-991.538) * [-994.092] (-995.322) (-995.938) (-997.655) -- 0:02:52
90000 -- (-993.393) (-997.130) [-992.349] (-999.397) * [-990.089] (-1000.432) (-998.492) (-997.144) -- 0:02:51
Average standard deviation of split frequencies: 0.010399
90500 -- [-996.314] (-991.585) (-992.859) (-990.818) * [-991.854] (-993.141) (-1003.738) (-997.707) -- 0:02:50
91000 -- (-1000.205) (-997.502) [-991.839] (-994.912) * (-993.369) (-995.047) (-1000.581) [-993.262] -- 0:02:59
91500 -- [-997.589] (-994.843) (-995.437) (-996.965) * [-995.638] (-993.443) (-996.794) (-992.166) -- 0:02:58
92000 -- [-993.633] (-998.015) (-994.259) (-995.295) * (-997.381) (-998.027) (-992.553) [-995.062] -- 0:02:57
92500 -- (-996.897) (-996.932) (-1002.335) [-998.428] * (-996.066) (-999.701) (-996.167) [-994.438] -- 0:02:56
93000 -- [-999.242] (-993.065) (-996.731) (-998.300) * (-997.345) (-999.521) (-993.499) [-989.518] -- 0:02:55
93500 -- (-998.646) (-1000.120) (-1000.081) [-1002.367] * (-999.412) (-996.639) [-994.909] (-993.006) -- 0:02:54
94000 -- [-1000.164] (-997.472) (-994.507) (-1003.113) * [-992.438] (-998.055) (-992.247) (-1000.181) -- 0:02:53
94500 -- [-997.161] (-1001.286) (-998.678) (-996.292) * (-1001.157) (-997.439) [-998.134] (-999.066) -- 0:02:52
95000 -- (-996.960) (-995.682) [-1003.409] (-996.964) * (-995.043) (-993.580) [-999.516] (-993.115) -- 0:02:51
Average standard deviation of split frequencies: 0.002455
95500 -- (-996.223) [-995.569] (-995.474) (-996.711) * (-998.365) [-993.483] (-1002.021) (-1000.549) -- 0:02:50
96000 -- (-996.277) [-991.164] (-1002.828) (-995.009) * [-995.339] (-996.446) (-1002.620) (-997.008) -- 0:02:49
96500 -- [-991.078] (-996.515) (-997.953) (-991.730) * (-994.208) (-998.083) (-999.833) [-998.716] -- 0:02:57
97000 -- [-991.674] (-990.630) (-999.775) (-993.735) * [-993.095] (-997.898) (-995.958) (-995.038) -- 0:02:56
97500 -- (-992.678) (-994.051) (-995.724) [-994.924] * (-992.166) (-991.417) (-997.740) [-992.145] -- 0:02:55
98000 -- (-993.694) [-996.588] (-993.417) (-995.010) * (-994.617) (-1001.840) (-997.784) [-993.393] -- 0:02:54
98500 -- (-999.289) [-992.699] (-991.609) (-992.545) * [-992.553] (-995.241) (-1003.036) (-994.489) -- 0:02:53
99000 -- (-994.089) (-994.893) [-995.430] (-998.822) * (-995.572) (-998.439) (-999.013) [-991.389] -- 0:02:52
99500 -- (-996.466) (-995.399) (-999.789) [-991.724] * (-995.096) (-999.901) [-996.329] (-988.978) -- 0:02:51
100000 -- [-996.487] (-992.755) (-991.361) (-992.080) * (-998.479) [-997.422] (-991.818) (-990.497) -- 0:02:51
Average standard deviation of split frequencies: 0.000000
100500 -- [-991.272] (-997.219) (-992.248) (-993.583) * (-996.142) (-998.039) (-991.281) [-991.125] -- 0:02:50
101000 -- (-997.115) [-993.153] (-995.674) (-996.894) * (-995.732) (-997.529) (-1004.745) [-989.468] -- 0:02:49
101500 -- [-990.517] (-995.452) (-997.133) (-994.508) * (-993.419) (-993.632) [-997.901] (-991.100) -- 0:02:57
102000 -- (-994.998) (-993.466) [-994.163] (-995.639) * (-998.421) (-996.809) [-996.991] (-994.155) -- 0:02:56
102500 -- (-992.189) [-996.814] (-991.759) (-992.726) * (-993.322) [-994.101] (-992.264) (-996.639) -- 0:02:55
103000 -- [-993.760] (-993.239) (-992.073) (-994.256) * (-994.330) (-997.414) [-998.108] (-992.601) -- 0:02:54
103500 -- [-998.241] (-994.827) (-996.962) (-996.570) * (-998.839) [-1002.236] (-994.968) (-999.991) -- 0:02:53
104000 -- (-998.231) (-998.472) (-995.216) [-993.202] * (-996.387) (-1001.588) (-1005.235) [-995.699] -- 0:02:52
104500 -- (-1004.215) [-994.209] (-995.205) (-993.503) * [-992.479] (-1003.758) (-999.704) (-998.110) -- 0:02:51
105000 -- (-998.442) [-994.366] (-994.032) (-996.577) * (-1000.354) (-1002.975) (-995.404) [-993.888] -- 0:02:50
Average standard deviation of split frequencies: 0.002224
105500 -- (-1000.469) (-992.312) (-1000.533) [-991.926] * (-994.142) (-1000.263) [-993.427] (-997.074) -- 0:02:49
106000 -- [-999.298] (-993.216) (-994.684) (-992.216) * (-993.970) (-999.126) [-994.819] (-990.230) -- 0:02:48
106500 -- (-1000.954) (-998.023) (-1002.420) [-997.089] * (-997.290) (-994.941) (-992.221) [-991.750] -- 0:02:47
107000 -- [-993.821] (-1001.182) (-995.616) (-998.694) * (-996.382) (-999.897) [-993.770] (-996.372) -- 0:02:55
107500 -- [-990.373] (-991.236) (-993.428) (-995.600) * (-995.118) [-993.947] (-993.975) (-995.517) -- 0:02:54
108000 -- (-997.225) (-989.750) (-1000.597) [-993.320] * (-998.683) (-991.429) (-994.395) [-995.680] -- 0:02:53
108500 -- [-995.495] (-994.174) (-992.965) (-994.552) * (-1006.708) (-991.982) [-994.176] (-996.937) -- 0:02:52
109000 -- [-989.093] (-992.638) (-997.092) (-996.642) * (-997.816) (-993.846) (-992.510) [-999.598] -- 0:02:51
109500 -- [-988.422] (-996.490) (-1001.288) (-997.112) * (-995.231) (-993.807) [-998.564] (-993.328) -- 0:02:50
110000 -- [-989.130] (-998.879) (-1000.349) (-988.805) * [-992.687] (-993.050) (-995.190) (-993.681) -- 0:02:49
Average standard deviation of split frequencies: 0.000000
110500 -- (-996.761) (-995.563) [-995.226] (-995.129) * [-993.635] (-994.463) (-994.385) (-997.182) -- 0:02:49
111000 -- [-994.710] (-994.583) (-1006.674) (-990.743) * (-991.606) (-992.136) [-997.455] (-999.974) -- 0:02:48
111500 -- (-992.359) (-995.145) [-996.194] (-993.405) * (-994.421) (-994.085) [-994.802] (-997.972) -- 0:02:47
112000 -- [-994.525] (-993.406) (-994.231) (-993.954) * (-998.030) (-996.407) (-996.476) [-991.030] -- 0:02:54
112500 -- (-992.598) [-990.469] (-995.460) (-994.393) * (-996.021) (-994.421) [-996.704] (-999.573) -- 0:02:53
113000 -- (-996.047) [-994.162] (-990.770) (-1004.152) * (-1004.695) [-995.682] (-994.040) (-999.783) -- 0:02:52
113500 -- (-991.050) (-994.427) (-993.262) [-999.885] * (-999.305) [-995.199] (-995.097) (-996.337) -- 0:02:51
114000 -- (-996.012) (-1005.827) [-992.820] (-998.617) * [-996.667] (-992.862) (-992.446) (-995.304) -- 0:02:50
114500 -- (-994.184) (-992.150) (-992.527) [-991.999] * (-990.990) (-1001.680) [-992.393] (-999.178) -- 0:02:50
115000 -- (-995.951) [-1000.063] (-991.433) (-992.996) * [-992.461] (-996.955) (-996.348) (-995.827) -- 0:02:49
Average standard deviation of split frequencies: 0.002032
115500 -- [-1000.958] (-1003.317) (-995.240) (-993.453) * (-999.377) (-1004.207) (-996.661) [-989.868] -- 0:02:48
116000 -- (-992.557) (-999.158) [-994.401] (-997.450) * (-998.894) (-993.524) [-997.841] (-996.700) -- 0:02:47
116500 -- (-993.878) (-999.036) (-994.876) [-994.470] * (-994.178) (-994.130) (-996.012) [-993.768] -- 0:02:46
117000 -- (-993.691) [-998.347] (-1000.299) (-994.317) * (-994.979) (-997.689) (-1001.548) [-994.981] -- 0:02:46
117500 -- [-994.319] (-997.728) (-996.911) (-997.363) * [-994.099] (-997.646) (-993.800) (-994.564) -- 0:02:52
118000 -- (-993.094) (-1001.071) [-994.785] (-1000.680) * [-997.356] (-991.854) (-998.058) (-993.593) -- 0:02:51
118500 -- [-991.935] (-994.609) (-990.391) (-991.873) * (-995.747) (-997.812) (-1001.038) [-996.217] -- 0:02:51
119000 -- (-996.293) (-990.175) [-996.735] (-994.879) * (-996.761) (-994.479) (-991.818) [-995.488] -- 0:02:50
119500 -- (-999.060) (-992.290) [-995.316] (-990.439) * (-1004.732) (-1000.604) [-992.688] (-993.274) -- 0:02:49
120000 -- (-989.783) (-1000.546) (-994.877) [-1000.054] * [-998.248] (-997.731) (-996.294) (-997.316) -- 0:02:48
Average standard deviation of split frequencies: 0.003907
120500 -- (-995.726) [-999.978] (-994.523) (-1006.857) * [-996.699] (-994.339) (-999.479) (-1000.820) -- 0:02:47
121000 -- [-992.097] (-995.222) (-992.008) (-991.647) * (-1000.259) [-997.144] (-990.935) (-1001.863) -- 0:02:47
121500 -- (-991.153) (-997.915) [-994.006] (-995.580) * [-995.815] (-996.903) (-993.569) (-997.119) -- 0:02:46
122000 -- (-993.255) (-997.671) [-993.259] (-997.094) * (-995.570) [-993.311] (-996.745) (-999.875) -- 0:02:45
122500 -- (-989.425) (-998.047) (-995.937) [-995.487] * (-995.845) [-993.762] (-990.597) (-997.735) -- 0:02:44
123000 -- (-993.770) (-1002.185) [-990.170] (-997.935) * (-995.049) (-995.035) [-998.705] (-1001.339) -- 0:02:51
123500 -- [-992.746] (-994.279) (-1002.277) (-994.622) * (-997.640) (-996.229) [-991.895] (-994.602) -- 0:02:50
124000 -- (-1002.237) [-994.367] (-997.307) (-995.765) * [-998.032] (-989.912) (-990.706) (-999.615) -- 0:02:49
124500 -- (-992.864) [-994.131] (-998.473) (-999.470) * [-994.203] (-994.704) (-992.675) (-991.320) -- 0:02:48
125000 -- (-998.443) (-997.005) [-990.564] (-1001.340) * (-999.643) (-999.500) (-994.357) [-1000.109] -- 0:02:48
Average standard deviation of split frequencies: 0.001871
125500 -- (-995.595) (-998.995) (-1000.423) [-991.293] * (-994.523) [-994.493] (-995.252) (-1002.270) -- 0:02:47
126000 -- (-1000.436) [-1003.112] (-993.610) (-999.062) * (-997.072) (-991.415) (-1000.553) [-997.525] -- 0:02:46
126500 -- (-1010.002) (-999.334) [-997.051] (-993.980) * (-995.159) [-995.189] (-998.877) (-996.643) -- 0:02:45
127000 -- [-990.451] (-998.243) (-997.810) (-1001.608) * (-997.654) [-993.829] (-996.897) (-996.932) -- 0:02:44
127500 -- (-994.408) [-991.619] (-1003.437) (-1001.147) * (-1007.234) (-997.226) [-994.481] (-997.951) -- 0:02:44
128000 -- (-997.725) (-998.528) [-995.674] (-995.306) * (-997.318) (-995.407) [-997.248] (-995.568) -- 0:02:50
128500 -- (-992.652) (-1001.696) [-1000.523] (-998.465) * (-994.009) (-996.312) [-999.978] (-991.483) -- 0:02:49
129000 -- [-993.391] (-992.420) (-998.563) (-997.806) * (-991.873) (-995.574) (-997.535) [-996.296] -- 0:02:48
129500 -- [-993.354] (-991.936) (-998.735) (-997.290) * (-992.964) (-1005.194) [-996.874] (-995.427) -- 0:02:48
130000 -- [-990.911] (-1000.153) (-1000.353) (-1001.424) * (-990.819) (-996.111) (-994.806) [-994.818] -- 0:02:47
Average standard deviation of split frequencies: 0.001804
130500 -- (-997.380) [-995.137] (-1001.355) (-993.500) * (-991.339) [-998.735] (-998.559) (-995.398) -- 0:02:46
131000 -- (-993.230) [-996.631] (-1005.653) (-994.527) * (-992.018) (-995.530) [-996.435] (-1001.447) -- 0:02:45
131500 -- (-997.069) (-994.917) (-1002.712) [-993.920] * (-990.899) [-995.980] (-1000.817) (-993.059) -- 0:02:45
132000 -- (-993.437) (-998.924) (-999.149) [-995.262] * (-992.318) (-993.507) (-1002.245) [-997.347] -- 0:02:44
132500 -- (-995.377) [-994.834] (-999.798) (-997.966) * (-994.906) [-994.474] (-1004.212) (-993.470) -- 0:02:43
133000 -- (-995.186) (-996.267) [-1002.938] (-998.344) * (-994.432) [-996.945] (-1000.794) (-994.910) -- 0:02:42
133500 -- (-991.267) (-993.891) [-996.364] (-999.946) * (-1000.214) (-991.934) [-999.583] (-998.719) -- 0:02:48
134000 -- (-989.940) (-994.494) [-993.766] (-998.103) * (-998.528) (-992.349) (-998.685) [-991.536] -- 0:02:48
134500 -- (-990.033) (-989.630) (-998.532) [-994.236] * (-998.359) (-991.296) (-997.472) [-993.410] -- 0:02:47
135000 -- (-993.183) [-991.813] (-993.772) (-998.992) * (-992.326) (-991.049) (-1001.725) [-992.529] -- 0:02:46
Average standard deviation of split frequencies: 0.001733
135500 -- (-999.161) (-993.287) (-997.253) [-1007.221] * [-992.962] (-993.996) (-997.561) (-999.530) -- 0:02:45
136000 -- [-994.989] (-997.727) (-999.574) (-997.827) * (-997.485) [-994.478] (-1006.727) (-997.295) -- 0:02:45
136500 -- [-993.948] (-1001.909) (-994.270) (-996.250) * (-991.352) [-994.167] (-996.838) (-998.561) -- 0:02:44
137000 -- (-1001.787) [-994.741] (-996.470) (-999.469) * (-992.152) (-996.219) (-992.028) [-998.161] -- 0:02:43
137500 -- [-991.617] (-996.280) (-994.511) (-995.090) * [-991.837] (-996.713) (-994.728) (-997.215) -- 0:02:43
138000 -- (-1001.137) [-992.042] (-995.382) (-997.383) * (-992.702) (-989.812) (-993.742) [-1002.575] -- 0:02:42
138500 -- (-991.659) [-992.502] (-991.055) (-995.176) * (-994.954) [-995.476] (-994.402) (-996.244) -- 0:02:41
139000 -- [-991.986] (-992.932) (-997.135) (-995.977) * (-1002.487) (-992.524) (-1008.386) [-992.602] -- 0:02:47
139500 -- (-993.044) (-995.511) (-997.935) [-996.126] * [-1000.968] (-993.020) (-997.572) (-992.067) -- 0:02:46
140000 -- [-993.432] (-993.712) (-993.514) (-993.345) * (-999.759) [-992.371] (-1001.644) (-1002.958) -- 0:02:45
Average standard deviation of split frequencies: 0.003351
140500 -- [-995.678] (-995.706) (-992.169) (-997.083) * (-996.109) [-996.247] (-1004.152) (-999.141) -- 0:02:45
141000 -- (-992.493) (-998.779) [-992.523] (-995.518) * (-996.330) [-998.527] (-994.435) (-1004.823) -- 0:02:44
141500 -- [-992.654] (-995.921) (-995.351) (-994.928) * (-997.784) (-994.803) [-999.330] (-995.557) -- 0:02:43
142000 -- (-995.472) (-992.312) [-994.553] (-1000.062) * (-996.239) (-992.647) [-992.488] (-994.640) -- 0:02:43
142500 -- (-996.689) (-993.018) (-996.545) [-993.402] * [-993.459] (-995.609) (-997.392) (-991.812) -- 0:02:42
143000 -- (-994.181) (-993.081) [-997.545] (-993.792) * (-988.665) (-993.569) [-993.578] (-1003.053) -- 0:02:41
143500 -- (-997.985) (-999.304) [-991.751] (-989.689) * [-1000.561] (-1001.814) (-996.542) (-991.901) -- 0:02:41
144000 -- [-994.152] (-991.598) (-992.797) (-997.256) * (-992.542) (-995.023) [-995.693] (-994.580) -- 0:02:40
144500 -- [-994.583] (-1002.599) (-996.555) (-994.620) * (-990.067) (-1003.396) (-992.130) [-992.035] -- 0:02:45
145000 -- (-1001.906) (-999.144) [-994.188] (-993.459) * (-990.620) [-992.547] (-995.419) (-996.970) -- 0:02:45
Average standard deviation of split frequencies: 0.001614
145500 -- (-992.986) (-994.103) [-992.460] (-1000.305) * [-993.210] (-999.660) (-992.759) (-990.885) -- 0:02:44
146000 -- (-993.791) (-994.227) [-988.627] (-998.537) * (-995.194) [-991.061] (-993.107) (-995.673) -- 0:02:43
146500 -- (-992.393) (-992.157) (-996.566) [-994.882] * [-996.278] (-995.944) (-1001.692) (-990.001) -- 0:02:43
147000 -- (-990.814) [-991.173] (-995.680) (-994.597) * (-999.300) (-993.750) [-994.974] (-994.982) -- 0:02:42
147500 -- (-995.594) (-994.210) [-1001.774] (-995.852) * [-997.893] (-996.584) (-995.404) (-991.332) -- 0:02:41
148000 -- (-994.359) (-1003.559) [-996.180] (-992.090) * (-1009.273) (-996.425) (-998.347) [-997.269] -- 0:02:41
148500 -- (-999.147) [-991.729] (-995.922) (-990.893) * (-993.541) [-998.858] (-1000.930) (-993.122) -- 0:02:40
149000 -- (-996.202) (-992.696) (-998.312) [-992.022] * (-996.621) [-996.564] (-1005.518) (-994.557) -- 0:02:39
149500 -- [-1000.172] (-990.941) (-996.179) (-1001.456) * (-997.418) (-995.310) (-992.104) [-993.209] -- 0:02:44
150000 -- (-1000.567) [-992.279] (-991.884) (-1001.042) * (-995.424) [-995.014] (-997.964) (-993.125) -- 0:02:44
Average standard deviation of split frequencies: 0.003129
150500 -- (-990.894) (-996.271) (-989.998) [-991.080] * (-996.641) (-1001.344) (-995.916) [-992.400] -- 0:02:43
151000 -- (-990.973) [-995.493] (-991.731) (-993.710) * (-992.930) (-993.979) [-993.541] (-995.384) -- 0:02:43
151500 -- (-995.069) [-993.972] (-994.743) (-995.105) * (-991.772) (-997.536) (-997.106) [-995.090] -- 0:02:42
152000 -- (-994.959) (-998.536) [-999.637] (-994.093) * (-993.420) (-993.911) (-992.794) [-998.667] -- 0:02:41
152500 -- (-1001.240) (-998.533) (-1001.019) [-991.603] * (-989.840) [-996.637] (-1002.081) (-996.196) -- 0:02:41
153000 -- (-995.959) [-993.172] (-994.219) (-995.371) * (-997.911) [-993.948] (-993.347) (-999.803) -- 0:02:40
153500 -- (-996.396) (-999.608) (-998.087) [-993.434] * (-992.845) (-995.414) [-998.633] (-997.664) -- 0:02:39
154000 -- (-998.046) (-993.600) (-999.387) [-998.517] * (-1000.633) (-988.054) (-994.039) [-991.760] -- 0:02:39
154500 -- (-994.074) (-991.816) (-998.145) [-994.961] * (-1002.252) (-991.392) [-996.007] (-993.341) -- 0:02:38
155000 -- (-997.675) (-998.675) [-1003.227] (-991.918) * (-996.565) [-996.298] (-993.974) (-1000.733) -- 0:02:43
Average standard deviation of split frequencies: 0.003022
155500 -- (-1002.115) [-996.433] (-995.469) (-997.749) * (-997.866) (-994.214) [-992.076] (-999.308) -- 0:02:42
156000 -- (-998.514) (-993.084) [-992.818] (-998.135) * (-997.578) (-994.526) (-995.392) [-990.728] -- 0:02:42
156500 -- (-1006.664) [-995.108] (-992.531) (-991.791) * [-992.918] (-1004.570) (-995.824) (-993.632) -- 0:02:41
157000 -- [-992.567] (-993.210) (-991.079) (-994.282) * [-995.349] (-1008.746) (-999.140) (-995.189) -- 0:02:41
157500 -- [-991.751] (-996.437) (-995.927) (-999.877) * (-997.652) [-994.022] (-991.913) (-998.501) -- 0:02:40
158000 -- (-989.185) (-997.502) (-991.454) [-989.789] * (-998.255) (-996.542) [-997.886] (-996.805) -- 0:02:39
158500 -- [-995.392] (-996.851) (-997.579) (-994.732) * (-995.399) (-1000.148) (-994.684) [-991.014] -- 0:02:39
159000 -- (-994.995) (-997.502) (-993.734) [-993.007] * (-991.360) (-991.044) [-993.861] (-992.938) -- 0:02:38
159500 -- (-992.428) (-993.120) (-994.008) [-995.753] * (-992.967) (-998.006) (-1003.647) [-995.311] -- 0:02:38
160000 -- (-999.525) (-998.082) [-991.501] (-993.820) * (-994.740) (-1000.557) [-997.321] (-993.057) -- 0:02:37
Average standard deviation of split frequencies: 0.004401
160500 -- (-996.233) (-997.833) [-991.764] (-995.367) * [-993.766] (-995.486) (-1003.631) (-995.744) -- 0:02:42
161000 -- [-997.251] (-993.973) (-995.159) (-996.861) * (-997.895) [-995.838] (-1006.201) (-994.403) -- 0:02:41
161500 -- (-995.314) (-993.850) [-992.120] (-993.776) * [-991.640] (-997.860) (-995.541) (-993.454) -- 0:02:40
162000 -- (-995.493) [-994.695] (-996.237) (-992.082) * (-997.282) (-1000.697) (-998.182) [-991.713] -- 0:02:40
162500 -- (-995.096) [-992.488] (-991.119) (-1001.964) * (-995.544) (-997.614) (-997.417) [-994.209] -- 0:02:39
163000 -- (-995.600) (-991.718) (-994.240) [-1000.979] * (-1001.415) [-1000.028] (-994.233) (-994.489) -- 0:02:39
163500 -- (-997.743) (-992.552) (-994.815) [-994.492] * [-989.049] (-1000.112) (-996.043) (-997.724) -- 0:02:38
164000 -- (-995.485) (-996.280) [-996.274] (-992.913) * [-995.399] (-996.394) (-996.718) (-998.097) -- 0:02:38
164500 -- (-994.929) (-1001.508) (-991.659) [-993.326] * [-991.029] (-995.764) (-1002.281) (-1002.548) -- 0:02:37
165000 -- (-998.356) (-994.880) [-996.252] (-995.893) * (-998.705) (-992.096) [-996.618] (-1003.411) -- 0:02:36
Average standard deviation of split frequencies: 0.004260
165500 -- (-993.082) (-994.708) (-993.801) [-993.871] * [-993.437] (-993.322) (-995.142) (-1003.389) -- 0:02:41
166000 -- [-990.662] (-1000.536) (-1000.029) (-995.384) * [-993.275] (-998.794) (-993.124) (-1002.800) -- 0:02:40
166500 -- (-993.774) (-1002.960) [-989.724] (-998.034) * (-996.794) (-994.977) [-990.881] (-995.499) -- 0:02:40
167000 -- (-992.077) (-994.490) [-991.966] (-1009.942) * (-1001.269) [-990.868] (-997.179) (-995.391) -- 0:02:39
167500 -- (-993.926) [-994.011] (-993.559) (-993.837) * (-992.923) (-989.974) [-996.281] (-994.775) -- 0:02:39
168000 -- [-991.127] (-995.312) (-1005.125) (-992.350) * (-991.522) [-993.747] (-993.975) (-997.241) -- 0:02:38
168500 -- (-992.097) (-1001.681) [-996.639] (-1002.830) * (-999.907) [-996.618] (-993.335) (-998.444) -- 0:02:37
169000 -- (-994.091) (-996.822) [-997.902] (-999.611) * (-993.538) [-995.210] (-997.330) (-992.035) -- 0:02:37
169500 -- (-997.647) (-997.175) [-993.474] (-1006.947) * [-991.026] (-999.695) (-993.061) (-991.184) -- 0:02:36
170000 -- [-994.315] (-996.923) (-990.644) (-995.461) * (-998.884) (-998.287) (-999.117) [-995.424] -- 0:02:36
Average standard deviation of split frequencies: 0.005524
170500 -- (-995.425) (-1005.572) [-995.901] (-998.857) * (-990.749) (-994.770) [-999.005] (-993.337) -- 0:02:35
171000 -- (-994.616) (-998.005) (-994.747) [-999.931] * (-1001.735) (-995.047) [-990.700] (-989.686) -- 0:02:39
171500 -- [-991.619] (-996.872) (-995.338) (-1000.649) * (-991.990) (-994.237) (-997.959) [-990.774] -- 0:02:39
172000 -- (-994.709) [-994.980] (-992.739) (-997.778) * (-989.316) (-995.240) (-993.884) [-996.477] -- 0:02:38
172500 -- [-990.367] (-993.422) (-990.160) (-1003.579) * (-991.681) [-993.623] (-996.658) (-995.956) -- 0:02:38
173000 -- (-992.812) [-992.209] (-995.765) (-999.089) * (-994.791) (-995.198) [-991.175] (-997.717) -- 0:02:37
173500 -- (-993.957) (-993.230) [-994.094] (-1012.754) * (-997.072) (-994.315) (-996.443) [-994.697] -- 0:02:37
174000 -- [-995.025] (-992.273) (-994.330) (-1002.739) * (-999.271) (-994.749) (-997.416) [-991.459] -- 0:02:36
174500 -- [-990.753] (-996.063) (-996.226) (-999.274) * (-1001.227) (-999.130) (-994.842) [-998.098] -- 0:02:36
175000 -- (-997.456) [-994.208] (-994.557) (-1003.699) * (-998.526) (-996.310) (-992.983) [-994.595] -- 0:02:35
Average standard deviation of split frequencies: 0.006696
175500 -- (-992.571) (-994.764) (-1002.249) [-994.229] * (-1001.228) (-997.319) [-992.871] (-996.897) -- 0:02:35
176000 -- (-992.134) [-992.999] (-997.061) (-995.821) * (-1001.012) [-991.520] (-999.604) (-992.546) -- 0:02:39
176500 -- [-993.668] (-994.991) (-996.782) (-997.597) * (-996.915) [-991.792] (-994.598) (-994.892) -- 0:02:38
177000 -- (-993.721) (-990.734) [-997.016] (-994.065) * [-995.128] (-993.657) (-991.888) (-998.813) -- 0:02:38
177500 -- (-994.728) [-988.745] (-993.275) (-998.287) * (-997.232) (-995.923) [-996.745] (-997.790) -- 0:02:37
178000 -- [-990.045] (-997.089) (-995.250) (-997.616) * (-991.129) (-994.972) (-993.371) [-998.302] -- 0:02:37
178500 -- [-995.241] (-997.320) (-994.644) (-995.125) * (-998.747) (-1000.018) (-993.864) [-996.579] -- 0:02:36
179000 -- (-993.338) [-990.119] (-993.209) (-993.824) * (-991.673) [-1002.609] (-995.646) (-996.657) -- 0:02:35
179500 -- (-1000.007) (-996.779) [-992.617] (-994.504) * (-992.970) (-1006.218) [-994.263] (-995.447) -- 0:02:35
180000 -- (-997.887) (-998.200) (-993.377) [-991.528] * (-993.875) (-995.414) (-991.991) [-998.561] -- 0:02:34
Average standard deviation of split frequencies: 0.006523
180500 -- (-1004.434) (-995.819) (-1000.573) [-989.225] * (-996.893) [-996.690] (-996.895) (-995.189) -- 0:02:38
181000 -- (-1000.106) (-995.234) [-995.336] (-994.366) * (-998.493) (-996.197) [-990.446] (-995.296) -- 0:02:38
181500 -- (-995.625) (-993.102) [-997.607] (-993.063) * [-995.653] (-997.500) (-993.217) (-995.128) -- 0:02:37
182000 -- [-995.329] (-991.269) (-991.951) (-996.488) * (-992.979) [-991.949] (-991.863) (-990.062) -- 0:02:37
182500 -- (-995.785) (-992.930) [-991.146] (-996.688) * (-995.589) (-995.002) (-999.740) [-993.621] -- 0:02:36
183000 -- (-993.279) [-1000.713] (-993.109) (-996.749) * (-997.463) (-1002.052) (-998.152) [-992.323] -- 0:02:36
183500 -- (-998.438) (-992.577) [-991.427] (-992.002) * (-993.490) (-994.413) [-1000.252] (-999.949) -- 0:02:35
184000 -- (-995.796) (-995.048) (-996.844) [-998.790] * (-997.736) [-994.198] (-998.334) (-994.889) -- 0:02:35
184500 -- (-993.009) (-994.007) [-995.722] (-995.614) * (-997.072) [-992.569] (-996.674) (-997.175) -- 0:02:34
185000 -- (-995.807) (-996.793) [-993.718] (-998.054) * (-995.994) (-1002.090) (-997.429) [-992.227] -- 0:02:38
Average standard deviation of split frequencies: 0.007603
185500 -- (-994.674) (-1001.213) (-995.192) [-997.490] * (-996.214) (-998.635) [-998.037] (-991.756) -- 0:02:38
186000 -- (-994.127) (-999.890) [-998.532] (-993.675) * [-996.526] (-1004.080) (-996.332) (-997.398) -- 0:02:37
186500 -- (-990.445) [-995.012] (-996.077) (-994.844) * (-996.168) (-998.204) [-995.746] (-996.493) -- 0:02:37
187000 -- [-993.879] (-997.419) (-999.597) (-997.634) * (-997.089) [-996.936] (-997.970) (-992.765) -- 0:02:36
187500 -- (-995.737) [-996.754] (-1001.704) (-996.952) * (-993.844) (-993.677) [-998.819] (-990.390) -- 0:02:36
188000 -- (-997.574) (-997.903) [-992.101] (-992.186) * (-994.471) [-989.675] (-1003.658) (-993.606) -- 0:02:35
188500 -- (-993.923) (-1000.443) (-990.597) [-993.467] * [-992.667] (-992.411) (-1001.595) (-991.409) -- 0:02:34
189000 -- (-994.002) (-995.771) (-997.704) [-989.417] * [-993.258] (-995.777) (-997.972) (-995.330) -- 0:02:34
189500 -- (-995.587) (-997.156) [-996.195] (-991.852) * [-990.214] (-1000.928) (-995.042) (-995.116) -- 0:02:33
190000 -- [-1002.862] (-997.894) (-996.363) (-997.385) * (-992.695) (-995.472) (-992.662) [-996.042] -- 0:02:33
Average standard deviation of split frequencies: 0.008653
190500 -- (-996.276) [-990.773] (-999.479) (-995.945) * (-995.184) (-993.468) (-1000.978) [-997.453] -- 0:02:37
191000 -- (-994.021) (-991.059) [-998.910] (-997.068) * (-998.705) [-990.041] (-1006.432) (-998.803) -- 0:02:36
191500 -- [-997.826] (-992.153) (-996.623) (-999.535) * (-1000.733) [-993.670] (-994.651) (-994.828) -- 0:02:36
192000 -- (-997.045) (-989.378) [-1000.239] (-997.308) * (-998.430) [-994.043] (-992.623) (-991.568) -- 0:02:35
192500 -- (-993.858) (-991.831) (-999.685) [-996.467] * (-1002.672) [-993.381] (-995.563) (-994.240) -- 0:02:35
193000 -- (-1007.451) [-994.407] (-992.544) (-993.179) * (-993.174) [-994.409] (-999.560) (-996.926) -- 0:02:34
193500 -- [-997.041] (-993.779) (-993.839) (-994.582) * (-993.276) [-997.142] (-1002.807) (-998.396) -- 0:02:34
194000 -- (-1000.602) (-995.452) [-989.493] (-995.717) * (-995.455) [-991.399] (-998.962) (-994.721) -- 0:02:33
194500 -- (-997.240) [-991.791] (-998.567) (-996.492) * (-993.636) [-995.349] (-996.548) (-995.490) -- 0:02:33
195000 -- (-1000.116) (-993.864) [-995.002] (-996.592) * (-994.946) [-994.259] (-998.308) (-993.468) -- 0:02:32
Average standard deviation of split frequencies: 0.008418
195500 -- [-995.412] (-992.958) (-998.246) (-993.311) * [-992.120] (-994.717) (-994.214) (-994.816) -- 0:02:36
196000 -- (-995.934) [-993.646] (-994.863) (-995.667) * (-993.145) (-999.905) [-994.156] (-995.323) -- 0:02:35
196500 -- [-1000.530] (-991.204) (-996.568) (-999.197) * (-992.977) (-996.773) [-992.843] (-994.707) -- 0:02:35
197000 -- (-997.264) [-992.625] (-999.468) (-995.040) * [-996.177] (-997.472) (-996.673) (-996.907) -- 0:02:34
197500 -- (-995.077) [-991.344] (-989.579) (-993.491) * (-996.554) [-999.782] (-994.806) (-997.929) -- 0:02:34
198000 -- (-1001.837) (-993.420) [-998.987] (-999.094) * (-995.424) (-996.867) [-992.651] (-996.631) -- 0:02:33
198500 -- [-997.707] (-998.766) (-992.198) (-995.765) * (-1002.465) (-996.798) (-1002.790) [-993.990] -- 0:02:33
199000 -- (-999.476) (-998.564) (-992.839) [-992.077] * (-998.498) (-996.485) [-994.735] (-1001.389) -- 0:02:32
199500 -- [-999.152] (-1004.656) (-993.615) (-992.713) * (-1000.019) (-996.215) (-996.147) [-995.705] -- 0:02:32
200000 -- (-1000.785) (-998.678) (-991.396) [-991.810] * (-995.741) (-994.929) [-998.330] (-994.503) -- 0:02:32
Average standard deviation of split frequencies: 0.009397
200500 -- (-991.995) (-996.995) [-992.372] (-992.075) * (-995.938) (-994.218) [-989.893] (-991.036) -- 0:02:31
201000 -- (-993.294) [-995.378] (-997.030) (-997.230) * [-996.783] (-990.052) (-995.035) (-997.632) -- 0:02:35
201500 -- [-992.430] (-1001.881) (-999.913) (-999.897) * (-996.532) (-990.699) [-991.194] (-997.017) -- 0:02:34
202000 -- (-1003.136) (-996.302) (-994.759) [-990.776] * (-993.028) [-991.943] (-991.370) (-995.574) -- 0:02:34
202500 -- [-991.770] (-999.175) (-999.262) (-994.626) * [-991.307] (-992.130) (-994.626) (-998.078) -- 0:02:33
203000 -- [-994.015] (-995.542) (-999.464) (-999.235) * [-995.442] (-994.154) (-993.069) (-996.879) -- 0:02:33
203500 -- (-1000.643) (-993.452) [-994.240] (-991.909) * (-996.404) (-996.080) (-996.260) [-993.979] -- 0:02:32
204000 -- (-996.496) [-994.855] (-994.873) (-991.883) * (-992.701) (-995.952) (-994.596) [-997.019] -- 0:02:32
204500 -- (-999.871) [-993.831] (-994.750) (-998.327) * [-999.149] (-997.848) (-992.154) (-999.625) -- 0:02:31
205000 -- (-999.209) (-993.184) [-993.453] (-997.540) * (-995.040) [-993.208] (-993.385) (-994.322) -- 0:02:31
Average standard deviation of split frequencies: 0.009153
205500 -- [-994.803] (-996.677) (-998.293) (-1001.356) * (-997.050) [-991.683] (-997.664) (-1000.567) -- 0:02:30
206000 -- (-997.192) (-997.670) (-992.169) [-992.550] * (-990.791) [-993.216] (-989.595) (-996.490) -- 0:02:30
206500 -- (-994.536) (-994.768) (-1000.096) [-995.970] * (-991.987) [-990.397] (-993.520) (-1005.519) -- 0:02:33
207000 -- (-999.548) (-991.313) (-993.464) [-995.854] * (-994.355) [-995.410] (-993.934) (-1002.541) -- 0:02:33
207500 -- [-991.652] (-994.602) (-996.144) (-994.308) * [-996.815] (-991.614) (-1004.846) (-993.016) -- 0:02:32
208000 -- [-991.953] (-998.705) (-996.351) (-992.793) * (-993.085) (-990.840) (-999.643) [-993.569] -- 0:02:32
208500 -- (-993.586) (-1003.871) [-993.948] (-998.633) * (-996.894) (-992.428) (-995.707) [-993.988] -- 0:02:31
209000 -- (-992.279) (-997.055) [-998.684] (-994.147) * (-997.015) (-995.330) (-998.022) [-996.643] -- 0:02:31
209500 -- (-997.316) [-999.031] (-991.017) (-991.850) * [-998.296] (-994.625) (-996.636) (-999.513) -- 0:02:30
210000 -- (-997.741) [-990.884] (-993.075) (-990.590) * (-991.493) (-992.435) (-994.100) [-994.102] -- 0:02:30
Average standard deviation of split frequencies: 0.008951
210500 -- (-993.557) [-990.114] (-994.450) (-990.574) * [-993.106] (-994.819) (-993.738) (-1001.709) -- 0:02:30
211000 -- (-991.526) (-1000.389) [-993.335] (-991.872) * (-993.558) (-999.704) (-993.247) [-992.572] -- 0:02:29
211500 -- (-995.775) (-991.300) [-996.588] (-989.230) * (-995.530) [-992.885] (-1002.058) (-992.272) -- 0:02:32
212000 -- (-996.365) (-995.024) [-994.885] (-994.298) * (-995.954) (-991.376) (-997.492) [-998.391] -- 0:02:32
212500 -- [-993.700] (-993.375) (-1000.796) (-993.359) * (-996.048) [-991.297] (-996.226) (-1004.573) -- 0:02:31
213000 -- (-993.837) (-992.232) [-997.936] (-995.583) * (-990.493) (-991.655) [-995.392] (-1002.263) -- 0:02:31
213500 -- [-990.628] (-994.367) (-1000.789) (-994.694) * (-992.653) (-999.790) [-994.803] (-997.534) -- 0:02:31
214000 -- (-990.996) [-994.369] (-1004.613) (-997.688) * (-992.008) (-992.465) (-997.702) [-991.693] -- 0:02:30
214500 -- (-1000.198) (-998.706) (-1005.826) [-997.414] * (-996.947) [-998.096] (-994.330) (-992.941) -- 0:02:30
215000 -- (-996.056) (-991.204) (-1001.495) [-996.566] * (-998.699) [-990.527] (-991.571) (-993.402) -- 0:02:29
Average standard deviation of split frequencies: 0.009821
215500 -- [-995.742] (-992.978) (-993.236) (-997.529) * (-997.474) (-996.997) (-995.218) [-992.098] -- 0:02:29
216000 -- [-992.556] (-995.611) (-997.169) (-996.466) * (-993.197) (-1000.096) [-995.171] (-997.594) -- 0:02:28
216500 -- [-996.307] (-997.705) (-998.332) (-995.482) * (-990.756) (-995.582) [-999.860] (-1001.277) -- 0:02:28
217000 -- (-1000.558) [-996.040] (-995.178) (-995.963) * [-993.529] (-994.808) (-997.942) (-997.488) -- 0:02:31
217500 -- (-996.836) [-991.948] (-1001.730) (-995.812) * [-991.899] (-999.949) (-1004.038) (-1003.835) -- 0:02:31
218000 -- (-996.775) (-996.765) (-996.264) [-992.412] * [-992.900] (-999.398) (-995.614) (-992.697) -- 0:02:30
218500 -- (-994.374) [-996.312] (-994.688) (-990.416) * [-993.483] (-997.108) (-994.342) (-993.946) -- 0:02:30
219000 -- [-993.534] (-991.556) (-995.807) (-998.858) * (-999.516) (-994.538) [-995.692] (-994.020) -- 0:02:29
219500 -- (-994.253) (-997.274) (-996.636) [-994.156] * (-997.818) (-1000.826) [-992.779] (-995.180) -- 0:02:29
220000 -- [-990.937] (-995.588) (-998.550) (-994.977) * (-991.825) (-991.107) (-994.902) [-991.186] -- 0:02:28
Average standard deviation of split frequencies: 0.010681
220500 -- (-992.813) [-992.518] (-1001.620) (-1003.157) * (-996.743) (-993.221) (-995.433) [-993.533] -- 0:02:28
221000 -- [-994.769] (-992.867) (-993.359) (-993.101) * [-1002.610] (-997.297) (-993.394) (-997.846) -- 0:02:28
221500 -- [-994.064] (-1001.010) (-995.009) (-994.874) * (-993.083) (-994.939) [-989.752] (-992.064) -- 0:02:27
222000 -- [-993.048] (-1003.830) (-996.666) (-1004.291) * [-993.073] (-997.232) (-993.748) (-996.870) -- 0:02:30
222500 -- (-998.139) [-999.830] (-1002.080) (-992.089) * (-992.494) (-995.524) (-997.754) [-991.622] -- 0:02:30
223000 -- (-1000.485) [-999.092] (-994.924) (-989.810) * (-991.584) (-993.740) [-992.276] (-990.740) -- 0:02:29
223500 -- (-999.647) (-995.772) (-995.768) [-990.232] * (-994.677) (-1005.366) (-993.063) [-993.480] -- 0:02:29
224000 -- (-997.480) [-992.221] (-996.750) (-996.708) * [-992.565] (-996.320) (-997.565) (-1001.013) -- 0:02:28
224500 -- (-995.890) (-993.368) (-994.926) [-995.479] * [-991.166] (-993.905) (-993.005) (-1000.359) -- 0:02:28
225000 -- (-998.742) (-994.751) [-990.438] (-995.028) * (-1000.061) [-990.710] (-996.438) (-998.626) -- 0:02:28
Average standard deviation of split frequencies: 0.010429
225500 -- (-999.308) (-1002.624) [-995.056] (-998.169) * (-994.894) (-995.788) [-991.192] (-993.576) -- 0:02:27
226000 -- (-999.849) (-995.307) (-992.087) [-995.101] * [-994.957] (-998.534) (-991.912) (-995.577) -- 0:02:27
226500 -- (-998.165) [-991.769] (-990.543) (-1002.445) * (-1000.131) [-995.309] (-995.444) (-991.141) -- 0:02:26
227000 -- (-996.418) (-998.714) [-999.678] (-1006.364) * (-993.708) (-995.210) [-996.215] (-995.834) -- 0:02:26
227500 -- (-991.449) (-994.323) [-991.048] (-994.261) * (-1001.823) [-997.279] (-1002.013) (-997.411) -- 0:02:29
228000 -- (-998.511) (-998.878) (-997.212) [-992.929] * (-999.306) (-999.515) (-993.755) [-994.023] -- 0:02:28
228500 -- (-991.524) (-992.226) (-995.073) [-991.779] * (-995.999) [-994.224] (-993.504) (-996.068) -- 0:02:28
229000 -- (-991.850) (-991.505) [-1006.510] (-993.251) * (-996.805) (-996.821) [-991.630] (-994.483) -- 0:02:28
229500 -- (-997.598) (-997.262) (-992.580) [-992.498] * (-993.727) (-999.821) (-994.502) [-998.251] -- 0:02:27
230000 -- (-1003.770) (-994.491) (-994.678) [-996.786] * (-992.444) [-999.242] (-995.347) (-998.497) -- 0:02:27
Average standard deviation of split frequencies: 0.010218
230500 -- [-990.779] (-995.013) (-996.396) (-996.325) * (-997.138) (-994.532) [-1001.851] (-991.809) -- 0:02:26
231000 -- (-997.267) (-996.831) [-992.932] (-991.591) * (-993.508) (-998.114) [-991.849] (-992.877) -- 0:02:26
231500 -- [-992.829] (-999.264) (-990.612) (-996.856) * (-1001.414) (-999.584) [-998.718] (-998.555) -- 0:02:26
232000 -- (-995.507) (-1003.127) (-1003.110) [-999.201] * (-999.481) [-995.614] (-997.858) (-1003.692) -- 0:02:25
232500 -- (-999.213) [-996.242] (-994.551) (-1000.170) * (-997.717) [-999.629] (-997.645) (-997.943) -- 0:02:28
233000 -- (-993.451) (-992.568) (-994.062) [-999.724] * (-997.199) [-994.210] (-996.323) (-998.134) -- 0:02:28
233500 -- (-995.779) (-1005.213) [-998.133] (-1001.063) * (-998.197) (-993.075) [-995.738] (-1004.612) -- 0:02:27
234000 -- (-997.880) (-993.238) (-991.692) [-996.609] * (-995.904) (-992.409) [-998.848] (-995.791) -- 0:02:27
234500 -- (-993.089) [-1000.218] (-1002.649) (-992.459) * (-994.209) (-992.970) [-994.394] (-995.143) -- 0:02:26
235000 -- [-995.871] (-994.431) (-994.308) (-996.115) * (-1000.757) (-992.728) (-992.607) [-996.422] -- 0:02:26
Average standard deviation of split frequencies: 0.010986
235500 -- (-991.591) [-994.849] (-999.945) (-992.457) * (-996.118) [-993.661] (-999.698) (-999.907) -- 0:02:26
236000 -- [-991.565] (-995.926) (-999.187) (-994.356) * (-998.810) [-992.633] (-999.312) (-1004.477) -- 0:02:25
236500 -- [-994.238] (-993.379) (-994.481) (-993.087) * (-1001.188) [-994.655] (-993.024) (-999.750) -- 0:02:25
237000 -- (-995.233) (-1003.809) [-990.415] (-996.714) * (-994.677) (-994.905) (-992.780) [-997.685] -- 0:02:24
237500 -- (-1000.207) [-993.987] (-997.402) (-993.387) * (-997.459) [-989.948] (-992.858) (-1008.987) -- 0:02:24
238000 -- (-992.013) (-991.199) (-1001.447) [-991.285] * [-993.506] (-994.230) (-990.651) (-999.584) -- 0:02:27
238500 -- (-997.947) [-989.981] (-996.784) (-991.355) * (-997.133) [-994.723] (-994.062) (-1001.273) -- 0:02:26
239000 -- (-993.268) (-993.562) [-991.350] (-994.663) * (-998.636) [-997.388] (-992.336) (-998.315) -- 0:02:26
239500 -- (-991.198) (-994.103) (-994.805) [-996.803] * [-994.646] (-993.876) (-1002.680) (-998.781) -- 0:02:26
240000 -- (-993.100) (-991.695) [-990.563] (-993.345) * [-992.294] (-994.244) (-1003.080) (-996.955) -- 0:02:25
Average standard deviation of split frequencies: 0.008814
240500 -- (-988.406) [-994.685] (-999.675) (-994.205) * (-996.956) (-1006.853) [-998.141] (-997.007) -- 0:02:25
241000 -- (-993.337) [-991.380] (-998.197) (-998.863) * [-991.668] (-1002.647) (-1000.261) (-993.456) -- 0:02:24
241500 -- (-992.295) [-995.309] (-993.234) (-994.032) * (-993.149) (-993.257) (-999.884) [-989.449] -- 0:02:24
242000 -- (-998.817) [-993.443] (-997.519) (-997.107) * (-995.776) (-996.875) [-994.648] (-996.756) -- 0:02:24
242500 -- (-992.904) (-994.736) [-990.949] (-996.243) * (-991.115) [-996.046] (-993.433) (-999.923) -- 0:02:23
243000 -- (-992.864) (-994.815) (-991.417) [-996.484] * (-993.558) (-998.823) [-991.424] (-1010.304) -- 0:02:23
243500 -- (-1004.570) (-997.744) (-998.327) [-993.846] * (-1000.754) (-1001.026) [-993.454] (-1004.092) -- 0:02:26
244000 -- (-996.946) [-998.561] (-1001.207) (-993.561) * (-995.713) [-990.748] (-991.574) (-1005.508) -- 0:02:25
244500 -- (-994.391) [-989.853] (-997.587) (-997.230) * (-999.150) (-995.910) [-994.173] (-993.239) -- 0:02:25
245000 -- (-996.278) [-991.716] (-996.370) (-996.392) * (-995.472) [-994.091] (-994.762) (-997.710) -- 0:02:24
Average standard deviation of split frequencies: 0.009581
245500 -- [-995.654] (-996.853) (-992.923) (-1005.602) * (-995.316) (-995.479) (-997.152) [-997.348] -- 0:02:24
246000 -- (-993.024) (-996.510) [-992.303] (-1000.625) * [-996.201] (-992.993) (-1000.182) (-996.389) -- 0:02:24
246500 -- (-1000.478) (-1002.654) (-992.693) [-990.277] * (-992.459) (-996.073) (-996.739) [-992.600] -- 0:02:23
247000 -- (-994.911) (-995.167) [-991.295] (-996.390) * (-1000.246) [-998.479] (-995.089) (-994.795) -- 0:02:23
247500 -- (-993.687) [-993.286] (-991.715) (-993.655) * (-999.451) (-994.061) (-997.144) [-1001.744] -- 0:02:22
248000 -- [-994.171] (-995.392) (-994.958) (-996.388) * (-995.407) [-993.106] (-996.269) (-997.732) -- 0:02:22
248500 -- (-997.260) (-994.811) (-996.160) [-996.242] * (-993.631) (-997.752) (-997.357) [-999.575] -- 0:02:25
249000 -- (-991.287) (-993.672) [-995.576] (-994.522) * (-993.388) [-994.214] (-1002.953) (-997.064) -- 0:02:24
249500 -- (-996.560) (-993.471) [-995.093] (-992.177) * (-992.209) (-996.849) (-999.664) [-997.668] -- 0:02:24
250000 -- (-1001.826) (-996.501) (-994.905) [-994.324] * (-992.021) (-995.790) [-995.369] (-998.122) -- 0:02:24
Average standard deviation of split frequencies: 0.008463
250500 -- (-997.992) (-998.411) [-992.233] (-993.874) * (-995.465) [-999.324] (-995.427) (-996.941) -- 0:02:23
251000 -- (-999.078) (-997.708) (-994.844) [-990.360] * (-997.657) [-991.914] (-997.697) (-992.492) -- 0:02:23
251500 -- (-997.850) (-996.851) [-992.308] (-998.225) * (-995.704) [-991.579] (-999.416) (-993.699) -- 0:02:22
252000 -- (-998.001) (-1001.710) (-996.167) [-993.233] * (-990.869) [-992.533] (-993.967) (-995.007) -- 0:02:22
252500 -- (-1003.421) (-1001.443) (-992.685) [-993.503] * (-997.220) [-989.707] (-994.279) (-993.713) -- 0:02:22
253000 -- (-1000.022) [-993.521] (-997.534) (-994.438) * [-994.601] (-998.067) (-990.903) (-991.486) -- 0:02:21
253500 -- (-994.284) (-997.992) [-991.322] (-990.005) * (-990.502) [-994.531] (-992.158) (-990.934) -- 0:02:21
254000 -- (-1002.284) (-999.609) [-995.688] (-991.746) * (-1001.806) (-992.603) (-994.236) [-989.802] -- 0:02:23
254500 -- (-1000.009) [-999.860] (-992.941) (-992.558) * [-997.489] (-993.896) (-1004.101) (-995.967) -- 0:02:23
255000 -- (-1002.762) (-995.397) (-991.651) [-992.993] * (-996.897) [-992.341] (-997.325) (-998.334) -- 0:02:23
Average standard deviation of split frequencies: 0.007366
255500 -- (-993.713) (-1007.880) [-992.825] (-993.031) * (-997.336) [-991.463] (-998.176) (-994.893) -- 0:02:22
256000 -- (-995.982) (-992.896) [-992.723] (-993.369) * (-992.471) (-993.579) (-993.751) [-996.814] -- 0:02:22
256500 -- [-995.769] (-993.153) (-1000.143) (-996.361) * [-992.580] (-1001.286) (-1002.374) (-995.079) -- 0:02:22
257000 -- (-998.776) (-994.716) (-992.670) [-1000.173] * (-994.217) (-1000.208) [-992.229] (-992.070) -- 0:02:21
257500 -- (-995.602) (-991.177) [-992.808] (-1000.658) * (-995.381) (-1006.371) [-992.757] (-996.844) -- 0:02:21
258000 -- [-993.977] (-992.724) (-997.286) (-1000.869) * (-997.383) (-998.451) [-997.672] (-995.069) -- 0:02:20
258500 -- [-1000.653] (-992.767) (-995.032) (-999.893) * (-995.598) (-992.884) [-995.087] (-997.268) -- 0:02:20
259000 -- (-994.035) [-996.056] (-993.452) (-994.906) * (-1008.782) (-994.216) [-989.782] (-992.365) -- 0:02:23
259500 -- [-992.880] (-992.321) (-991.961) (-991.460) * (-999.224) (-989.952) [-993.089] (-991.856) -- 0:02:22
260000 -- (-994.222) (-998.496) [-995.170] (-1001.698) * (-996.460) [-992.066] (-992.656) (-994.634) -- 0:02:22
Average standard deviation of split frequencies: 0.005425
260500 -- (-999.735) (-991.874) [-989.936] (-992.765) * [-989.379] (-991.066) (-992.412) (-995.221) -- 0:02:21
261000 -- [-995.693] (-997.849) (-991.886) (-991.488) * (-998.748) [-992.891] (-993.352) (-994.186) -- 0:02:21
261500 -- (-996.527) (-996.910) (-992.668) [-998.140] * [-992.066] (-1000.261) (-991.952) (-990.998) -- 0:02:21
262000 -- (-995.977) (-997.495) [-992.521] (-998.867) * (-996.074) (-995.163) (-990.572) [-992.604] -- 0:02:20
262500 -- (-997.022) (-1007.406) [-994.909] (-994.659) * (-993.029) (-993.866) (-994.110) [-996.580] -- 0:02:20
263000 -- (-991.878) (-994.528) (-996.764) [-994.382] * [-999.092] (-999.398) (-994.193) (-992.190) -- 0:02:20
263500 -- [-996.750] (-993.675) (-998.720) (-996.286) * [-996.740] (-1003.154) (-998.687) (-998.730) -- 0:02:19
264000 -- (-995.073) (-1002.184) [-994.095] (-992.463) * (-993.648) (-999.803) [-992.081] (-995.379) -- 0:02:19
264500 -- (-994.984) (-993.055) [-995.967] (-993.665) * (-993.419) (-997.254) [-995.352] (-998.542) -- 0:02:21
265000 -- (-997.464) (-997.218) (-998.978) [-999.913] * [-993.969] (-999.042) (-995.447) (-992.074) -- 0:02:21
Average standard deviation of split frequencies: 0.004430
265500 -- (-995.940) [-998.289] (-992.975) (-995.769) * (-991.801) (-1007.589) [-991.959] (-992.136) -- 0:02:21
266000 -- (-996.622) [-997.844] (-995.999) (-995.815) * (-994.779) (-1002.709) (-995.122) [-995.661] -- 0:02:20
266500 -- (-998.343) (-993.562) [-991.501] (-991.322) * [-994.495] (-1001.096) (-999.999) (-1000.547) -- 0:02:20
267000 -- (-1001.546) [-989.264] (-992.158) (-998.636) * (-1005.043) (-997.528) (-997.226) [-1000.785] -- 0:02:20
267500 -- (-1005.692) (-1000.091) [-993.921] (-1000.150) * (-992.738) (-999.401) (-995.520) [-995.773] -- 0:02:19
268000 -- (-994.793) (-999.066) (-996.909) [-993.598] * [-989.942] (-996.292) (-998.421) (-991.376) -- 0:02:19
268500 -- (-999.083) [-999.382] (-992.053) (-995.667) * (-997.549) (-994.289) (-997.824) [-993.396] -- 0:02:18
269000 -- [-1000.681] (-998.164) (-1001.558) (-994.718) * [-995.259] (-997.265) (-996.019) (-989.310) -- 0:02:18
269500 -- (-1000.114) (-999.488) [-995.346] (-1004.744) * (-997.093) [-996.085] (-999.363) (-994.242) -- 0:02:20
270000 -- (-996.623) [-998.587] (-1002.086) (-993.102) * (-999.421) (-995.873) [-991.911] (-992.306) -- 0:02:20
Average standard deviation of split frequencies: 0.003483
270500 -- (-1001.450) (-1003.143) [-1002.396] (-998.016) * (-993.603) [-994.433] (-996.226) (-1002.807) -- 0:02:20
271000 -- [-1004.466] (-998.480) (-1001.243) (-996.105) * (-998.899) [-990.551] (-999.021) (-990.878) -- 0:02:19
271500 -- (-1004.919) [-993.872] (-995.372) (-993.034) * (-992.973) [-991.742] (-999.510) (-994.585) -- 0:02:19
272000 -- (-1000.331) [-991.790] (-999.656) (-991.932) * (-993.420) [-995.778] (-995.251) (-994.034) -- 0:02:19
272500 -- [-994.953] (-994.454) (-999.159) (-990.603) * (-997.269) (-993.819) [-994.241] (-992.541) -- 0:02:18
273000 -- (-993.353) (-997.728) (-1005.693) [-997.430] * (-995.350) (-995.137) (-998.489) [-997.719] -- 0:02:18
273500 -- [-991.079] (-993.545) (-1005.434) (-994.232) * [-997.042] (-993.521) (-992.637) (-997.150) -- 0:02:18
274000 -- (-993.585) (-995.397) (-999.149) [-994.274] * (-994.127) (-999.737) [-997.263] (-999.585) -- 0:02:17
274500 -- [-991.852] (-996.258) (-999.788) (-998.926) * (-996.575) (-998.422) (-1003.080) [-998.873] -- 0:02:17
275000 -- (-991.053) [-999.876] (-1002.631) (-998.857) * [-995.349] (-998.602) (-994.457) (-995.201) -- 0:02:19
Average standard deviation of split frequencies: 0.004270
275500 -- (-995.814) (-996.211) (-997.081) [-993.718] * (-997.762) (-999.388) [-995.325] (-994.184) -- 0:02:19
276000 -- [-997.254] (-998.851) (-994.854) (-995.832) * (-1001.254) [-996.146] (-989.811) (-992.249) -- 0:02:19
276500 -- (-991.699) (-994.390) (-999.642) [-997.924] * (-1001.115) [-1001.574] (-992.921) (-995.307) -- 0:02:18
277000 -- (-998.671) (-995.133) [-993.859] (-1003.181) * (-1006.292) (-992.803) (-997.598) [-999.440] -- 0:02:18
277500 -- [-995.020] (-995.695) (-995.615) (-996.996) * (-998.394) (-1000.122) [-990.353] (-993.272) -- 0:02:17
278000 -- (-997.546) [-997.166] (-998.185) (-994.985) * (-1000.065) (-993.403) (-989.551) [-993.767] -- 0:02:17
278500 -- (-997.453) (-1004.979) (-998.830) [-989.049] * (-998.262) [-990.524] (-994.497) (-992.883) -- 0:02:17
279000 -- (-992.298) (-997.509) (-995.626) [-994.795] * (-992.704) (-1003.417) (-993.976) [-997.186] -- 0:02:16
279500 -- (-990.488) (-1002.502) [-994.196] (-995.303) * (-994.557) [-994.475] (-998.010) (-1002.571) -- 0:02:16
280000 -- (-998.069) (-1000.385) (-991.229) [-989.496] * (-992.989) (-996.397) [-998.326] (-995.015) -- 0:02:16
Average standard deviation of split frequencies: 0.005039
280500 -- (-994.933) (-1000.000) [-990.341] (-991.862) * (-996.849) (-995.938) (-997.711) [-997.157] -- 0:02:18
281000 -- (-1000.322) [-995.587] (-992.889) (-994.180) * (-996.724) (-991.482) [-995.058] (-996.690) -- 0:02:18
281500 -- (-995.041) (-998.522) (-994.935) [-996.921] * (-993.729) (-992.965) [-999.487] (-999.197) -- 0:02:17
282000 -- [-996.827] (-996.414) (-996.170) (-1001.324) * [-997.247] (-996.228) (-998.055) (-993.790) -- 0:02:17
282500 -- (-994.687) [-995.700] (-1006.102) (-992.669) * (-1001.520) (-999.047) (-1001.219) [-989.921] -- 0:02:17
283000 -- (-995.192) [-992.431] (-994.359) (-994.792) * [-999.001] (-992.395) (-997.033) (-996.152) -- 0:02:16
283500 -- (-1000.636) [-994.631] (-996.500) (-997.415) * (-997.296) (-990.577) [-995.649] (-994.200) -- 0:02:16
284000 -- [-989.702] (-995.803) (-1007.624) (-989.574) * (-1008.996) [-993.382] (-993.663) (-1003.654) -- 0:02:16
284500 -- [-994.049] (-995.809) (-1000.975) (-1004.398) * [-991.574] (-992.607) (-996.537) (-993.901) -- 0:02:15
285000 -- (-1001.362) (-997.160) (-997.661) [-993.310] * (-996.708) [-992.058] (-1015.276) (-994.728) -- 0:02:15
Average standard deviation of split frequencies: 0.004945
285500 -- [-995.523] (-993.311) (-993.405) (-995.569) * [-990.440] (-991.074) (-997.341) (-995.383) -- 0:02:17
286000 -- [-993.300] (-992.155) (-993.788) (-992.290) * (-995.513) (-997.003) (-997.071) [-1000.354] -- 0:02:17
286500 -- [-995.664] (-998.322) (-998.234) (-995.894) * (-993.897) (-1003.840) [-991.951] (-993.965) -- 0:02:16
287000 -- [-996.834] (-993.357) (-996.550) (-996.174) * (-994.848) (-1002.252) [-993.156] (-993.989) -- 0:02:16
287500 -- [-994.855] (-991.253) (-998.743) (-996.913) * (-999.968) [-995.036] (-991.283) (-993.117) -- 0:02:16
288000 -- [-1004.212] (-994.889) (-990.992) (-998.459) * [-992.230] (-996.607) (-1001.095) (-993.214) -- 0:02:15
288500 -- (-995.899) [-990.648] (-996.493) (-994.112) * (-991.065) [-997.934] (-998.824) (-992.630) -- 0:02:15
289000 -- [-993.537] (-993.572) (-997.467) (-993.819) * (-993.786) (-992.585) (-995.418) [-991.588] -- 0:02:15
289500 -- (-1001.898) [-992.155] (-993.522) (-991.383) * (-995.267) (-994.793) [-991.708] (-994.136) -- 0:02:14
290000 -- (-994.645) (-996.800) (-996.452) [-1002.664] * [-994.851] (-995.470) (-995.632) (-996.654) -- 0:02:14
Average standard deviation of split frequencies: 0.005676
290500 -- [-992.584] (-996.164) (-996.756) (-991.799) * [-995.798] (-996.973) (-993.850) (-996.761) -- 0:02:14
291000 -- [-999.643] (-994.114) (-993.599) (-993.302) * [-990.401] (-996.538) (-993.479) (-1000.715) -- 0:02:16
291500 -- (-995.684) (-998.965) (-995.992) [-991.453] * [-996.349] (-997.794) (-993.257) (-996.219) -- 0:02:16
292000 -- (-993.415) (-995.988) [-997.554] (-996.819) * (-994.707) (-994.297) [-996.541] (-994.228) -- 0:02:15
292500 -- (-993.621) (-996.031) [-993.033] (-995.269) * (-997.654) (-999.811) (-1003.533) [-991.673] -- 0:02:15
293000 -- (-996.457) [-991.570] (-996.798) (-995.878) * (-991.290) (-995.338) (-1005.271) [-992.471] -- 0:02:15
293500 -- (-993.969) (-995.854) (-993.356) [-998.633] * (-991.481) (-995.723) [-1006.988] (-1000.292) -- 0:02:14
294000 -- (-994.394) (-999.374) (-991.189) [-991.448] * [-991.657] (-1004.569) (-1002.352) (-996.629) -- 0:02:14
294500 -- (-993.696) (-1003.506) [-989.509] (-994.337) * (-991.530) (-1003.897) (-1000.484) [-996.993] -- 0:02:14
295000 -- [-993.568] (-993.693) (-994.982) (-999.631) * (-993.051) (-1002.890) (-997.589) [-997.036] -- 0:02:13
Average standard deviation of split frequencies: 0.003981
295500 -- (-991.998) [-993.070] (-995.042) (-997.132) * (-998.110) (-990.010) (-1001.520) [-994.157] -- 0:02:13
296000 -- (-998.650) (-996.275) [-992.627] (-990.127) * (-996.898) (-994.604) (-999.804) [-992.911] -- 0:02:15
296500 -- (-1006.737) [-1000.759] (-992.210) (-992.091) * (-995.010) [-998.480] (-999.647) (-991.310) -- 0:02:15
297000 -- (-993.898) (-996.720) (-996.087) [-990.615] * (-991.813) [-1000.514] (-995.830) (-994.039) -- 0:02:14
297500 -- (-1002.369) (-997.339) [-990.618] (-991.757) * [-993.657] (-994.269) (-993.508) (-992.812) -- 0:02:14
298000 -- [-998.225] (-1005.193) (-994.781) (-992.082) * [-995.585] (-997.647) (-991.329) (-994.838) -- 0:02:14
298500 -- [-993.218] (-994.968) (-995.451) (-992.123) * (-993.285) [-996.344] (-1002.995) (-1006.545) -- 0:02:13
299000 -- (-1000.082) [-1001.332] (-987.991) (-996.864) * [-993.855] (-997.402) (-999.400) (-997.074) -- 0:02:13
299500 -- (-998.339) [-996.276] (-997.140) (-998.073) * (-997.238) (-995.849) [-991.503] (-992.697) -- 0:02:13
300000 -- (-996.577) [-996.903] (-998.082) (-997.032) * (-993.619) (-996.035) [-994.655] (-996.621) -- 0:02:13
Average standard deviation of split frequencies: 0.004704
300500 -- [-993.372] (-995.873) (-994.456) (-994.990) * [-988.218] (-996.036) (-997.481) (-993.466) -- 0:02:12
301000 -- (-994.605) [-995.747] (-993.605) (-999.881) * (-993.211) [-1004.182] (-992.630) (-991.262) -- 0:02:12
301500 -- (-993.991) (-991.929) [-996.339] (-999.503) * (-989.305) (-999.708) [-997.865] (-993.166) -- 0:02:14
302000 -- (-994.663) (-991.842) [-995.919] (-997.908) * [-997.890] (-1000.089) (-1003.630) (-994.830) -- 0:02:14
302500 -- (-1000.335) (-997.053) [-994.756] (-996.826) * (-1000.422) (-1002.757) (-993.909) [-993.144] -- 0:02:13
303000 -- (-995.916) [-998.000] (-993.798) (-1001.439) * (-998.642) (-996.783) [-996.301] (-990.167) -- 0:02:13
303500 -- (-996.776) (-998.726) [-991.344] (-998.020) * [-992.427] (-994.908) (-1002.050) (-988.961) -- 0:02:13
304000 -- [-990.891] (-1000.886) (-994.347) (-997.054) * (-995.441) (-996.693) (-995.952) [-991.864] -- 0:02:12
304500 -- [-994.231] (-998.051) (-1005.509) (-995.582) * (-995.880) [-997.652] (-997.930) (-994.354) -- 0:02:12
305000 -- [-995.953] (-998.537) (-1001.137) (-995.858) * [-998.000] (-992.395) (-995.345) (-995.718) -- 0:02:12
Average standard deviation of split frequencies: 0.003081
305500 -- (-995.425) (-997.072) [-995.082] (-992.437) * (-994.472) (-993.966) [-998.129] (-997.771) -- 0:02:11
306000 -- (-997.031) (-995.430) (-996.942) [-993.922] * [-992.842] (-992.700) (-997.911) (-992.702) -- 0:02:11
306500 -- (-996.836) [-996.182] (-994.436) (-995.545) * (-990.646) (-1000.260) [-994.638] (-996.808) -- 0:02:11
307000 -- (-998.859) (-991.817) [-998.381] (-993.899) * (-996.732) (-998.466) [-993.722] (-993.966) -- 0:02:13
307500 -- (-998.176) [-993.694] (-991.994) (-996.350) * (-998.053) (-998.777) (-997.184) [-994.323] -- 0:02:12
308000 -- (-1000.819) (-996.438) [-993.665] (-997.780) * [-1000.631] (-997.018) (-992.127) (-994.400) -- 0:02:12
308500 -- (-994.157) (-992.657) (-992.557) [-997.208] * (-995.828) (-1000.262) [-995.977] (-996.663) -- 0:02:12
309000 -- (-996.323) [-993.359] (-1003.555) (-996.926) * (-994.816) (-995.596) [-995.842] (-997.364) -- 0:02:11
309500 -- (-996.852) (-993.854) [-991.486] (-999.501) * (-995.422) [-992.215] (-995.713) (-997.377) -- 0:02:11
310000 -- [-995.879] (-990.923) (-1003.700) (-993.021) * (-991.885) [-994.313] (-997.182) (-995.597) -- 0:02:11
Average standard deviation of split frequencies: 0.003035
310500 -- (-993.871) (-993.793) [-999.250] (-995.014) * (-998.680) (-998.346) (-995.433) [-993.783] -- 0:02:11
311000 -- (-1000.840) (-997.457) (-1003.216) [-991.565] * [-995.153] (-996.549) (-994.397) (-993.542) -- 0:02:10
311500 -- (-1002.073) (-996.373) (-998.384) [-991.808] * (-994.700) [-995.167] (-993.529) (-991.832) -- 0:02:10
312000 -- [-993.646] (-998.942) (-997.923) (-993.866) * [-997.652] (-991.014) (-993.665) (-991.804) -- 0:02:12
312500 -- (-995.159) (-997.138) (-994.366) [-991.378] * (-998.168) [-996.559] (-993.177) (-990.193) -- 0:02:12
313000 -- (-994.501) (-993.969) [-995.687] (-996.421) * (-996.772) [-994.772] (-995.916) (-993.526) -- 0:02:11
313500 -- (-990.642) [-992.618] (-998.353) (-992.846) * (-993.254) [-995.033] (-997.289) (-1001.207) -- 0:02:11
314000 -- [-992.957] (-990.998) (-996.267) (-992.847) * [-991.804] (-996.390) (-992.094) (-998.523) -- 0:02:11
314500 -- (-997.132) [-992.698] (-990.631) (-990.662) * (-998.439) (-992.990) [-996.941] (-991.570) -- 0:02:10
315000 -- [-995.859] (-996.001) (-998.723) (-991.159) * (-1005.272) [-992.542] (-994.378) (-994.792) -- 0:02:10
Average standard deviation of split frequencies: 0.002238
315500 -- (-991.490) [-993.970] (-997.947) (-994.502) * (-1002.554) (-996.181) (-993.385) [-995.378] -- 0:02:10
316000 -- [-996.652] (-999.416) (-1009.509) (-996.152) * (-996.344) (-998.930) (-999.662) [-992.614] -- 0:02:09
316500 -- (-993.294) [-998.083] (-1002.184) (-1003.320) * (-995.115) (-995.533) (-995.433) [-993.657] -- 0:02:09
317000 -- (-996.394) (-989.795) [-999.865] (-999.746) * (-991.690) [-994.908] (-997.486) (-994.886) -- 0:02:09
317500 -- (-995.324) [-995.545] (-998.323) (-992.426) * (-994.594) (-999.295) (-996.286) [-998.453] -- 0:02:11
318000 -- (-1000.443) (-998.502) (-993.076) [-993.434] * [-992.765] (-1002.549) (-995.772) (-996.951) -- 0:02:10
318500 -- (-995.002) (-996.674) (-996.264) [-998.456] * (-992.341) (-994.033) (-999.065) [-994.310] -- 0:02:10
319000 -- (-1005.365) [-989.841] (-993.745) (-997.178) * (-996.400) (-998.038) [-991.231] (-997.502) -- 0:02:10
319500 -- (-998.145) (-998.240) [-996.196] (-996.940) * (-993.529) [-998.979] (-997.862) (-997.888) -- 0:02:09
320000 -- (-996.088) (-990.052) [-997.122] (-994.016) * (-996.052) [-994.559] (-993.261) (-992.675) -- 0:02:09
Average standard deviation of split frequencies: 0.002940
320500 -- (-997.201) [-992.508] (-1003.817) (-993.987) * (-994.584) [-994.717] (-996.964) (-996.026) -- 0:02:09
321000 -- [-989.936] (-990.677) (-997.005) (-997.035) * (-993.992) (-993.401) [-997.649] (-995.063) -- 0:02:09
321500 -- [-990.199] (-998.403) (-994.370) (-998.093) * (-994.116) (-995.052) (-993.838) [-998.280] -- 0:02:08
322000 -- [-993.096] (-992.594) (-993.147) (-1006.309) * (-992.487) (-993.147) (-993.162) [-999.996] -- 0:02:08
322500 -- (-991.374) [-989.787] (-996.253) (-995.323) * (-1002.993) [-994.695] (-996.993) (-999.633) -- 0:02:10
323000 -- (-999.814) (-994.025) (-995.191) [-994.511] * (-993.037) [-993.785] (-996.452) (-994.973) -- 0:02:09
323500 -- (-992.608) (-994.393) (-999.019) [-993.807] * (-993.634) (-999.685) (-996.878) [-991.042] -- 0:02:09
324000 -- (-994.255) (-995.871) (-998.955) [-992.721] * (-994.392) [-993.095] (-993.850) (-991.842) -- 0:02:09
324500 -- (-997.077) (-993.528) (-996.529) [-993.256] * [-992.266] (-1000.767) (-993.553) (-992.333) -- 0:02:09
325000 -- [-993.572] (-992.137) (-1000.206) (-993.850) * (-1006.276) (-993.745) [-993.000] (-998.364) -- 0:02:08
Average standard deviation of split frequencies: 0.002892
325500 -- [-992.220] (-993.811) (-999.373) (-998.517) * (-994.688) (-991.174) [-998.458] (-994.394) -- 0:02:08
326000 -- (-992.472) (-995.321) [-999.759] (-996.295) * (-994.607) (-997.433) (-998.938) [-992.205] -- 0:02:08
326500 -- (-996.944) (-995.740) (-996.454) [-992.473] * (-994.941) [-991.487] (-1003.006) (-994.884) -- 0:02:07
327000 -- (-994.440) (-996.132) [-992.071] (-997.483) * (-995.105) (-992.509) (-999.099) [-993.015] -- 0:02:07
327500 -- (-992.210) (-998.764) (-992.930) [-993.418] * (-991.295) [-995.574] (-1000.980) (-999.828) -- 0:02:07
328000 -- (-998.626) (-995.539) [-994.199] (-992.495) * (-1003.941) (-994.989) (-1001.306) [-1000.619] -- 0:02:09
328500 -- (-992.130) (-996.901) [-998.160] (-993.942) * (-996.601) (-996.757) [-992.848] (-995.521) -- 0:02:08
329000 -- [-992.085] (-994.183) (-989.951) (-993.914) * [-996.344] (-1000.864) (-1003.300) (-992.298) -- 0:02:08
329500 -- [-993.248] (-996.629) (-1000.942) (-994.442) * [-997.420] (-998.042) (-1004.072) (-993.410) -- 0:02:08
330000 -- [-995.025] (-993.628) (-997.617) (-992.090) * (-994.646) [-997.289] (-995.541) (-993.760) -- 0:02:07
Average standard deviation of split frequencies: 0.002851
330500 -- (-995.253) [-994.785] (-1004.194) (-993.861) * (-991.702) (-995.986) [-999.335] (-994.160) -- 0:02:07
331000 -- (-993.108) (-1001.831) [-995.647] (-996.626) * (-994.570) [-993.680] (-998.886) (-992.735) -- 0:02:07
331500 -- [-994.846] (-994.230) (-988.004) (-999.431) * [-996.675] (-995.641) (-995.859) (-992.808) -- 0:02:07
332000 -- (-995.456) (-995.839) [-991.542] (-994.801) * (-990.034) (-993.251) [-993.843] (-993.648) -- 0:02:06
332500 -- (-997.821) (-1009.201) (-992.676) [-993.583] * [-994.771] (-996.671) (-993.887) (-994.168) -- 0:02:06
333000 -- [-992.841] (-1003.961) (-990.991) (-992.680) * (-1001.142) (-999.752) (-998.978) [-994.604] -- 0:02:08
333500 -- (-996.799) (-1000.816) [-995.172] (-993.278) * [-998.164] (-997.632) (-1001.070) (-992.667) -- 0:02:07
334000 -- (-1000.803) (-1002.261) [-997.270] (-996.367) * (-997.770) [-995.582] (-997.066) (-994.924) -- 0:02:07
334500 -- (-1007.371) (-1003.396) [-993.100] (-995.750) * (-994.184) [-990.158] (-997.342) (-997.062) -- 0:02:07
335000 -- (-999.043) [-994.359] (-996.575) (-996.145) * (-994.354) [-993.955] (-994.751) (-996.884) -- 0:02:07
Average standard deviation of split frequencies: 0.003507
335500 -- (-1006.621) [-992.286] (-1002.999) (-996.147) * (-999.591) [-992.541] (-992.352) (-995.927) -- 0:02:06
336000 -- [-1002.023] (-1002.075) (-1002.458) (-992.748) * (-994.819) (-994.989) (-993.638) [-992.584] -- 0:02:06
336500 -- (-1001.617) (-998.470) (-1016.385) [-995.185] * (-1001.623) (-994.558) (-996.208) [-994.832] -- 0:02:06
337000 -- [-997.227] (-1015.769) (-1005.554) (-997.874) * (-1000.095) (-994.943) [-998.655] (-1002.476) -- 0:02:05
337500 -- (-999.758) (-993.112) (-998.468) [-992.695] * [-992.144] (-998.192) (-996.211) (-992.952) -- 0:02:05
338000 -- (-1004.562) [-994.241] (-993.428) (-1000.955) * (-995.956) [-990.124] (-1005.302) (-996.454) -- 0:02:05
338500 -- (-1000.837) (-998.461) [-992.638] (-994.780) * (-996.045) (-996.898) [-997.855] (-997.770) -- 0:02:07
339000 -- (-1001.037) (-1003.147) [-992.007] (-993.217) * (-995.224) [-994.828] (-997.977) (-995.085) -- 0:02:06
339500 -- (-995.861) (-999.110) (-995.066) [-995.732] * (-996.464) (-993.537) [-998.869] (-994.553) -- 0:02:06
340000 -- (-1002.794) (-1001.688) [-993.584] (-999.358) * (-997.421) (-996.501) (-998.554) [-998.322] -- 0:02:06
Average standard deviation of split frequencies: 0.002768
340500 -- (-993.620) (-998.578) [-992.696] (-997.521) * (-997.033) [-993.838] (-990.189) (-1001.449) -- 0:02:05
341000 -- (-989.048) [-999.126] (-1000.732) (-998.796) * (-996.917) (-996.443) (-996.600) [-997.116] -- 0:02:05
341500 -- (-1001.343) (-1006.027) (-996.454) [-995.158] * [-1000.972] (-993.939) (-994.600) (-1003.832) -- 0:02:05
342000 -- [-993.969] (-999.696) (-997.383) (-992.673) * (-995.470) [-992.170] (-998.042) (-1005.755) -- 0:02:05
342500 -- (-994.554) (-998.184) (-994.838) [-991.632] * (-997.986) (-992.612) (-999.537) [-996.291] -- 0:02:04
343000 -- (-996.048) (-1000.055) (-998.958) [-993.636] * (-1004.089) [-996.343] (-999.677) (-996.059) -- 0:02:04
343500 -- (-993.381) (-1002.984) [-994.387] (-993.773) * (-998.580) (-993.444) [-1000.729] (-999.581) -- 0:02:04
344000 -- (-995.059) (-995.852) [-992.847] (-994.013) * (-1004.394) (-995.347) (-1006.240) [-1001.193] -- 0:02:05
344500 -- (-1000.482) (-992.256) (-999.700) [-997.875] * (-996.935) [-992.820] (-1001.925) (-995.362) -- 0:02:05
345000 -- (-998.957) (-995.972) (-997.514) [-994.646] * (-999.862) (-994.272) (-996.577) [-998.324] -- 0:02:05
Average standard deviation of split frequencies: 0.002725
345500 -- (-995.387) (-993.926) (-1001.014) [-992.192] * (-999.181) [-991.310] (-994.147) (-995.177) -- 0:02:05
346000 -- (-999.304) (-996.074) (-995.801) [-994.542] * (-999.917) (-999.653) (-996.493) [-997.348] -- 0:02:04
346500 -- (-1002.005) (-991.986) (-996.943) [-999.118] * (-1004.562) [-990.415] (-997.434) (-999.425) -- 0:02:04
347000 -- [-993.745] (-995.686) (-1008.028) (-1003.945) * (-1004.142) (-994.379) (-997.911) [-1001.809] -- 0:02:04
347500 -- (-998.268) (-994.914) (-996.778) [-995.728] * [-996.618] (-990.872) (-998.248) (-998.914) -- 0:02:03
348000 -- (-997.804) (-991.613) [-995.786] (-994.658) * (-994.329) (-991.229) (-1004.180) [-997.582] -- 0:02:05
348500 -- (-996.960) (-993.341) [-1003.444] (-996.618) * (-992.292) [-994.599] (-991.321) (-998.998) -- 0:02:05
349000 -- (-997.863) [-993.097] (-995.903) (-1002.313) * [-990.124] (-998.715) (-997.450) (-996.473) -- 0:02:04
349500 -- [-995.129] (-988.841) (-991.953) (-1006.277) * [-990.581] (-993.149) (-994.734) (-992.715) -- 0:02:04
350000 -- (-1003.614) [-995.640] (-994.406) (-999.353) * (-996.471) (-997.288) [-995.805] (-993.214) -- 0:02:04
Average standard deviation of split frequencies: 0.002016
350500 -- (-991.145) (-992.206) (-990.853) [-998.538] * (-990.936) (-998.994) [-996.421] (-989.967) -- 0:02:04
351000 -- [-991.252] (-991.609) (-998.659) (-998.896) * (-991.242) [-999.528] (-990.748) (-997.453) -- 0:02:03
351500 -- [-991.150] (-992.471) (-992.274) (-995.084) * (-994.433) [-994.971] (-993.890) (-993.497) -- 0:02:03
352000 -- (-993.798) [-999.524] (-993.728) (-994.776) * (-993.116) (-996.708) (-998.588) [-990.278] -- 0:02:03
352500 -- (-993.801) (-994.745) (-992.321) [-996.444] * (-993.330) (-995.610) (-996.807) [-998.950] -- 0:02:03
353000 -- [-991.798] (-999.374) (-993.436) (-996.196) * [-996.010] (-991.521) (-996.655) (-998.338) -- 0:02:04
353500 -- (-993.953) [-994.834] (-997.808) (-995.964) * [-999.369] (-993.846) (-995.099) (-998.995) -- 0:02:04
354000 -- (-995.074) (-993.556) [-994.901] (-992.440) * (-1002.678) [-994.558] (-992.177) (-994.375) -- 0:02:04
354500 -- (-1000.267) (-996.678) (-994.227) [-993.297] * (-994.446) (-995.161) (-1002.472) [-990.423] -- 0:02:03
355000 -- [-994.669] (-997.833) (-995.566) (-992.494) * (-992.175) (-999.144) [-990.152] (-994.611) -- 0:02:03
Average standard deviation of split frequencies: 0.003310
355500 -- [-993.375] (-993.383) (-993.859) (-987.810) * (-993.167) (-995.687) (-993.706) [-991.399] -- 0:02:03
356000 -- (-996.214) (-1000.570) [-990.727] (-992.283) * (-998.525) (-997.823) [-995.093] (-993.830) -- 0:02:03
356500 -- (-994.738) (-1000.489) [-991.189] (-995.823) * (-995.815) [-992.454] (-992.281) (-999.234) -- 0:02:02
357000 -- (-989.791) (-1008.438) [-992.003] (-995.284) * (-995.126) (-996.446) (-996.112) [-992.438] -- 0:02:02
357500 -- (-996.944) (-998.673) [-989.493] (-995.691) * [-992.849] (-995.003) (-1000.688) (-999.536) -- 0:02:02
358000 -- (-998.736) (-1002.444) (-989.668) [-992.023] * (-999.701) [-999.380] (-994.158) (-995.719) -- 0:02:03
358500 -- [-991.939] (-996.979) (-997.262) (-991.302) * (-993.468) (-992.457) (-1003.160) [-992.044] -- 0:02:03
359000 -- (-989.955) (-991.463) [-994.031] (-992.028) * [-994.291] (-991.622) (-994.887) (-996.018) -- 0:02:03
359500 -- [-994.502] (-992.943) (-997.123) (-993.117) * [-1002.014] (-994.192) (-1006.300) (-993.214) -- 0:02:02
360000 -- (-993.098) (-993.348) [-993.458] (-995.038) * [-995.008] (-993.730) (-1000.129) (-994.497) -- 0:02:02
Average standard deviation of split frequencies: 0.003268
360500 -- (-992.170) [-995.368] (-991.842) (-1002.241) * (-997.422) (-994.657) (-996.801) [-998.476] -- 0:02:02
361000 -- (-994.427) [-996.437] (-992.946) (-997.736) * (-998.613) (-993.893) [-992.086] (-997.512) -- 0:02:02
361500 -- (-994.837) [-999.352] (-996.081) (-999.276) * [-999.564] (-992.468) (-993.628) (-1000.186) -- 0:02:01
362000 -- (-995.280) [-994.975] (-1002.667) (-1000.002) * (-1000.100) (-997.704) (-994.826) [-997.195] -- 0:02:03
362500 -- (-992.427) [-992.482] (-1000.282) (-990.519) * (-992.897) (-996.706) (-993.861) [-993.374] -- 0:02:03
363000 -- (-989.785) (-992.571) (-1005.314) [-994.988] * [-992.767] (-992.977) (-994.798) (-993.023) -- 0:02:02
363500 -- (-995.823) (-988.224) (-999.635) [-988.355] * (-999.277) (-994.763) [-993.888] (-998.395) -- 0:02:02
364000 -- [-994.659] (-991.856) (-996.896) (-991.254) * (-991.785) [-989.853] (-996.118) (-990.894) -- 0:02:02
364500 -- (-995.720) [-992.406] (-994.343) (-992.810) * (-991.474) [-992.159] (-993.622) (-996.589) -- 0:02:02
365000 -- (-995.217) [-991.704] (-1000.298) (-993.990) * (-993.807) (-995.339) [-991.617] (-993.067) -- 0:02:01
Average standard deviation of split frequencies: 0.003864
365500 -- (-992.104) (-995.245) (-1002.970) [-992.536] * (-998.877) [-995.831] (-994.224) (-1000.692) -- 0:02:01
366000 -- (-1001.523) (-997.518) (-1000.914) [-993.339] * (-996.095) [-995.988] (-997.615) (-1005.557) -- 0:02:01
366500 -- (-1001.059) [-992.952] (-995.358) (-990.451) * [-993.912] (-996.362) (-992.940) (-998.884) -- 0:02:00
367000 -- (-997.328) (-998.279) (-1005.864) [-996.457] * (-995.866) (-1002.773) (-994.608) [-997.870] -- 0:02:02
367500 -- (-997.818) (-993.257) [-994.851] (-993.272) * (-997.126) [-991.239] (-994.228) (-995.652) -- 0:02:02
368000 -- (-996.084) (-992.666) [-990.241] (-992.511) * (-995.194) (-996.978) (-994.099) [-992.987] -- 0:02:01
368500 -- (-1000.924) [-994.898] (-993.589) (-990.640) * (-992.009) (-1000.811) [-992.512] (-997.343) -- 0:02:01
369000 -- (-995.427) (-993.917) (-997.299) [-991.135] * (-992.587) [-995.253] (-993.530) (-995.073) -- 0:02:01
369500 -- [-996.340] (-992.566) (-991.407) (-992.205) * (-992.626) (-992.112) [-994.978] (-994.942) -- 0:02:01
370000 -- [-992.006] (-992.563) (-996.684) (-995.512) * (-998.674) (-1000.308) (-992.389) [-990.599] -- 0:02:00
Average standard deviation of split frequencies: 0.003179
370500 -- [-996.003] (-995.786) (-994.644) (-997.578) * (-995.724) (-993.110) (-1008.960) [-992.466] -- 0:02:00
371000 -- [-994.274] (-999.682) (-994.587) (-997.932) * (-996.349) [-995.220] (-1001.189) (-994.359) -- 0:02:00
371500 -- (-992.650) (-992.335) [-997.924] (-999.811) * (-990.607) [-993.528] (-996.895) (-996.806) -- 0:02:00
372000 -- (-991.520) (-990.242) [-995.387] (-999.996) * (-991.009) [-995.245] (-991.738) (-1001.559) -- 0:01:59
372500 -- (-990.025) [-990.907] (-994.571) (-997.438) * (-992.884) (-993.966) [-992.469] (-998.729) -- 0:02:01
373000 -- (-993.103) (-992.107) (-996.115) [-996.004] * (-996.211) (-995.796) (-993.659) [-991.165] -- 0:02:01
373500 -- [-990.323] (-989.572) (-995.509) (-997.513) * (-995.812) [-994.954] (-997.167) (-997.179) -- 0:02:00
374000 -- [-991.876] (-995.380) (-997.468) (-998.258) * (-995.043) [-997.421] (-994.658) (-999.217) -- 0:02:00
374500 -- (-993.087) [-991.713] (-997.911) (-994.741) * [-991.986] (-997.052) (-999.618) (-997.297) -- 0:02:00
375000 -- (-1001.790) [-994.202] (-993.170) (-997.166) * (-995.567) (-991.964) (-992.398) [-995.776] -- 0:02:00
Average standard deviation of split frequencies: 0.001881
375500 -- (-991.816) (-988.912) [-993.848] (-994.322) * [-996.815] (-996.658) (-997.892) (-996.558) -- 0:01:59
376000 -- [-997.899] (-991.139) (-999.145) (-996.574) * [-998.475] (-995.461) (-991.561) (-996.731) -- 0:01:59
376500 -- (-998.823) [-992.615] (-990.015) (-993.903) * (-993.173) [-994.874] (-992.094) (-995.838) -- 0:01:59
377000 -- [-1002.500] (-993.348) (-997.366) (-1003.144) * [-992.023] (-993.868) (-994.024) (-1006.124) -- 0:01:58
377500 -- (-1001.172) (-994.843) [-991.517] (-995.351) * [-993.711] (-995.774) (-993.862) (-1004.910) -- 0:02:00
378000 -- [-998.897] (-992.931) (-996.950) (-998.385) * [-1001.586] (-995.917) (-999.406) (-993.020) -- 0:02:00
378500 -- (-992.988) (-996.368) [-991.318] (-992.631) * (-990.487) (-999.123) (-998.315) [-992.639] -- 0:01:59
379000 -- (-991.431) [-995.164] (-991.446) (-996.382) * [-991.984] (-992.318) (-997.857) (-998.982) -- 0:01:59
379500 -- (-998.464) [-997.197] (-997.146) (-998.761) * (-994.352) (-997.363) (-994.437) [-993.561] -- 0:01:59
380000 -- [-990.480] (-1001.993) (-996.564) (-994.057) * (-997.469) (-996.486) (-996.386) [-994.569] -- 0:01:59
Average standard deviation of split frequencies: 0.002477
380500 -- (-991.107) (-997.843) (-996.776) [-991.901] * [-990.139] (-998.947) (-999.487) (-1000.940) -- 0:01:58
381000 -- (-996.448) (-999.994) (-1001.148) [-992.843] * [-996.303] (-995.584) (-993.612) (-995.176) -- 0:01:58
381500 -- (-994.015) (-1008.251) (-993.336) [-994.840] * (-999.509) (-998.974) (-995.073) [-993.064] -- 0:01:58
382000 -- (-996.015) [-996.052] (-1000.686) (-995.602) * (-997.481) (-991.480) [-989.410] (-992.836) -- 0:01:58
382500 -- (-996.944) [-992.881] (-995.056) (-993.286) * (-993.922) (-995.368) (-996.073) [-991.461] -- 0:01:57
383000 -- (-1001.593) (-992.309) [-991.207] (-992.964) * (-1004.299) (-997.320) [-993.584] (-999.992) -- 0:01:59
383500 -- (-1003.892) (-993.920) (-997.079) [-992.247] * (-1000.125) (-996.412) [-992.546] (-993.157) -- 0:01:58
384000 -- (-999.954) (-998.280) [-995.128] (-995.846) * [-999.918] (-990.846) (-994.127) (-994.596) -- 0:01:58
384500 -- [-990.675] (-1000.303) (-989.789) (-996.360) * (-999.440) [-992.708] (-994.391) (-998.341) -- 0:01:58
385000 -- (-992.354) (-992.100) (-994.588) [-994.941] * [-995.465] (-995.588) (-995.811) (-994.777) -- 0:01:58
Average standard deviation of split frequencies: 0.001832
385500 -- (-997.440) (-991.130) (-997.030) [-1000.605] * (-991.466) [-993.983] (-997.622) (-994.188) -- 0:01:57
386000 -- (-994.996) (-990.533) [-991.817] (-998.352) * (-993.689) (-994.971) [-996.856] (-993.929) -- 0:01:57
386500 -- (-993.044) (-1006.141) [-994.925] (-994.411) * (-993.174) (-1004.524) (-992.889) [-991.550] -- 0:01:57
387000 -- [-991.776] (-996.931) (-996.115) (-992.001) * (-999.812) (-996.457) (-994.757) [-995.507] -- 0:01:58
387500 -- (-994.513) (-994.898) (-993.299) [-996.774] * (-997.121) (-997.658) [-996.196] (-993.662) -- 0:01:58
388000 -- (-992.228) (-999.365) [-995.617] (-992.741) * (-996.909) (-995.658) (-988.649) [-994.164] -- 0:01:58
388500 -- (-995.888) [-991.220] (-996.494) (-991.900) * (-992.380) (-996.422) [-991.777] (-998.375) -- 0:01:58
389000 -- (-997.631) (-991.049) (-997.725) [-1000.107] * (-1000.513) (-995.965) (-990.644) [-995.160] -- 0:01:57
389500 -- (-991.745) [-991.148] (-993.541) (-993.642) * (-1001.336) [-994.963] (-993.217) (-996.846) -- 0:01:57
390000 -- (-998.187) (-992.382) [-992.844] (-1001.045) * (-999.066) (-996.860) [-992.085] (-992.599) -- 0:01:57
Average standard deviation of split frequencies: 0.001810
390500 -- [-1002.238] (-990.509) (-992.687) (-994.803) * (-999.065) (-997.532) (-996.499) [-994.558] -- 0:01:57
391000 -- (-997.412) [-993.699] (-993.155) (-991.831) * (-995.002) (-994.623) [-997.080] (-996.716) -- 0:01:56
391500 -- (-993.907) [-996.798] (-996.541) (-991.426) * (-1000.621) (-993.534) [-994.297] (-1002.940) -- 0:01:58
392000 -- [-994.305] (-997.136) (-994.555) (-1002.636) * [-993.142] (-996.728) (-992.920) (-1000.266) -- 0:01:57
392500 -- (-996.103) [-990.087] (-998.137) (-994.622) * (-1000.800) (-994.910) [-996.326] (-992.982) -- 0:01:57
393000 -- (-996.317) (-997.201) (-1001.994) [-995.041] * (-995.870) [-995.085] (-1002.448) (-991.159) -- 0:01:57
393500 -- (-999.284) (-990.672) (-1003.194) [-993.295] * (-995.943) (-995.220) (-996.521) [-992.446] -- 0:01:57
394000 -- (-999.285) (-998.065) (-996.420) [-990.256] * [-996.203] (-995.277) (-992.397) (-996.090) -- 0:01:56
394500 -- (-995.961) (-996.353) (-1001.061) [-993.617] * (-992.547) (-1005.369) [-993.569] (-1000.486) -- 0:01:56
395000 -- (-995.446) [-994.359] (-998.254) (-993.687) * (-995.248) (-997.987) [-997.974] (-994.080) -- 0:01:56
Average standard deviation of split frequencies: 0.001786
395500 -- (-999.072) (-996.667) [-993.928] (-993.048) * [-996.125] (-995.528) (-994.150) (-995.134) -- 0:01:56
396000 -- (-992.327) (-998.088) [-996.286] (-989.965) * (-994.879) (-992.940) (-998.560) [-1000.393] -- 0:01:55
396500 -- (-998.526) (-990.209) [-993.064] (-1000.239) * (-998.250) [-994.206] (-999.619) (-996.313) -- 0:01:55
397000 -- (-991.642) [-994.771] (-994.774) (-996.646) * (-1000.257) [-996.286] (-996.928) (-994.035) -- 0:01:56
397500 -- (-996.964) (-1000.985) (-996.370) [-996.510] * (-996.568) [-993.672] (-994.477) (-994.252) -- 0:01:56
398000 -- [-998.061] (-997.632) (-1006.572) (-991.302) * (-996.589) (-999.318) (-999.452) [-991.031] -- 0:01:56
398500 -- [-998.238] (-993.765) (-1003.151) (-992.686) * [-996.223] (-997.778) (-1002.570) (-1000.548) -- 0:01:56
399000 -- (-995.897) (-994.148) [-991.083] (-995.034) * [-1000.992] (-994.377) (-994.930) (-996.368) -- 0:01:55
399500 -- (-994.877) [-996.328] (-995.406) (-990.860) * (-996.317) (-994.129) [-995.345] (-1004.138) -- 0:01:55
400000 -- [-996.592] (-1001.722) (-995.118) (-1000.122) * (-992.406) [-995.085] (-999.051) (-1001.144) -- 0:01:55
Average standard deviation of split frequencies: 0.001765
400500 -- [-992.080] (-995.183) (-994.439) (-1000.714) * [-995.319] (-996.568) (-993.287) (-998.539) -- 0:01:55
401000 -- (-990.974) (-995.415) (-992.780) [-993.873] * (-994.691) [-998.139] (-995.420) (-1000.247) -- 0:01:55
401500 -- (-993.312) (-996.481) (-1001.223) [-990.956] * [-992.996] (-995.260) (-993.526) (-1001.022) -- 0:01:54
402000 -- (-992.645) (-1001.799) (-999.436) [-993.972] * [-995.175] (-991.472) (-992.327) (-995.984) -- 0:01:54
402500 -- [-998.059] (-993.317) (-993.776) (-996.825) * (-992.636) (-1001.194) (-991.404) [-991.719] -- 0:01:55
403000 -- (-990.899) [-988.610] (-991.182) (-995.293) * (-994.142) (-993.874) [-991.185] (-995.209) -- 0:01:55
403500 -- [-989.799] (-994.549) (-993.509) (-996.067) * [-992.279] (-994.161) (-990.655) (-992.648) -- 0:01:55
404000 -- (-1000.166) [-994.322] (-990.617) (-994.625) * (-994.566) (-990.325) [-995.570] (-995.534) -- 0:01:55
404500 -- (-998.741) [-993.708] (-994.273) (-995.898) * (-991.542) (-991.805) (-997.151) [-993.366] -- 0:01:54
405000 -- (-991.638) [-992.230] (-990.971) (-994.756) * [-993.652] (-992.381) (-992.370) (-994.616) -- 0:01:54
Average standard deviation of split frequencies: 0.001742
405500 -- (-998.836) (-995.807) [-990.135] (-993.180) * (-996.272) [-993.359] (-992.912) (-1001.079) -- 0:01:54
406000 -- [-994.276] (-999.304) (-995.832) (-1004.997) * [-992.901] (-998.368) (-997.092) (-1003.481) -- 0:01:54
406500 -- (-992.198) (-990.110) [-1000.921] (-998.297) * (-993.856) [-990.404] (-995.104) (-998.510) -- 0:01:53
407000 -- [-992.100] (-996.033) (-995.672) (-994.597) * (-997.811) [-996.991] (-998.403) (-994.109) -- 0:01:53
407500 -- (-997.487) [-992.799] (-995.103) (-998.483) * (-993.298) (-999.734) (-998.235) [-993.485] -- 0:01:54
408000 -- (-997.274) (-992.475) [-993.992] (-995.213) * (-999.042) [-994.318] (-998.095) (-994.264) -- 0:01:54
408500 -- (-997.880) (-1000.566) (-994.329) [-1003.525] * (-997.466) (-995.362) [-992.701] (-991.939) -- 0:01:54
409000 -- (-994.004) (-993.254) [-991.844] (-998.727) * [-996.996] (-997.774) (-990.737) (-990.801) -- 0:01:54
409500 -- (-999.884) (-996.021) [-989.507] (-993.810) * (-996.160) [-995.175] (-993.149) (-997.009) -- 0:01:53
410000 -- (-1000.206) (-989.990) (-992.414) [-997.435] * [-994.712] (-997.492) (-1000.983) (-993.623) -- 0:01:53
Average standard deviation of split frequencies: 0.002870
410500 -- (-998.022) (-997.858) (-991.820) [-1000.121] * [-997.794] (-1000.625) (-994.581) (-996.384) -- 0:01:53
411000 -- (-996.120) [-992.980] (-991.408) (-993.932) * (-995.938) (-1004.643) (-998.494) [-990.145] -- 0:01:53
411500 -- (-994.419) [-994.925] (-994.372) (-998.001) * (-996.397) [-996.223] (-993.849) (-1001.831) -- 0:01:52
412000 -- (-996.891) (-990.091) [-993.318] (-997.700) * [-994.249] (-1002.447) (-994.860) (-998.701) -- 0:01:52
412500 -- (-1004.464) (-996.882) (-995.150) [-993.570] * (-998.381) (-992.988) [-992.252] (-1001.417) -- 0:01:52
413000 -- (-995.133) [-991.839] (-995.628) (-994.434) * [-996.277] (-997.567) (-995.325) (-999.047) -- 0:01:53
413500 -- (-994.171) (-997.297) (-992.408) [-992.994] * (-1001.950) [-992.101] (-995.205) (-1000.445) -- 0:01:53
414000 -- (-995.372) (-1004.508) (-991.460) [-991.888] * (-998.797) [-993.152] (-996.319) (-994.417) -- 0:01:53
414500 -- (-990.048) (-1000.197) [-1001.620] (-996.730) * (-1008.752) (-998.481) (-994.775) [-997.846] -- 0:01:53
415000 -- (-999.166) [-996.576] (-993.070) (-994.059) * (-999.818) [-991.821] (-996.496) (-1003.406) -- 0:01:52
Average standard deviation of split frequencies: 0.002833
415500 -- (-989.784) [-999.349] (-996.181) (-994.559) * (-993.918) [-994.893] (-997.531) (-1000.179) -- 0:01:52
416000 -- (-998.770) (-997.961) (-992.777) [-999.190] * (-995.557) [-996.041] (-997.065) (-997.508) -- 0:01:52
416500 -- (-995.404) [-1001.501] (-998.193) (-994.687) * (-1001.384) (-996.518) [-994.425] (-996.883) -- 0:01:52
417000 -- (-1003.078) (-1004.106) [-997.743] (-998.937) * (-1003.674) (-994.100) [-993.872] (-1001.897) -- 0:01:51
417500 -- (-1001.148) (-1002.337) [-992.806] (-1000.111) * (-998.514) [-995.718] (-998.528) (-998.097) -- 0:01:51
418000 -- (-994.157) (-1000.436) (-1000.097) [-995.923] * (-1000.644) [-990.144] (-994.174) (-996.208) -- 0:01:52
418500 -- (-992.349) [-1004.008] (-994.340) (-994.346) * (-999.818) [-994.619] (-995.172) (-997.967) -- 0:01:52
419000 -- (-998.283) [-1001.852] (-996.729) (-994.075) * (-998.444) [-998.390] (-993.449) (-995.269) -- 0:01:52
419500 -- [-994.864] (-996.870) (-994.001) (-999.335) * [-998.934] (-1000.237) (-996.208) (-997.137) -- 0:01:52
420000 -- (-991.706) [-990.913] (-990.510) (-1001.342) * (-995.057) [-993.395] (-1002.934) (-997.231) -- 0:01:51
Average standard deviation of split frequencies: 0.003362
420500 -- (-995.038) (-993.389) (-995.407) [-995.067] * (-993.822) [-990.563] (-991.948) (-997.102) -- 0:01:51
421000 -- (-994.496) (-992.969) [-996.185] (-996.795) * (-989.367) [-998.228] (-994.601) (-996.220) -- 0:01:51
421500 -- (-998.764) (-995.349) (-992.326) [-994.925] * (-990.491) (-992.062) [-992.257] (-1000.057) -- 0:01:51
422000 -- (-996.722) (-991.919) [-998.238] (-1001.471) * (-993.711) [-989.543] (-996.592) (-997.721) -- 0:01:50
422500 -- [-991.891] (-994.751) (-993.312) (-1003.449) * [-996.580] (-996.277) (-999.167) (-995.266) -- 0:01:50
423000 -- [-993.790] (-1001.131) (-993.357) (-999.956) * (-993.807) (-1000.038) [-997.507] (-997.199) -- 0:01:50
423500 -- (-995.156) (-997.713) [-997.433] (-1005.152) * [-991.768] (-994.842) (-1001.577) (-996.413) -- 0:01:51
424000 -- [-992.799] (-995.179) (-991.196) (-1003.258) * (-993.298) [-995.934] (-998.317) (-993.762) -- 0:01:51
424500 -- (-996.882) [-993.656] (-995.853) (-1001.017) * [-995.639] (-991.827) (-997.782) (-993.061) -- 0:01:51
425000 -- (-990.866) (-993.191) [-996.359] (-998.674) * (-996.038) [-994.764] (-992.265) (-993.168) -- 0:01:50
Average standard deviation of split frequencies: 0.004426
425500 -- (-993.364) (-994.849) (-992.345) [-999.405] * (-995.880) [-995.153] (-991.055) (-994.180) -- 0:01:50
426000 -- (-996.144) (-992.395) (-991.297) [-998.144] * (-1001.999) (-991.279) [-991.524] (-995.391) -- 0:01:50
426500 -- (-996.734) (-997.401) [-993.976] (-999.348) * (-998.543) (-994.339) [-993.496] (-999.625) -- 0:01:50
427000 -- (-997.576) (-996.444) (-995.427) [-996.238] * (-1007.864) [-989.005] (-998.414) (-996.781) -- 0:01:50
427500 -- [-990.795] (-998.551) (-994.209) (-998.339) * (-999.130) (-994.898) (-998.011) [-993.444] -- 0:01:49
428000 -- (-990.871) (-996.212) (-995.662) [-992.743] * [-993.210] (-1000.169) (-1001.804) (-993.224) -- 0:01:49
428500 -- (-992.926) (-998.134) [-993.309] (-996.217) * (-1000.568) [-996.265] (-998.468) (-991.282) -- 0:01:49
429000 -- [-990.019] (-996.561) (-992.163) (-992.418) * [-992.432] (-1002.323) (-994.355) (-992.057) -- 0:01:50
429500 -- [-992.944] (-997.419) (-996.644) (-997.782) * (-992.322) [-997.484] (-993.777) (-990.148) -- 0:01:50
430000 -- [-999.679] (-994.370) (-994.065) (-997.689) * (-995.142) (-1001.381) (-999.435) [-994.565] -- 0:01:50
Average standard deviation of split frequencies: 0.003831
430500 -- [-996.957] (-1002.368) (-996.528) (-995.567) * (-995.757) (-1004.618) [-993.036] (-994.312) -- 0:01:49
431000 -- (-996.187) [-996.762] (-992.409) (-991.575) * (-996.772) (-997.513) (-995.148) [-998.778] -- 0:01:49
431500 -- [-995.796] (-992.305) (-991.980) (-999.919) * [-993.487] (-1002.830) (-994.974) (-996.225) -- 0:01:49
432000 -- [-998.016] (-1000.428) (-993.733) (-997.429) * (-995.594) (-995.238) [-994.014] (-991.569) -- 0:01:49
432500 -- (-997.886) [-991.403] (-993.896) (-997.125) * (-993.444) (-992.386) [-993.041] (-993.044) -- 0:01:48
433000 -- (-992.316) (-990.937) [-992.206] (-993.589) * (-993.568) (-994.669) [-997.579] (-1000.605) -- 0:01:48
433500 -- (-1004.273) (-993.534) [-1000.729] (-1000.946) * (-999.479) [-996.685] (-994.302) (-996.751) -- 0:01:48
434000 -- (-995.360) (-993.419) (-993.151) [-994.348] * (-999.726) [-999.092] (-1000.526) (-999.931) -- 0:01:49
434500 -- [-998.550] (-997.618) (-990.957) (-994.463) * (-1004.290) (-997.375) (-997.013) [-991.502] -- 0:01:49
435000 -- (-991.571) [-995.405] (-995.750) (-992.592) * (-1001.939) [-992.048] (-999.119) (-993.610) -- 0:01:49
Average standard deviation of split frequencies: 0.003784
435500 -- (-999.496) (-999.090) (-995.657) [-995.397] * (-998.092) (-996.360) (-1000.413) [-997.798] -- 0:01:48
436000 -- (-992.974) (-998.920) (-999.667) [-992.815] * (-997.552) (-993.886) [-998.465] (-996.721) -- 0:01:48
436500 -- (-991.715) (-999.242) [-996.808] (-992.245) * (-995.412) (-999.051) [-1002.923] (-999.053) -- 0:01:48
437000 -- (-992.763) [-998.304] (-999.432) (-992.527) * (-995.081) [-1000.982] (-1000.652) (-996.716) -- 0:01:48
437500 -- (-997.109) [-993.567] (-998.830) (-998.726) * (-994.858) (-996.239) (-997.746) [-994.242] -- 0:01:48
438000 -- [-993.526] (-1001.130) (-1003.934) (-997.829) * (-992.617) (-996.293) (-999.190) [-994.219] -- 0:01:47
438500 -- (-994.369) (-992.281) (-994.841) [-995.993] * (-996.569) (-995.844) (-994.108) [-992.893] -- 0:01:47
439000 -- (-1004.489) (-996.658) (-998.745) [-994.190] * (-995.421) [-999.197] (-1000.075) (-994.335) -- 0:01:47
439500 -- (-1000.276) (-996.236) [-998.803] (-998.609) * (-997.989) [-998.212] (-994.175) (-994.760) -- 0:01:48
440000 -- [-993.220] (-992.224) (-990.100) (-998.397) * (-999.343) [-994.405] (-995.964) (-991.322) -- 0:01:48
Average standard deviation of split frequencies: 0.003744
440500 -- (-994.094) [-995.333] (-994.148) (-999.051) * (-997.541) (-994.419) (-1003.646) [-990.549] -- 0:01:47
441000 -- (-993.594) (-1001.513) (-996.607) [-993.955] * (-999.132) (-997.067) [-998.799] (-994.129) -- 0:01:47
441500 -- (-1000.309) [-993.786] (-991.848) (-993.370) * (-999.428) (-1006.165) [-995.963] (-996.715) -- 0:01:47
442000 -- (-999.418) [-999.233] (-995.451) (-1000.690) * [-1000.673] (-996.769) (-994.908) (-994.112) -- 0:01:47
442500 -- (-998.498) [-990.989] (-998.372) (-1004.350) * (-997.494) (-993.904) [-993.500] (-995.717) -- 0:01:47
443000 -- [-992.382] (-992.497) (-993.707) (-994.563) * (-1002.519) (-995.826) (-995.758) [-993.133] -- 0:01:46
443500 -- [-993.417] (-993.910) (-996.352) (-991.918) * (-996.785) (-997.385) [-992.482] (-993.039) -- 0:01:46
444000 -- [-998.326] (-997.824) (-989.481) (-1002.050) * (-996.304) (-993.804) (-995.506) [-1001.986] -- 0:01:46
444500 -- [-998.537] (-991.034) (-994.021) (-1002.331) * (-1001.753) (-994.659) [-988.281] (-997.361) -- 0:01:47
445000 -- (-996.146) (-991.409) [-994.323] (-1010.523) * [-996.935] (-1003.396) (-991.367) (-998.740) -- 0:01:47
Average standard deviation of split frequencies: 0.003699
445500 -- (-992.318) [-993.502] (-997.164) (-1002.617) * [-993.538] (-998.428) (-991.638) (-1002.590) -- 0:01:47
446000 -- (-996.016) (-997.147) (-994.787) [-992.184] * (-992.445) [-995.249] (-997.691) (-997.687) -- 0:01:46
446500 -- [-1000.318] (-992.171) (-993.345) (-995.007) * (-990.055) [-995.149] (-991.899) (-999.234) -- 0:01:46
447000 -- (-1000.486) (-995.070) [-993.428] (-995.863) * (-991.484) (-1011.916) [-990.866] (-1004.534) -- 0:01:46
447500 -- (-994.457) [-992.923] (-994.669) (-1003.512) * (-992.117) (-1002.661) [-996.542] (-1004.006) -- 0:01:46
448000 -- [-993.781] (-998.055) (-994.221) (-993.344) * (-994.879) [-994.574] (-997.562) (-1000.219) -- 0:01:45
448500 -- (-1002.278) [-992.472] (-991.221) (-994.027) * [-990.909] (-994.531) (-996.615) (-999.379) -- 0:01:45
449000 -- [-996.018] (-991.409) (-995.608) (-993.087) * [-993.823] (-999.089) (-992.585) (-1002.203) -- 0:01:45
449500 -- (-994.754) (-994.623) (-997.350) [-994.861] * (-992.580) (-1001.997) [-991.549] (-1003.525) -- 0:01:45
450000 -- [-996.678] (-995.246) (-992.455) (-992.916) * [-994.945] (-997.347) (-993.111) (-1003.411) -- 0:01:46
Average standard deviation of split frequencies: 0.003138
450500 -- (-993.717) (-997.191) (-993.354) [-993.641] * (-993.312) [-997.612] (-993.229) (-997.317) -- 0:01:46
451000 -- (-999.914) [-999.133] (-990.821) (-993.595) * (-993.961) (-999.230) [-995.560] (-1000.828) -- 0:01:45
451500 -- (-993.439) (-996.633) (-993.283) [-996.049] * (-995.514) (-1001.539) (-994.971) [-992.257] -- 0:01:45
452000 -- (-999.402) (-997.106) (-994.348) [-992.436] * (-993.501) (-1000.806) (-998.394) [-993.516] -- 0:01:45
452500 -- [-1002.063] (-990.888) (-992.616) (-1001.951) * (-995.181) (-995.818) [-994.707] (-995.307) -- 0:01:45
453000 -- (-1002.873) (-992.261) [-992.992] (-995.150) * (-996.617) [-993.546] (-999.854) (-993.246) -- 0:01:45
453500 -- (-996.845) (-992.223) [-994.619] (-1000.306) * (-1000.505) (-993.853) (-1002.643) [-997.191] -- 0:01:44
454000 -- (-990.316) (-1001.070) [-1001.529] (-999.738) * (-1005.492) (-1007.011) (-997.592) [-998.984] -- 0:01:44
454500 -- (-991.825) (-998.453) [-996.879] (-997.168) * (-996.960) (-998.006) [-994.262] (-1000.998) -- 0:01:44
455000 -- (-998.526) (-992.103) (-999.958) [-994.568] * (-996.719) (-998.478) (-995.308) [-1008.337] -- 0:01:45
Average standard deviation of split frequencies: 0.003101
455500 -- (-994.976) [-993.993] (-996.416) (-1002.911) * [-993.352] (-992.768) (-998.189) (-998.059) -- 0:01:45
456000 -- [-994.125] (-997.201) (-1001.297) (-998.318) * (-994.267) (-994.780) (-994.780) [-995.739] -- 0:01:44
456500 -- [-992.533] (-998.925) (-996.005) (-995.001) * (-994.317) [-989.960] (-996.373) (-996.924) -- 0:01:44
457000 -- (-996.158) (-994.170) (-996.184) [-994.099] * (-994.844) [-992.270] (-1004.468) (-995.270) -- 0:01:44
457500 -- (-993.467) [-994.967] (-995.746) (-995.769) * (-990.845) [-996.901] (-1000.433) (-995.334) -- 0:01:44
458000 -- (-1000.280) (-995.516) (-1000.368) [-994.082] * (-991.986) (-991.290) (-995.093) [-995.435] -- 0:01:44
458500 -- (-995.300) (-1005.361) [-997.504] (-993.228) * (-994.401) [-991.929] (-1000.182) (-999.585) -- 0:01:43
459000 -- (-1000.421) (-993.945) [-997.634] (-992.328) * (-992.257) (-999.635) (-995.744) [-993.942] -- 0:01:43
459500 -- (-993.925) (-989.749) (-1001.920) [-994.310] * [-991.409] (-994.368) (-998.426) (-991.570) -- 0:01:43
460000 -- [-1000.714] (-999.498) (-994.948) (-991.176) * (-993.506) (-994.419) [-996.400] (-997.540) -- 0:01:43
Average standard deviation of split frequencies: 0.002558
460500 -- (-997.898) (-1005.348) (-993.749) [-993.332] * [-994.295] (-997.788) (-1012.084) (-995.020) -- 0:01:44
461000 -- (-998.354) (-998.200) (-997.248) [-993.223] * (-1000.078) (-1002.192) [-999.881] (-998.983) -- 0:01:44
461500 -- (-991.017) (-993.217) [-995.221] (-996.237) * (-992.652) (-1000.395) (-996.886) [-993.863] -- 0:01:43
462000 -- (-993.581) [-992.893] (-998.149) (-994.718) * (-991.150) [-1000.586] (-995.887) (-998.466) -- 0:01:43
462500 -- (-990.231) (-993.243) (-995.700) [-991.930] * [-1000.523] (-998.428) (-995.394) (-1000.886) -- 0:01:43
463000 -- [-993.896] (-998.389) (-997.693) (-995.843) * [-993.821] (-1003.086) (-997.225) (-999.276) -- 0:01:43
463500 -- [-991.225] (-995.946) (-999.335) (-998.409) * [-998.973] (-1001.431) (-997.210) (-994.190) -- 0:01:43
464000 -- (-993.903) [-993.963] (-989.465) (-995.014) * (-996.924) (-1000.211) (-991.581) [-990.470] -- 0:01:42
464500 -- [-992.231] (-991.028) (-993.566) (-995.890) * (-997.944) (-1004.063) [-994.086] (-999.785) -- 0:01:42
465000 -- (-995.873) (-996.735) (-994.081) [-995.484] * (-997.528) (-993.975) (-995.932) [-1002.698] -- 0:01:42
Average standard deviation of split frequencies: 0.001517
465500 -- (-993.649) [-996.347] (-991.982) (-1001.375) * (-995.702) [-993.950] (-990.848) (-993.934) -- 0:01:42
466000 -- (-996.720) [-994.750] (-996.537) (-993.884) * [-992.473] (-990.796) (-992.673) (-994.634) -- 0:01:43
466500 -- (-992.071) (-992.746) [-992.980] (-993.652) * (-997.360) [-992.507] (-996.054) (-993.633) -- 0:01:42
467000 -- [-994.476] (-996.105) (-991.245) (-997.820) * (-992.621) (-992.052) [-998.840] (-996.154) -- 0:01:42
467500 -- (-996.035) (-999.756) [-995.964] (-1000.023) * (-1006.713) (-997.614) [-992.430] (-995.657) -- 0:01:42
468000 -- (-992.493) (-996.442) [-996.437] (-993.663) * (-994.113) [-999.898] (-992.608) (-995.853) -- 0:01:42
468500 -- [-996.404] (-995.135) (-993.373) (-991.876) * [-997.523] (-1002.565) (-993.863) (-994.487) -- 0:01:42
469000 -- (-999.295) (-994.056) [-999.784] (-996.549) * (-995.288) (-1002.883) (-1003.865) [-993.831] -- 0:01:41
469500 -- (-998.229) (-992.765) (-997.081) [-995.987] * (-992.804) [-997.298] (-1000.164) (-996.871) -- 0:01:41
470000 -- [-1002.866] (-995.691) (-994.529) (-994.403) * [-996.578] (-996.370) (-995.650) (-997.393) -- 0:01:41
Average standard deviation of split frequencies: 0.000501
470500 -- [-999.281] (-996.065) (-995.549) (-999.844) * (-991.627) (-998.131) [-991.947] (-1000.874) -- 0:01:41
471000 -- (-999.375) (-998.919) (-991.250) [-991.895] * [-992.814] (-999.552) (-990.817) (-1013.397) -- 0:01:42
471500 -- (-1000.341) [-993.410] (-991.826) (-995.638) * [-992.327] (-996.532) (-990.014) (-1001.633) -- 0:01:42
472000 -- (-1009.179) (-991.469) [-990.985] (-991.696) * (-991.962) (-994.933) (-989.489) [-993.478] -- 0:01:41
472500 -- [-996.516] (-996.276) (-996.524) (-995.931) * (-998.075) (-998.556) (-991.855) [-995.127] -- 0:01:41
473000 -- (-999.118) [-997.849] (-998.827) (-993.362) * [-993.169] (-1000.484) (-997.029) (-998.324) -- 0:01:41
473500 -- (-998.143) (-996.801) (-998.736) [-990.902] * [-994.999] (-999.844) (-991.804) (-994.468) -- 0:01:41
474000 -- [-991.332] (-997.035) (-993.946) (-991.199) * [-995.468] (-999.654) (-994.244) (-996.682) -- 0:01:40
474500 -- (-997.183) (-996.469) [-991.236] (-991.728) * (-995.579) (-994.754) [-993.768] (-995.899) -- 0:01:40
475000 -- (-1000.378) (-997.963) [-995.154] (-1000.735) * (-996.853) (-994.592) [-993.844] (-1000.418) -- 0:01:40
Average standard deviation of split frequencies: 0.000495
475500 -- (-995.939) (-996.552) [-995.802] (-991.356) * (-992.582) (-996.667) [-996.425] (-994.349) -- 0:01:40
476000 -- (-997.091) [-991.377] (-993.724) (-994.355) * (-998.180) (-1000.478) (-995.325) [-990.547] -- 0:01:40
476500 -- (-1000.010) [-995.739] (-991.369) (-1000.286) * (-992.406) (-996.292) (-991.275) [-992.841] -- 0:01:41
477000 -- (-997.552) (-993.367) [-998.437] (-997.662) * (-998.836) [-997.093] (-994.240) (-992.860) -- 0:01:40
477500 -- [-995.034] (-993.437) (-1001.963) (-998.623) * (-994.259) (-994.952) (-999.798) [-992.469] -- 0:01:40
478000 -- (-996.966) (-994.991) [-995.727] (-995.274) * [-992.237] (-997.846) (-994.329) (-999.536) -- 0:01:40
478500 -- [-997.400] (-999.385) (-994.006) (-991.571) * (-997.164) (-997.576) [-996.756] (-992.127) -- 0:01:40
479000 -- [-995.867] (-995.160) (-999.626) (-999.957) * (-991.158) (-997.067) [-993.266] (-1001.941) -- 0:01:40
479500 -- (-996.512) (-996.106) (-993.876) [-991.811] * [-990.425] (-994.298) (-997.408) (-997.019) -- 0:01:39
480000 -- (-990.961) [-989.956] (-995.414) (-994.418) * (-993.704) (-997.380) (-991.133) [-998.242] -- 0:01:39
Average standard deviation of split frequencies: 0.000000
480500 -- (-995.207) (-991.900) [-997.519] (-992.295) * (-994.205) (-994.913) [-992.738] (-1000.253) -- 0:01:39
481000 -- (-994.509) (-997.674) [-993.507] (-1000.918) * (-993.975) (-994.703) [-990.148] (-997.669) -- 0:01:39
481500 -- (-993.884) (-992.468) (-992.068) [-991.155] * (-998.171) [-992.621] (-995.533) (-997.967) -- 0:01:40
482000 -- [-993.023] (-991.105) (-1001.964) (-1002.900) * (-995.001) (-991.585) [-991.433] (-995.538) -- 0:01:39
482500 -- (-989.777) [-992.807] (-999.914) (-999.899) * (-998.859) (-995.409) [-995.254] (-1000.343) -- 0:01:39
483000 -- (-995.941) [-990.969] (-1000.072) (-999.225) * (-998.307) [-992.198] (-994.903) (-997.993) -- 0:01:39
483500 -- (-993.984) [-995.461] (-994.474) (-998.090) * (-1000.578) (-997.783) [-996.691] (-994.810) -- 0:01:39
484000 -- (-995.902) (-1001.102) (-994.134) [-1004.662] * (-994.746) (-990.518) [-994.300] (-996.309) -- 0:01:39
484500 -- (-993.079) [-993.733] (-999.259) (-1001.987) * (-1001.913) (-997.960) [-997.257] (-994.207) -- 0:01:38
485000 -- [-995.591] (-993.718) (-996.170) (-1000.057) * [-994.699] (-992.108) (-995.380) (-996.501) -- 0:01:38
Average standard deviation of split frequencies: 0.000485
485500 -- (-999.220) (-993.805) (-993.186) [-995.071] * (-994.007) (-999.973) (-1003.662) [-993.637] -- 0:01:38
486000 -- [-994.086] (-993.868) (-994.293) (-994.520) * (-990.341) (-993.131) [-994.370] (-1002.044) -- 0:01:38
486500 -- (-994.932) (-993.978) [-990.789] (-1004.182) * (-1004.586) (-995.842) [-994.420] (-997.328) -- 0:01:38
487000 -- [-989.483] (-992.107) (-996.141) (-998.848) * (-997.333) (-996.946) (-992.533) [-1005.496] -- 0:01:39
487500 -- [-990.791] (-997.868) (-994.920) (-1001.288) * (-997.198) [-994.639] (-996.603) (-999.468) -- 0:01:38
488000 -- (-991.117) [-996.918] (-996.918) (-996.334) * (-1001.684) (-995.431) (-1001.321) [-995.376] -- 0:01:38
488500 -- (-989.981) (-998.425) [-993.698] (-1001.126) * [-988.829] (-995.049) (-994.606) (-1001.812) -- 0:01:38
489000 -- (-993.244) (-996.953) [-995.781] (-1001.776) * [-993.906] (-992.918) (-1000.235) (-1000.429) -- 0:01:38
489500 -- (-998.092) (-999.941) [-994.699] (-997.268) * (-996.581) [-990.889] (-993.496) (-992.460) -- 0:01:38
490000 -- (-994.929) [-994.062] (-1000.726) (-993.931) * [-989.592] (-992.906) (-992.752) (-997.361) -- 0:01:37
Average standard deviation of split frequencies: 0.000961
490500 -- (-997.168) [-998.767] (-999.021) (-992.624) * (-990.481) [-998.610] (-990.772) (-998.545) -- 0:01:37
491000 -- [-991.279] (-1000.127) (-996.990) (-998.172) * (-993.647) [-996.289] (-989.659) (-990.698) -- 0:01:37
491500 -- (-996.955) [-993.882] (-999.230) (-998.632) * (-997.206) (-998.560) [-993.900] (-1002.795) -- 0:01:37
492000 -- (-998.060) [-997.898] (-995.476) (-998.881) * [-993.775] (-993.137) (-994.828) (-997.690) -- 0:01:38
492500 -- (-1001.105) (-1002.980) [-992.556] (-994.827) * (-1000.334) (-997.302) (-994.413) [-998.118] -- 0:01:37
493000 -- (-998.722) (-999.933) [-991.677] (-997.796) * (-994.011) (-1001.235) (-998.142) [-992.022] -- 0:01:37
493500 -- (-996.058) [-991.144] (-993.489) (-995.438) * (-995.977) (-999.429) [-1001.799] (-990.419) -- 0:01:37
494000 -- (-995.376) [-993.371] (-993.841) (-997.807) * (-993.192) (-998.783) (-1002.227) [-1000.996] -- 0:01:37
494500 -- [-995.104] (-994.591) (-998.772) (-992.165) * [-995.912] (-996.779) (-997.903) (-992.814) -- 0:01:37
495000 -- (-997.365) [-993.263] (-991.613) (-996.300) * (-995.651) [-994.143] (-995.002) (-998.297) -- 0:01:36
Average standard deviation of split frequencies: 0.001901
495500 -- (-995.847) (-989.869) (-993.297) [-989.759] * (-993.815) (-993.522) (-998.140) [-997.948] -- 0:01:36
496000 -- (-1002.516) (-995.083) (-999.914) [-994.029] * [-998.429] (-998.047) (-994.155) (-992.042) -- 0:01:36
496500 -- [-996.167] (-989.116) (-997.467) (-998.716) * [-992.006] (-1006.338) (-998.657) (-998.289) -- 0:01:36
497000 -- (-1005.388) [-993.853] (-998.175) (-994.190) * [-992.476] (-1000.550) (-991.795) (-999.210) -- 0:01:36
497500 -- (-999.051) [-996.243] (-995.598) (-996.530) * (-989.001) (-1000.210) (-996.711) [-992.979] -- 0:01:36
498000 -- (-996.540) [-989.519] (-1000.665) (-1001.458) * (-995.209) (-998.292) (-999.274) [-993.504] -- 0:01:36
498500 -- (-995.777) [-993.043] (-996.667) (-992.893) * [-992.415] (-988.582) (-1003.072) (-994.146) -- 0:01:36
499000 -- (-999.318) (-994.062) [-989.472] (-995.248) * [-997.066] (-993.562) (-999.480) (-990.474) -- 0:01:36
499500 -- (-1003.325) (-1004.266) [-994.204] (-996.451) * (-994.488) (-997.985) (-1000.398) [-994.614] -- 0:01:36
500000 -- (-1001.209) [-995.687] (-996.278) (-1000.554) * [-994.934] (-999.404) (-999.519) (-1004.246) -- 0:01:36
Average standard deviation of split frequencies: 0.001412
500500 -- [-999.518] (-992.577) (-994.561) (-996.037) * (-1001.491) [-993.058] (-998.275) (-999.690) -- 0:01:35
501000 -- (-1000.453) [-991.512] (-989.891) (-994.340) * (-996.061) (-994.475) (-998.126) [-998.280] -- 0:01:35
501500 -- (-995.231) (-997.656) (-993.449) [-994.578] * (-998.901) [-993.671] (-1001.748) (-997.725) -- 0:01:35
502000 -- (-998.886) [-989.231] (-992.167) (-995.071) * (-994.211) (-991.627) (-996.621) [-995.776] -- 0:01:35
502500 -- (-994.091) [-988.603] (-998.779) (-1001.036) * [-997.595] (-992.170) (-1002.372) (-1000.805) -- 0:01:35
503000 -- (-993.491) (-996.264) [-990.604] (-1000.907) * (-1000.321) (-999.401) [-996.872] (-1002.920) -- 0:01:35
503500 -- (-999.117) [-990.469] (-994.619) (-1000.205) * (-998.313) (-999.178) [-997.913] (-1001.150) -- 0:01:35
504000 -- (-995.359) (-991.260) [-990.421] (-996.502) * (-995.251) [-991.904] (-994.903) (-996.026) -- 0:01:35
504500 -- (-992.067) [-990.415] (-991.714) (-998.099) * (-997.113) (-992.100) (-997.969) [-991.855] -- 0:01:35
505000 -- [-994.779] (-994.323) (-996.185) (-995.817) * (-996.073) [-993.327] (-997.046) (-992.176) -- 0:01:35
Average standard deviation of split frequencies: 0.001863
505500 -- (-996.999) (-992.281) [-995.066] (-996.389) * (-993.275) (-994.515) (-993.261) [-994.782] -- 0:01:34
506000 -- (-990.628) [-997.131] (-990.997) (-993.885) * (-1000.135) (-1001.114) [-995.293] (-994.121) -- 0:01:34
506500 -- (-996.750) (-998.185) [-992.704] (-999.470) * (-999.632) (-997.090) (-995.122) [-993.159] -- 0:01:34
507000 -- (-994.109) [-994.160] (-992.509) (-995.317) * (-1001.019) (-996.010) [-996.478] (-991.471) -- 0:01:34
507500 -- (-998.540) (-993.466) [-993.914] (-994.289) * (-995.530) (-993.900) [-993.540] (-993.947) -- 0:01:34
508000 -- (-999.590) [-992.839] (-994.285) (-994.015) * (-994.455) [-991.586] (-992.228) (-990.697) -- 0:01:34
508500 -- [-994.333] (-998.192) (-997.689) (-996.290) * (-992.986) (-995.333) (-994.999) [-990.373] -- 0:01:34
509000 -- (-995.837) (-996.640) [-995.869] (-997.649) * [-996.871] (-997.941) (-994.053) (-991.822) -- 0:01:34
509500 -- (-998.506) (-993.047) (-994.795) [-1000.030] * (-1002.545) (-997.447) [-988.823] (-993.905) -- 0:01:34
510000 -- (-996.854) (-994.562) [-993.218] (-995.508) * (-998.377) (-1003.215) [-991.827] (-992.535) -- 0:01:34
Average standard deviation of split frequencies: 0.001846
510500 -- (-1002.789) (-997.099) (-997.156) [-994.505] * (-995.074) [-997.149] (-993.058) (-999.020) -- 0:01:33
511000 -- (-1001.241) [-1000.079] (-998.621) (-993.697) * (-994.299) [-996.703] (-993.630) (-996.152) -- 0:01:33
511500 -- (-995.840) [-1000.300] (-1003.835) (-997.242) * [-995.054] (-1002.017) (-1001.859) (-996.616) -- 0:01:33
512000 -- (-992.610) (-1002.350) (-994.749) [-1000.944] * (-991.198) (-996.517) (-991.251) [-992.202] -- 0:01:33
512500 -- (-995.498) (-999.747) (-994.561) [-990.723] * (-999.241) [-993.893] (-996.645) (-996.091) -- 0:01:33
513000 -- (-994.530) (-1011.958) (-996.579) [-997.787] * (-998.760) (-996.951) (-997.019) [-990.809] -- 0:01:33
513500 -- (-987.949) (-1000.677) [-993.081] (-1002.577) * (-999.673) [-995.309] (-993.161) (-990.926) -- 0:01:33
514000 -- (-1000.507) (-997.090) [-995.030] (-1000.694) * (-991.069) (-999.175) [-995.232] (-994.276) -- 0:01:33
514500 -- [-989.839] (-998.759) (-992.936) (-995.324) * (-994.319) (-996.176) (-994.967) [-998.921] -- 0:01:33
515000 -- (-998.891) [-996.408] (-993.747) (-996.108) * [-997.038] (-997.727) (-995.610) (-994.746) -- 0:01:33
Average standard deviation of split frequencies: 0.001827
515500 -- [-998.447] (-994.372) (-993.808) (-1003.116) * (-997.076) (-993.895) (-993.063) [-998.235] -- 0:01:33
516000 -- (-1001.691) (-995.330) [-995.191] (-995.635) * [-992.156] (-996.294) (-1002.840) (-995.100) -- 0:01:32
516500 -- (-997.424) (-998.836) [-995.737] (-990.493) * (-1003.402) [-995.587] (-999.699) (-996.023) -- 0:01:32
517000 -- (-997.464) (-994.870) (-993.711) [-993.834] * (-1001.681) (-994.191) (-996.695) [-996.642] -- 0:01:32
517500 -- (-996.004) [-990.158] (-994.566) (-996.750) * (-993.433) (-994.496) (-992.985) [-996.085] -- 0:01:32
518000 -- (-991.039) (-994.393) [-993.831] (-993.044) * (-992.436) (-994.723) [-993.011] (-1004.284) -- 0:01:32
518500 -- [-993.845] (-998.375) (-992.087) (-991.460) * [-991.587] (-1002.144) (-995.788) (-997.898) -- 0:01:32
519000 -- (-994.426) (-998.977) [-991.146] (-998.080) * (-993.852) (-996.115) (-997.817) [-997.753] -- 0:01:32
519500 -- (-992.147) (-994.226) [-994.596] (-990.389) * (-995.281) (-994.248) [-995.680] (-994.599) -- 0:01:32
520000 -- (-999.861) (-998.387) [-990.175] (-991.622) * (-999.517) (-993.953) (-997.248) [-996.103] -- 0:01:32
Average standard deviation of split frequencies: 0.001358
520500 -- (-994.619) (-1002.049) (-996.655) [-991.125] * [-997.128] (-995.091) (-1000.697) (-996.076) -- 0:01:32
521000 -- (-997.100) [-996.222] (-994.287) (-993.387) * (-991.700) [-1005.762] (-1004.047) (-1005.186) -- 0:01:31
521500 -- [-995.964] (-999.694) (-999.419) (-995.424) * [-990.737] (-998.659) (-1001.158) (-1002.205) -- 0:01:31
522000 -- [-994.965] (-999.931) (-997.338) (-994.971) * [-993.935] (-994.524) (-1000.081) (-996.415) -- 0:01:31
522500 -- (-992.450) (-996.312) (-998.294) [-995.561] * [-994.137] (-996.134) (-990.349) (-994.447) -- 0:01:31
523000 -- (-989.860) (-995.303) [-998.149] (-1003.940) * (-991.112) (-993.209) [-993.268] (-991.169) -- 0:01:31
523500 -- (-991.929) (-994.013) [-994.102] (-1015.823) * [-994.284] (-991.712) (-992.083) (-993.653) -- 0:01:31
524000 -- (-990.882) (-994.450) [-994.098] (-1004.314) * (-991.919) [-990.304] (-998.712) (-994.696) -- 0:01:31
524500 -- (-990.414) (-994.562) (-995.404) [-1000.420] * (-1001.844) (-994.218) [-993.319] (-995.209) -- 0:01:31
525000 -- [-994.005] (-995.155) (-994.133) (-998.952) * (-996.100) (-990.977) (-993.825) [-993.035] -- 0:01:31
Average standard deviation of split frequencies: 0.000896
525500 -- (-992.610) (-991.985) (-995.174) [-1002.396] * (-990.472) (-1003.956) (-996.813) [-993.153] -- 0:01:31
526000 -- (-994.184) (-996.944) (-996.634) [-996.730] * (-996.937) [-994.665] (-998.208) (-997.092) -- 0:01:31
526500 -- [-994.384] (-992.934) (-998.093) (-1002.121) * (-996.598) (-994.398) (-995.825) [-991.715] -- 0:01:30
527000 -- (-990.668) [-1002.235] (-996.591) (-992.300) * (-994.904) (-995.777) [-997.948] (-997.122) -- 0:01:30
527500 -- (-995.621) (-998.711) (-994.317) [-997.555] * (-999.444) [-991.664] (-996.982) (-991.891) -- 0:01:30
528000 -- (-998.234) (-995.853) [-995.781] (-1001.062) * (-1000.064) (-994.590) [-995.142] (-1002.032) -- 0:01:30
528500 -- (-1001.693) (-993.277) [-992.689] (-995.168) * [-996.555] (-994.837) (-992.028) (-998.068) -- 0:01:30
529000 -- (-994.253) (-993.129) (-997.252) [-992.410] * [-998.162] (-996.284) (-996.746) (-998.264) -- 0:01:29
529500 -- (-1003.661) (-995.736) (-997.548) [-993.484] * (-996.645) (-991.703) (-994.758) [-991.957] -- 0:01:30
530000 -- (-1001.303) (-991.295) (-990.932) [-988.132] * [-995.157] (-998.727) (-996.068) (-993.633) -- 0:01:30
Average standard deviation of split frequencies: 0.000444
530500 -- (-996.380) [-997.592] (-996.732) (-991.557) * (-994.543) (-995.772) (-995.734) [-992.958] -- 0:01:30
531000 -- [-994.664] (-994.120) (-992.092) (-996.025) * [-995.287] (-991.540) (-992.087) (-998.851) -- 0:01:30
531500 -- (-996.012) (-997.012) [-999.834] (-999.787) * (-998.125) [-992.086] (-993.846) (-999.281) -- 0:01:29
532000 -- (-997.846) (-1000.480) [-992.875] (-996.932) * (-999.626) (-996.019) [-993.455] (-1005.630) -- 0:01:29
532500 -- [-992.278] (-1000.052) (-991.035) (-992.191) * (-996.035) (-999.436) (-996.527) [-995.862] -- 0:01:29
533000 -- (-993.382) (-996.257) (-992.510) [-993.264] * (-997.622) [-998.307] (-994.390) (-996.482) -- 0:01:29
533500 -- (-993.656) [-996.971] (-994.239) (-995.854) * [-997.929] (-1000.381) (-992.525) (-995.663) -- 0:01:29
534000 -- (-991.586) (-994.721) [-994.441] (-990.574) * (-995.262) [-997.030] (-995.721) (-995.795) -- 0:01:29
534500 -- [-996.231] (-993.532) (-995.292) (-997.455) * (-995.664) (-993.027) [-990.558] (-1001.781) -- 0:01:29
535000 -- (-991.406) (-997.670) (-996.737) [-994.264] * (-997.538) [-991.118] (-995.559) (-996.389) -- 0:01:29
Average standard deviation of split frequencies: 0.000000
535500 -- (-997.702) (-993.600) [-996.593] (-996.377) * (-990.677) (-994.826) [-994.494] (-993.381) -- 0:01:29
536000 -- (-998.217) (-994.929) [-992.962] (-998.252) * (-993.712) (-991.118) (-993.640) [-991.775] -- 0:01:29
536500 -- (-996.805) [-998.603] (-989.720) (-994.283) * [-992.178] (-997.397) (-995.697) (-993.019) -- 0:01:28
537000 -- [-991.835] (-993.394) (-994.751) (-992.255) * (-997.627) (-997.533) (-996.124) [-993.084] -- 0:01:28
537500 -- (-993.130) [-995.409] (-993.152) (-997.578) * [-996.323] (-996.026) (-1003.255) (-998.586) -- 0:01:28
538000 -- (-990.378) (-992.523) [-992.389] (-991.351) * (-995.786) [-992.392] (-995.646) (-998.301) -- 0:01:28
538500 -- [-1001.837] (-996.995) (-995.464) (-994.961) * [-999.458] (-995.985) (-999.655) (-1000.641) -- 0:01:28
539000 -- (-995.245) [-994.437] (-997.577) (-998.858) * (-992.639) (-994.313) [-993.628] (-997.368) -- 0:01:28
539500 -- (-991.451) [-994.123] (-1004.462) (-1002.018) * [-996.368] (-995.259) (-999.707) (-993.998) -- 0:01:27
540000 -- (-995.682) (-997.804) (-996.233) [-992.425] * (-998.693) (-995.482) (-992.931) [-999.073] -- 0:01:28
Average standard deviation of split frequencies: 0.000436
540500 -- (-992.388) (-1003.412) (-997.705) [-993.700] * (-999.394) [-992.989] (-994.951) (-992.572) -- 0:01:28
541000 -- [-991.651] (-999.933) (-1001.333) (-996.356) * [-993.408] (-996.131) (-994.414) (-990.121) -- 0:01:28
541500 -- (-993.528) (-994.927) (-994.251) [-999.584] * (-992.868) (-995.748) (-990.746) [-991.969] -- 0:01:28
542000 -- (-995.113) (-992.816) (-999.630) [-994.242] * (-994.466) (-1005.946) [-993.435] (-994.799) -- 0:01:27
542500 -- (-991.521) (-998.098) (-996.036) [-996.936] * (-992.357) (-994.980) (-995.719) [-998.473] -- 0:01:27
543000 -- [-993.001] (-997.724) (-992.020) (-1001.901) * (-996.521) (-992.954) (-992.418) [-998.047] -- 0:01:27
543500 -- (-995.875) [-991.585] (-997.457) (-997.413) * (-997.719) (-995.755) [-997.797] (-999.690) -- 0:01:27
544000 -- [-993.731] (-1001.019) (-993.043) (-996.122) * (-1003.440) (-990.813) (-996.030) [-995.659] -- 0:01:27
544500 -- [-994.075] (-992.902) (-992.204) (-998.829) * (-997.173) [-990.191] (-1003.386) (-992.777) -- 0:01:27
545000 -- (-995.173) [-994.768] (-995.736) (-999.278) * [-997.041] (-992.000) (-1002.756) (-995.139) -- 0:01:27
Average standard deviation of split frequencies: 0.000432
545500 -- (-998.390) (-1001.425) (-997.466) [-994.100] * (-994.192) (-996.065) (-996.922) [-993.938] -- 0:01:27
546000 -- [-995.451] (-992.580) (-1001.026) (-997.193) * (-997.415) (-998.865) [-993.508] (-1003.937) -- 0:01:27
546500 -- (-991.552) (-990.021) (-998.838) [-992.163] * (-999.594) (-998.049) [-992.040] (-998.928) -- 0:01:27
547000 -- (-996.857) [-993.211] (-992.543) (-990.964) * [-1002.684] (-1003.581) (-994.911) (-1000.288) -- 0:01:26
547500 -- (-997.364) (-993.074) (-993.767) [-994.641] * (-995.535) [-992.527] (-990.863) (-995.694) -- 0:01:26
548000 -- (-992.401) (-991.404) [-998.598] (-994.532) * (-997.031) [-995.035] (-995.254) (-993.477) -- 0:01:26
548500 -- (-991.585) [-1000.968] (-995.407) (-995.104) * (-998.917) (-997.210) (-994.053) [-995.928] -- 0:01:26
549000 -- (-995.506) (-1005.812) (-994.661) [-995.484] * (-996.295) (-992.829) (-990.674) [-994.803] -- 0:01:26
549500 -- [-992.183] (-994.588) (-994.838) (-996.179) * (-999.230) (-995.975) (-999.037) [-990.729] -- 0:01:26
550000 -- (-996.901) (-993.393) [-993.778] (-1001.055) * (-994.329) [-991.198] (-991.473) (-995.857) -- 0:01:25
Average standard deviation of split frequencies: 0.000856
550500 -- (-995.444) (-991.813) (-998.408) [-994.652] * [-993.952] (-1003.670) (-995.331) (-995.502) -- 0:01:26
551000 -- (-997.647) (-995.792) (-995.540) [-994.459] * (-998.049) (-995.190) [-992.938] (-992.170) -- 0:01:26
551500 -- (-999.331) (-990.262) [-996.310] (-1003.197) * [-1004.354] (-1002.008) (-995.579) (-995.701) -- 0:01:26
552000 -- [-994.799] (-993.304) (-996.660) (-997.820) * (-994.302) (-999.907) (-994.837) [-997.511] -- 0:01:26
552500 -- [-992.601] (-993.190) (-996.576) (-993.790) * [-990.361] (-996.822) (-997.082) (-1000.510) -- 0:01:25
553000 -- (-994.021) (-995.536) [-999.335] (-992.978) * (-999.703) (-995.985) [-994.354] (-996.966) -- 0:01:25
553500 -- (-1002.148) (-1000.366) [-1002.410] (-996.935) * (-992.100) [-998.377] (-1000.935) (-993.852) -- 0:01:25
554000 -- [-996.632] (-996.180) (-992.379) (-993.290) * (-996.314) (-999.196) (-990.983) [-994.515] -- 0:01:25
554500 -- (-998.180) [-996.453] (-998.326) (-999.311) * (-1000.904) (-1003.425) [-995.369] (-994.410) -- 0:01:25
555000 -- (-995.599) (-994.344) (-997.254) [-994.276] * (-995.409) (-998.270) [-992.737] (-991.627) -- 0:01:24
Average standard deviation of split frequencies: 0.000848
555500 -- (-993.728) (-990.716) (-998.222) [-993.336] * (-998.953) (-998.702) [-993.010] (-995.587) -- 0:01:24
556000 -- (-1004.257) (-1000.720) (-993.663) [-998.362] * (-998.116) [-995.590] (-993.338) (-993.520) -- 0:01:25
556500 -- [-994.624] (-995.348) (-993.130) (-1001.588) * [-1001.729] (-992.006) (-1003.758) (-995.180) -- 0:01:25
557000 -- (-997.245) (-994.827) [-994.317] (-1000.394) * [-995.987] (-996.716) (-995.811) (-994.020) -- 0:01:25
557500 -- [-989.493] (-993.972) (-995.440) (-998.588) * [-990.792] (-994.480) (-994.397) (-1000.788) -- 0:01:24
558000 -- (-992.004) [-993.900] (-990.764) (-1001.681) * [-992.389] (-997.466) (-1002.694) (-994.745) -- 0:01:24
558500 -- (-995.139) [-993.483] (-992.560) (-999.415) * (-991.808) (-1000.276) (-995.328) [-998.744] -- 0:01:24
559000 -- (-993.798) (-991.876) [-991.263] (-995.992) * (-998.735) (-996.582) (-1003.729) [-992.944] -- 0:01:24
559500 -- [-996.604] (-994.502) (-998.712) (-994.330) * (-990.834) (-1010.834) (-993.540) [-994.946] -- 0:01:24
560000 -- (-998.660) (-995.874) (-990.853) [-994.843] * (-993.888) (-1000.261) [-991.635] (-994.213) -- 0:01:24
Average standard deviation of split frequencies: 0.000841
560500 -- (-992.892) (-999.783) (-991.060) [-995.395] * [-995.573] (-996.797) (-999.237) (-999.596) -- 0:01:23
561000 -- (-992.490) (-997.197) [-995.333] (-994.349) * (-992.068) (-1000.540) [-997.989] (-995.223) -- 0:01:24
561500 -- [-990.519] (-997.952) (-992.421) (-993.409) * (-1000.298) (-994.801) (-997.124) [-994.737] -- 0:01:24
562000 -- (-1000.227) (-996.912) [-996.199] (-994.441) * (-994.985) (-996.706) [-992.328] (-993.903) -- 0:01:24
562500 -- (-995.307) (-1003.888) (-992.261) [-993.593] * (-994.234) [-993.928] (-997.603) (-997.758) -- 0:01:24
563000 -- (-999.928) (-996.822) (-996.660) [-992.527] * [-996.499] (-998.184) (-995.965) (-993.628) -- 0:01:23
563500 -- (-1002.229) (-996.985) (-992.944) [-993.429] * (-991.474) [-1000.750] (-1003.366) (-994.919) -- 0:01:23
564000 -- (-995.628) [-1001.930] (-991.943) (-995.211) * (-994.964) (-996.428) (-1000.477) [-992.681] -- 0:01:23
564500 -- (-993.368) (-995.775) [-994.922] (-994.033) * (-992.746) (-994.983) (-998.186) [-993.301] -- 0:01:23
565000 -- [-996.324] (-994.082) (-1003.031) (-995.131) * [-996.573] (-994.637) (-997.377) (-996.174) -- 0:01:23
Average standard deviation of split frequencies: 0.000833
565500 -- (-997.070) (-999.546) (-992.675) [-993.873] * [-993.837] (-996.377) (-1001.438) (-995.117) -- 0:01:22
566000 -- (-996.443) (-993.364) [-994.785] (-993.568) * [-993.273] (-997.383) (-997.569) (-999.468) -- 0:01:22
566500 -- (-993.918) (-992.151) [-992.049] (-995.255) * (-995.335) (-999.335) [-995.320] (-998.554) -- 0:01:23
567000 -- (-996.990) (-994.711) [-996.413] (-999.196) * (-994.572) (-999.297) [-991.773] (-987.678) -- 0:01:23
567500 -- (-999.087) (-999.495) [-992.917] (-1000.171) * [-994.694] (-997.364) (-997.832) (-1001.449) -- 0:01:23
568000 -- (-994.962) (-998.175) [-993.825] (-994.757) * (-993.729) (-998.816) (-992.515) [-996.650] -- 0:01:22
568500 -- (-999.918) [-995.181] (-992.290) (-994.367) * (-995.495) (-995.181) (-993.477) [-994.033] -- 0:01:22
569000 -- (-997.495) (-990.982) (-991.338) [-991.975] * (-992.166) [-996.900] (-999.670) (-995.174) -- 0:01:22
569500 -- (-1008.022) (-1000.498) (-997.992) [-993.029] * (-995.979) (-998.613) (-997.361) [-994.551] -- 0:01:22
570000 -- (-1006.226) (-999.231) [-993.573] (-1001.797) * (-1002.059) (-996.792) (-992.172) [-993.769] -- 0:01:22
Average standard deviation of split frequencies: 0.001239
570500 -- (-1002.374) [-995.350] (-994.167) (-1000.303) * (-1003.995) (-996.416) (-996.012) [-1000.044] -- 0:01:22
571000 -- (-997.101) [-997.511] (-992.635) (-997.312) * (-995.708) (-996.698) [-995.763] (-996.372) -- 0:01:22
571500 -- [-993.264] (-997.142) (-994.286) (-996.413) * [-993.471] (-997.253) (-1000.527) (-999.041) -- 0:01:22
572000 -- (-989.670) (-994.051) (-992.958) [-996.415] * (-995.283) [-992.176] (-995.921) (-994.807) -- 0:01:22
572500 -- [-991.900] (-995.463) (-999.076) (-993.775) * [-994.199] (-996.216) (-995.000) (-994.815) -- 0:01:22
573000 -- [-995.794] (-994.921) (-995.506) (-994.912) * (-997.302) (-994.290) (-994.852) [-995.069] -- 0:01:21
573500 -- [-996.384] (-996.598) (-999.798) (-994.064) * (-994.641) (-996.324) (-1001.707) [-999.741] -- 0:01:21
574000 -- (-994.779) [-994.509] (-999.941) (-994.533) * (-996.234) (-996.865) [-996.573] (-1001.197) -- 0:01:21
574500 -- (-990.714) (-994.016) (-996.355) [-1002.805] * (-992.582) (-994.972) (-1000.650) [-995.265] -- 0:01:21
575000 -- [-998.790] (-992.594) (-995.010) (-993.885) * (-996.544) (-1003.496) (-1000.471) [-995.808] -- 0:01:21
Average standard deviation of split frequencies: 0.001228
575500 -- (-992.967) (-1000.780) [-992.390] (-995.735) * (-997.613) (-996.312) (-999.699) [-993.010] -- 0:01:21
576000 -- (-991.840) [-994.113] (-999.559) (-993.549) * [-993.007] (-997.204) (-996.297) (-994.112) -- 0:01:21
576500 -- (-998.398) (-1000.711) (-993.222) [-991.425] * (-995.986) [-998.697] (-999.139) (-996.470) -- 0:01:21
577000 -- (-991.826) [-1001.066] (-1001.241) (-994.781) * [-994.246] (-1007.963) (-1001.960) (-991.767) -- 0:01:21
577500 -- (-996.156) (-1004.770) (-1000.830) [-993.154] * (-998.925) (-998.779) [-995.954] (-992.202) -- 0:01:21
578000 -- (-996.422) (-996.169) (-1005.018) [-996.083] * (-997.640) (-1006.632) (-996.239) [-998.090] -- 0:01:21
578500 -- (-994.227) (-998.002) (-1005.347) [-991.432] * (-993.859) (-996.949) (-994.506) [-989.862] -- 0:01:20
579000 -- (-993.122) [-1001.388] (-1002.933) (-996.875) * (-993.751) (-996.010) [-989.813] (-993.971) -- 0:01:20
579500 -- (-991.506) (-996.392) (-1005.590) [-997.112] * (-1000.367) (-997.361) (-998.469) [-992.938] -- 0:01:20
580000 -- [-994.145] (-996.904) (-994.576) (-996.693) * (-1001.171) (-1002.353) [-997.435] (-996.954) -- 0:01:20
Average standard deviation of split frequencies: 0.001624
580500 -- (-997.444) [-996.529] (-996.957) (-1000.061) * (-996.928) [-991.906] (-995.961) (-1002.809) -- 0:01:20
581000 -- (-999.226) (-998.160) [-995.968] (-994.560) * (-994.306) [-991.872] (-997.947) (-995.881) -- 0:01:20
581500 -- (-995.441) (-997.840) (-993.302) [-999.692] * (-991.661) [-995.553] (-998.039) (-996.941) -- 0:01:20
582000 -- [-995.928] (-997.186) (-1000.997) (-991.208) * (-992.313) (-999.010) (-997.793) [-991.253] -- 0:01:20
582500 -- (-992.367) (-992.632) (-998.351) [-989.797] * [-998.190] (-999.597) (-994.841) (-994.822) -- 0:01:20
583000 -- (-988.819) (-999.077) (-998.294) [-993.566] * (-992.018) (-997.347) [-991.195] (-994.328) -- 0:01:20
583500 -- [-991.216] (-995.277) (-997.165) (-995.212) * [-992.616] (-994.758) (-989.524) (-999.007) -- 0:01:19
584000 -- [-993.588] (-998.176) (-996.054) (-999.246) * (-990.169) [-988.940] (-998.229) (-992.561) -- 0:01:19
584500 -- (-996.270) [-992.688] (-994.512) (-1003.280) * (-995.934) (-994.290) [-994.517] (-995.781) -- 0:01:19
585000 -- [-991.880] (-993.482) (-1000.288) (-995.698) * [-990.290] (-993.501) (-1004.296) (-991.302) -- 0:01:19
Average standard deviation of split frequencies: 0.001609
585500 -- [-990.519] (-991.956) (-998.891) (-996.159) * (-995.710) (-993.869) (-993.242) [-991.667] -- 0:01:19
586000 -- (-1005.173) (-996.229) (-994.211) [-993.258] * (-1004.156) (-992.020) [-994.911] (-993.170) -- 0:01:19
586500 -- (-995.052) [-996.179] (-991.742) (-994.188) * [-994.583] (-996.492) (-997.602) (-992.738) -- 0:01:19
587000 -- (-995.975) [-996.732] (-989.445) (-997.592) * [-995.392] (-1000.052) (-995.884) (-996.797) -- 0:01:19
587500 -- [-993.747] (-996.911) (-993.265) (-999.267) * [-996.456] (-995.564) (-990.199) (-996.145) -- 0:01:19
588000 -- (-998.990) (-994.625) (-993.237) [-993.510] * (-1001.636) [-994.208] (-999.432) (-998.484) -- 0:01:19
588500 -- [-1000.205] (-995.611) (-992.370) (-993.946) * (-992.537) [-996.050] (-995.194) (-996.490) -- 0:01:19
589000 -- [-999.284] (-995.292) (-992.363) (-999.041) * [-991.462] (-998.280) (-996.150) (-1000.215) -- 0:01:18
589500 -- (-999.623) [-996.318] (-997.863) (-990.508) * [-996.612] (-1001.475) (-995.843) (-992.629) -- 0:01:18
590000 -- (-995.485) [-1001.482] (-995.383) (-993.764) * (-996.357) [-995.609] (-994.050) (-994.672) -- 0:01:18
Average standard deviation of split frequencies: 0.001596
590500 -- (-1002.645) (-999.676) (-998.220) [-996.217] * (-995.594) (-997.987) (-996.085) [-991.191] -- 0:01:18
591000 -- (-1006.782) [-995.786] (-995.080) (-1000.289) * (-996.545) [-996.282] (-1001.056) (-994.919) -- 0:01:18
591500 -- [-1000.633] (-995.408) (-1000.121) (-997.002) * (-997.174) (-995.646) [-998.079] (-996.589) -- 0:01:18
592000 -- (-996.638) [-994.997] (-994.163) (-995.185) * (-1000.670) [-991.988] (-994.897) (-998.633) -- 0:01:18
592500 -- (-999.048) (-998.698) (-997.473) [-992.751] * (-992.722) (-995.344) [-992.245] (-992.080) -- 0:01:18
593000 -- (-993.387) (-997.290) [-998.961] (-997.497) * (-995.671) (-995.570) (-991.425) [-994.648] -- 0:01:18
593500 -- (-997.452) (-1000.903) [-994.989] (-999.924) * (-990.078) (-993.248) [-993.702] (-992.088) -- 0:01:18
594000 -- (-994.470) (-999.178) (-998.079) [-991.674] * (-996.206) (-993.982) [-991.848] (-999.793) -- 0:01:17
594500 -- (-996.727) (-1000.515) (-995.560) [-991.572] * [-997.038] (-994.226) (-1000.290) (-990.893) -- 0:01:17
595000 -- [-993.093] (-1000.701) (-1003.091) (-990.853) * (-1002.862) [-1000.480] (-998.364) (-997.928) -- 0:01:17
Average standard deviation of split frequencies: 0.000395
595500 -- (-990.799) (-999.319) (-997.149) [-990.177] * (-1005.389) (-992.118) (-998.550) [-997.637] -- 0:01:17
596000 -- (-993.930) (-992.595) (-996.236) [-1002.446] * (-995.995) [-993.740] (-999.616) (-997.777) -- 0:01:17
596500 -- (-996.918) (-998.019) (-995.208) [-994.734] * (-999.518) [-994.659] (-996.935) (-997.579) -- 0:01:17
597000 -- (-995.419) (-996.554) [-990.153] (-998.190) * [-993.337] (-992.169) (-996.561) (-997.431) -- 0:01:17
597500 -- (-992.649) [-998.260] (-995.674) (-993.461) * (-998.209) (-996.403) (-996.006) [-993.220] -- 0:01:17
598000 -- (-993.882) [-990.741] (-996.028) (-992.689) * (-996.152) (-993.209) (-995.575) [-989.358] -- 0:01:17
598500 -- (-994.153) (-995.400) (-997.274) [-995.619] * [-996.096] (-1010.024) (-1000.653) (-998.369) -- 0:01:17
599000 -- [-996.153] (-995.059) (-1002.594) (-990.772) * (-1003.473) (-999.028) [-999.253] (-995.794) -- 0:01:16
599500 -- (-998.931) (-992.860) (-993.509) [-996.155] * (-994.645) (-998.326) (-998.524) [-991.616] -- 0:01:16
600000 -- (-994.387) (-993.309) [-995.160] (-990.309) * (-992.105) [-998.250] (-993.021) (-995.902) -- 0:01:16
Average standard deviation of split frequencies: 0.000785
600500 -- (-994.096) (-994.055) [-995.112] (-994.265) * (-999.277) [-1005.001] (-994.095) (-990.651) -- 0:01:16
601000 -- [-993.312] (-992.977) (-991.254) (-996.146) * (-994.460) (-1003.645) (-997.180) [-992.495] -- 0:01:16
601500 -- (-999.505) [-991.800] (-995.084) (-994.017) * (-995.251) [-999.015] (-993.452) (-998.607) -- 0:01:16
602000 -- (-998.757) [-994.782] (-991.800) (-995.615) * (-992.899) (-994.771) [-1000.566] (-992.863) -- 0:01:16
602500 -- (-998.956) (-990.566) [-992.807] (-991.662) * (-998.538) [-992.884] (-998.332) (-993.676) -- 0:01:16
603000 -- (-1002.940) [-992.587] (-992.354) (-990.679) * (-990.498) (-995.970) (-999.182) [-999.290] -- 0:01:16
603500 -- (-997.749) (-990.905) [-994.067] (-991.850) * (-997.530) [-1002.328] (-1004.362) (-1000.441) -- 0:01:16
604000 -- (-995.883) (-996.070) (-993.550) [-991.592] * (-996.433) (-999.557) (-993.307) [-993.597] -- 0:01:16
604500 -- (-998.957) (-998.184) [-995.649] (-996.117) * [-994.363] (-998.580) (-991.282) (-993.014) -- 0:01:15
605000 -- (-996.347) [-992.498] (-1005.459) (-994.344) * [-996.221] (-1005.994) (-996.224) (-998.130) -- 0:01:15
Average standard deviation of split frequencies: 0.000778
605500 -- (-1005.365) [-990.475] (-1002.699) (-991.274) * [-996.049] (-999.011) (-991.373) (-1000.129) -- 0:01:15
606000 -- (-996.532) [-991.016] (-999.449) (-1000.131) * [-996.327] (-1001.575) (-993.924) (-997.763) -- 0:01:15
606500 -- (-997.119) (-995.885) (-996.668) [-993.731] * [-995.862] (-998.140) (-994.894) (-992.558) -- 0:01:15
607000 -- (-1002.785) (-993.684) (-1000.206) [-999.675] * (-998.193) [-992.242] (-993.070) (-996.446) -- 0:01:15
607500 -- (-1005.412) [-998.764] (-996.317) (-995.105) * (-1001.514) (-1011.009) [-991.015] (-991.039) -- 0:01:15
608000 -- (-997.675) (-989.816) (-996.488) [-993.767] * [-992.591] (-994.255) (-994.828) (-995.070) -- 0:01:15
608500 -- (-998.531) [-994.820] (-1001.972) (-994.002) * (-992.383) (-990.588) (-996.574) [-991.433] -- 0:01:15
609000 -- (-996.149) (-996.568) [-995.432] (-1004.055) * [-993.490] (-997.828) (-998.258) (-993.835) -- 0:01:15
609500 -- (-997.174) [-995.697] (-997.109) (-1002.871) * [-992.092] (-994.711) (-991.943) (-1003.326) -- 0:01:14
610000 -- [-1003.508] (-991.974) (-991.835) (-994.689) * (-990.419) [-994.934] (-995.039) (-996.121) -- 0:01:14
Average standard deviation of split frequencies: 0.001158
610500 -- (-998.753) (-996.217) [-993.727] (-993.146) * (-999.747) (-994.856) (-995.113) [-992.301] -- 0:01:14
611000 -- (-997.191) (-997.272) [-998.286] (-998.452) * [-996.285] (-1000.028) (-993.880) (-991.254) -- 0:01:14
611500 -- [-995.383] (-994.920) (-997.210) (-996.837) * (-990.848) (-993.205) (-993.403) [-991.590] -- 0:01:14
612000 -- [-997.915] (-990.931) (-1000.930) (-994.365) * (-996.814) (-997.765) (-992.855) [-998.404] -- 0:01:14
612500 -- [-993.569] (-999.007) (-997.810) (-991.288) * (-996.965) [-995.374] (-995.864) (-994.105) -- 0:01:14
613000 -- (-1000.261) (-995.554) [-990.168] (-997.558) * [-999.425] (-996.230) (-1005.758) (-993.763) -- 0:01:14
613500 -- (-1003.911) (-993.336) (-994.036) [-993.770] * (-996.987) (-997.837) [-992.681] (-994.608) -- 0:01:14
614000 -- (-1000.691) (-994.462) [-995.269] (-997.298) * (-999.427) (-998.392) (-993.324) [-1001.297] -- 0:01:14
614500 -- (-998.385) [-995.799] (-996.239) (-989.791) * [-993.706] (-994.481) (-993.705) (-995.392) -- 0:01:14
615000 -- (-993.794) (-994.862) (-993.184) [-992.410] * (-999.606) (-1003.396) [-998.108] (-1002.532) -- 0:01:13
Average standard deviation of split frequencies: 0.001148
615500 -- (-1002.012) (-998.476) (-997.729) [-994.438] * [-991.623] (-1004.682) (-996.183) (-1006.026) -- 0:01:13
616000 -- (-995.018) [-992.524] (-992.717) (-994.073) * (-993.261) [-996.790] (-991.959) (-1002.903) -- 0:01:13
616500 -- (-1001.933) [-994.670] (-998.724) (-990.672) * [-992.861] (-997.129) (-996.646) (-998.168) -- 0:01:13
617000 -- [-998.527] (-992.174) (-998.447) (-990.714) * (-990.404) [-996.323] (-998.796) (-995.090) -- 0:01:13
617500 -- (-1005.507) (-988.562) (-995.891) [-996.160] * (-997.294) (-1002.389) [-994.803] (-1008.322) -- 0:01:13
618000 -- (-990.961) (-995.281) [-995.283] (-991.179) * (-993.823) (-995.562) [-997.711] (-1001.153) -- 0:01:13
618500 -- (-993.752) (-993.300) [-992.648] (-1004.391) * (-995.299) (-999.291) [-993.661] (-999.197) -- 0:01:13
619000 -- [-994.927] (-993.784) (-993.513) (-992.184) * (-994.821) (-993.775) (-994.503) [-996.765] -- 0:01:13
619500 -- (-995.423) [-991.832] (-994.172) (-998.550) * (-992.120) (-995.256) (-994.573) [-994.552] -- 0:01:13
620000 -- (-996.286) (-996.611) [-990.387] (-999.017) * (-996.163) (-996.567) (-989.543) [-990.322] -- 0:01:12
Average standard deviation of split frequencies: 0.000760
620500 -- (-995.320) [-994.983] (-995.764) (-996.562) * (-996.210) [-998.604] (-993.131) (-995.317) -- 0:01:12
621000 -- (-994.207) (-996.800) (-997.147) [-994.270] * (-995.839) [-991.114] (-997.311) (-995.081) -- 0:01:12
621500 -- [-990.874] (-996.278) (-996.043) (-994.675) * (-998.128) [-992.568] (-991.620) (-993.503) -- 0:01:12
622000 -- (-1008.281) (-1005.140) (-994.470) [-994.568] * (-1002.455) (-992.191) (-1005.521) [-991.738] -- 0:01:12
622500 -- (-992.088) (-999.009) [-996.469] (-994.717) * (-997.890) (-999.932) (-999.558) [-992.960] -- 0:01:12
623000 -- (-994.757) (-995.549) (-993.906) [-995.231] * (-994.724) [-992.252] (-994.745) (-995.294) -- 0:01:12
623500 -- (-998.507) (-995.873) [-997.914] (-994.178) * (-992.503) (-991.481) (-995.304) [-995.675] -- 0:01:12
624000 -- (-999.001) (-997.227) (-993.330) [-993.105] * (-998.261) [-995.559] (-993.563) (-1001.721) -- 0:01:12
624500 -- [-1000.628] (-1003.820) (-996.679) (-1001.593) * (-1001.548) (-993.167) [-991.997] (-992.849) -- 0:01:12
625000 -- (-999.678) (-1000.715) [-993.460] (-996.828) * (-997.553) (-995.086) [-993.594] (-994.560) -- 0:01:12
Average standard deviation of split frequencies: 0.000753
625500 -- [-995.088] (-1000.919) (-1001.171) (-993.124) * [-1000.154] (-998.953) (-994.468) (-995.017) -- 0:01:11
626000 -- [-988.933] (-1004.361) (-998.095) (-992.310) * (-1000.189) (-1000.665) (-991.466) [-995.567] -- 0:01:11
626500 -- (-992.283) (-1004.138) [-993.983] (-1001.577) * (-999.180) (-993.474) [-995.608] (-1008.254) -- 0:01:11
627000 -- (-990.256) (-1001.754) (-993.777) [-994.333] * (-1001.938) [-994.088] (-996.423) (-1001.264) -- 0:01:11
627500 -- (-993.458) [-998.341] (-995.799) (-993.037) * (-1000.387) (-994.739) [-994.808] (-1002.635) -- 0:01:11
628000 -- [-995.619] (-995.584) (-995.099) (-1001.701) * [-998.947] (-996.310) (-992.566) (-993.134) -- 0:01:11
628500 -- (-993.958) [-993.165] (-997.604) (-993.039) * (-997.174) (-1000.216) [-1001.088] (-993.997) -- 0:01:11
629000 -- (-998.178) [-997.332] (-995.994) (-990.293) * (-993.429) (-992.523) [-993.102] (-1004.315) -- 0:01:11
629500 -- (-1002.725) (-991.807) [-992.566] (-997.652) * [-996.209] (-995.279) (-996.234) (-992.414) -- 0:01:11
630000 -- (-1001.945) (-1000.721) [-992.156] (-995.316) * (-995.438) [-992.113] (-992.481) (-999.069) -- 0:01:11
Average standard deviation of split frequencies: 0.000747
630500 -- [-997.364] (-993.500) (-994.031) (-995.769) * (-992.091) (-991.234) [-996.561] (-1003.368) -- 0:01:10
631000 -- (-999.413) [-994.648] (-1004.580) (-998.253) * [-990.960] (-1001.141) (-994.663) (-1004.687) -- 0:01:10
631500 -- (-998.962) [-999.864] (-996.646) (-996.905) * [-994.996] (-998.369) (-995.732) (-999.017) -- 0:01:10
632000 -- (-996.754) (-996.346) (-1006.230) [-995.063] * (-993.375) (-994.063) (-991.760) [-1000.689] -- 0:01:10
632500 -- (-994.632) (-995.706) [-997.053] (-992.529) * [-992.765] (-996.610) (-996.230) (-1000.390) -- 0:01:10
633000 -- [-994.687] (-991.804) (-998.756) (-997.634) * (-995.592) [-996.804] (-1002.024) (-999.633) -- 0:01:10
633500 -- (-993.943) (-1001.099) [-994.268] (-997.106) * (-992.741) (-996.063) [-995.325] (-995.143) -- 0:01:10
634000 -- (-993.983) (-1001.359) [-997.611] (-995.259) * (-994.922) (-993.460) (-990.222) [-991.026] -- 0:01:10
634500 -- [-993.242] (-997.829) (-997.068) (-998.975) * (-995.661) (-993.354) (-994.758) [-998.879] -- 0:01:10
635000 -- (-996.504) [-989.879] (-998.247) (-996.259) * (-994.525) (-992.687) [-995.304] (-1015.000) -- 0:01:10
Average standard deviation of split frequencies: 0.000371
635500 -- (-999.902) [-992.757] (-993.642) (-993.890) * (-998.380) (-995.391) [-990.778] (-1003.610) -- 0:01:09
636000 -- (-993.912) (-991.357) [-997.708] (-997.378) * (-995.728) [-998.370] (-992.871) (-998.437) -- 0:01:09
636500 -- (-990.097) (-994.941) [-1000.436] (-996.498) * (-993.179) (-1007.760) [-993.671] (-997.666) -- 0:01:09
637000 -- (-991.187) (-995.002) (-999.014) [-994.985] * [-995.401] (-1006.155) (-996.010) (-994.500) -- 0:01:09
637500 -- (-995.896) (-994.866) (-995.067) [-998.054] * [-992.847] (-997.136) (-999.028) (-994.319) -- 0:01:09
638000 -- (-995.916) [-991.291] (-997.798) (-998.618) * (-994.716) (-996.426) [-990.897] (-993.659) -- 0:01:09
638500 -- (-999.869) (-993.439) (-995.755) [-993.717] * (-994.926) [-998.207] (-1000.330) (-994.575) -- 0:01:09
639000 -- (-996.739) (-995.950) [-993.567] (-991.188) * [-992.500] (-992.444) (-993.418) (-1000.573) -- 0:01:09
639500 -- [-989.607] (-996.445) (-995.358) (-994.070) * [-995.616] (-998.507) (-994.094) (-1002.490) -- 0:01:09
640000 -- (-996.563) [-993.121] (-997.932) (-992.300) * (-997.232) [-994.931] (-995.992) (-998.837) -- 0:01:09
Average standard deviation of split frequencies: 0.000736
640500 -- [-991.428] (-996.695) (-997.466) (-993.222) * (-992.289) [-993.261] (-995.497) (-996.546) -- 0:01:09
641000 -- [-991.237] (-998.886) (-994.380) (-993.079) * (-989.473) (-991.968) (-997.362) [-989.696] -- 0:01:08
641500 -- (-993.005) [-998.446] (-998.106) (-991.145) * [-995.019] (-999.530) (-992.862) (-996.739) -- 0:01:08
642000 -- [-992.695] (-1001.838) (-996.561) (-995.659) * [-992.856] (-994.760) (-998.617) (-995.894) -- 0:01:08
642500 -- (-992.617) (-997.472) [-992.418] (-995.120) * (-991.979) (-992.610) (-1001.024) [-992.642] -- 0:01:08
643000 -- (-993.409) (-998.968) [-993.987] (-991.909) * [-996.688] (-993.200) (-999.015) (-1002.956) -- 0:01:08
643500 -- (-999.079) (-994.072) (-993.824) [-1002.656] * (-1001.671) (-999.278) [-995.915] (-995.694) -- 0:01:08
644000 -- (-997.338) (-1000.056) [-992.322] (-995.470) * (-995.443) [-997.754] (-999.099) (-994.974) -- 0:01:07
644500 -- [-999.742] (-998.125) (-998.858) (-997.354) * (-994.437) (-1004.352) [-995.871] (-993.701) -- 0:01:08
645000 -- (-997.808) [-994.715] (-1000.160) (-998.272) * (-994.215) (-1000.178) [-997.411] (-997.840) -- 0:01:08
Average standard deviation of split frequencies: 0.000730
645500 -- (-995.787) (-996.018) (-992.950) [-995.607] * (-994.455) [-994.025] (-993.580) (-997.737) -- 0:01:08
646000 -- (-1004.247) [-990.327] (-993.944) (-995.324) * (-996.750) [-993.831] (-992.012) (-996.877) -- 0:01:07
646500 -- [-992.580] (-994.846) (-995.356) (-995.839) * (-995.082) (-1001.104) [-994.888] (-996.306) -- 0:01:07
647000 -- (-996.731) [-995.799] (-996.758) (-995.624) * (-997.646) [-994.877] (-1002.556) (-996.608) -- 0:01:07
647500 -- (-994.575) (-995.234) [-991.733] (-997.010) * (-990.792) (-996.326) (-994.770) [-998.216] -- 0:01:07
648000 -- (-997.057) (-997.181) [-991.625] (-1001.512) * (-991.551) [-998.343] (-993.411) (-993.234) -- 0:01:07
648500 -- (-992.628) (-994.694) [-991.732] (-995.013) * (-999.298) (-991.851) (-994.753) [-996.272] -- 0:01:07
649000 -- (-996.229) (-1002.650) (-996.762) [-997.916] * [-997.687] (-997.957) (-996.562) (-992.886) -- 0:01:07
649500 -- (-998.315) [-993.091] (-993.430) (-999.896) * (-997.413) [-992.276] (-998.308) (-994.739) -- 0:01:06
650000 -- (-992.634) [-991.423] (-1002.779) (-992.993) * (-995.193) [-996.939] (-1001.499) (-994.467) -- 0:01:07
Average standard deviation of split frequencies: 0.000362
650500 -- (-994.951) [-991.647] (-1002.570) (-990.614) * (-990.867) (-992.897) [-995.341] (-994.370) -- 0:01:07
651000 -- (-993.520) (-996.342) (-997.697) [-991.285] * [-994.050] (-993.429) (-997.990) (-996.853) -- 0:01:07
651500 -- (-994.141) (-993.036) (-994.843) [-992.770] * (-996.315) (-997.823) [-996.133] (-996.426) -- 0:01:06
652000 -- (-998.477) (-993.807) (-994.946) [-993.056] * [-994.731] (-995.236) (-991.674) (-999.960) -- 0:01:06
652500 -- (-1001.781) (-996.608) (-998.041) [-992.758] * (-989.121) [-994.179] (-998.870) (-992.303) -- 0:01:06
653000 -- (-1000.064) (-994.611) [-994.763] (-995.703) * (-998.649) (-998.340) [-991.753] (-990.841) -- 0:01:06
653500 -- [-995.777] (-997.702) (-990.541) (-999.940) * [-995.408] (-998.453) (-993.576) (-994.359) -- 0:01:06
654000 -- (-994.657) (-996.035) [-992.775] (-998.365) * (-995.131) (-991.786) (-1002.471) [-991.686] -- 0:01:06
654500 -- (-990.617) (-993.482) [-991.885] (-995.111) * (-995.838) [-994.500] (-999.287) (-992.697) -- 0:01:05
655000 -- [-991.721] (-996.369) (-1000.562) (-999.245) * (-990.805) (-992.135) (-998.375) [-995.020] -- 0:01:06
Average standard deviation of split frequencies: 0.000359
655500 -- (-998.237) (-997.266) (-999.614) [-993.369] * (-997.932) (-995.605) [-1001.538] (-998.073) -- 0:01:06
656000 -- (-1001.306) (-992.962) [-994.544] (-990.890) * (-989.059) [-991.092] (-993.376) (-997.950) -- 0:01:06
656500 -- (-993.536) (-1000.875) (-996.199) [-993.030] * (-1001.350) [-995.881] (-997.699) (-1003.419) -- 0:01:05
657000 -- (-998.660) (-997.812) (-998.391) [-992.459] * [-996.589] (-993.355) (-1001.314) (-993.860) -- 0:01:05
657500 -- (-1006.096) [-991.810] (-991.716) (-994.595) * [-991.532] (-995.505) (-995.304) (-997.646) -- 0:01:05
658000 -- [-998.170] (-994.387) (-992.946) (-994.245) * (-997.294) (-997.346) (-1003.508) [-994.970] -- 0:01:05
658500 -- [-990.491] (-993.469) (-994.279) (-996.372) * (-998.007) (-998.290) (-1002.891) [-996.213] -- 0:01:05
659000 -- [-996.094] (-993.254) (-996.516) (-993.492) * (-995.336) (-1001.004) (-994.960) [-995.919] -- 0:01:05
659500 -- [-992.788] (-1001.189) (-1000.941) (-995.003) * [-996.763] (-995.340) (-995.202) (-990.594) -- 0:01:05
660000 -- [-995.120] (-997.400) (-1002.374) (-997.823) * (-995.680) (-994.506) (-1000.213) [-992.855] -- 0:01:05
Average standard deviation of split frequencies: 0.000000
660500 -- (-997.362) (-993.423) (-999.474) [-997.506] * [-992.322] (-992.471) (-996.216) (-993.872) -- 0:01:05
661000 -- [-989.893] (-991.502) (-997.273) (-994.477) * [-993.906] (-995.506) (-990.301) (-993.008) -- 0:01:05
661500 -- [-993.097] (-992.946) (-994.904) (-994.138) * (-994.934) (-1001.140) [-993.612] (-996.133) -- 0:01:04
662000 -- (-993.691) (-992.500) (-996.805) [-998.301] * (-992.700) (-997.047) (-994.289) [-991.508] -- 0:01:04
662500 -- (-996.689) (-993.867) (-1010.985) [-993.563] * (-996.721) (-991.987) [-997.571] (-994.359) -- 0:01:04
663000 -- (-999.995) (-996.946) (-991.551) [-996.119] * [-990.118] (-996.557) (-997.328) (-996.270) -- 0:01:04
663500 -- [-998.208] (-993.798) (-1000.642) (-996.687) * (-1001.965) [-993.827] (-999.515) (-997.476) -- 0:01:04
664000 -- (-989.667) (-1005.087) [-991.225] (-1004.941) * [-995.066] (-995.507) (-993.919) (-996.734) -- 0:01:04
664500 -- (-992.489) (-989.990) (-993.919) [-995.352] * (-999.978) [-992.091] (-996.587) (-995.790) -- 0:01:04
665000 -- (-996.803) [-993.279] (-1001.328) (-1000.046) * (-992.617) (-994.106) [-991.092] (-998.966) -- 0:01:04
Average standard deviation of split frequencies: 0.000000
665500 -- (-999.787) (-998.734) (-997.147) [-991.753] * (-993.578) [-1002.197] (-990.996) (-998.596) -- 0:01:04
666000 -- [-994.451] (-991.228) (-995.577) (-993.319) * [-992.835] (-999.018) (-991.261) (-1001.581) -- 0:01:04
666500 -- (-992.230) (-1000.911) [-996.914] (-999.935) * [-994.287] (-992.672) (-999.651) (-997.686) -- 0:01:04
667000 -- (-991.906) (-995.344) [-991.816] (-1002.292) * (-992.378) [-992.749] (-995.589) (-994.822) -- 0:01:03
667500 -- (-990.017) [-999.394] (-997.556) (-1000.590) * [-994.110] (-992.734) (-995.495) (-993.285) -- 0:01:03
668000 -- (-993.193) (-999.103) [-998.647] (-1000.462) * [-992.450] (-997.299) (-1000.406) (-992.649) -- 0:01:03
668500 -- (-990.872) [-990.743] (-995.217) (-995.932) * [-993.407] (-997.431) (-993.416) (-994.581) -- 0:01:03
669000 -- (-993.746) [-994.637] (-995.360) (-993.848) * [-989.847] (-997.387) (-998.271) (-996.905) -- 0:01:03
669500 -- [-994.517] (-993.477) (-996.175) (-997.396) * [-988.457] (-995.759) (-997.802) (-996.680) -- 0:01:03
670000 -- (-993.383) (-999.556) [-998.403] (-991.665) * (-995.436) (-992.103) (-995.688) [-993.234] -- 0:01:03
Average standard deviation of split frequencies: 0.000703
670500 -- [-993.765] (-1001.994) (-995.827) (-994.139) * (-993.890) [-995.902] (-998.216) (-997.370) -- 0:01:03
671000 -- (-994.138) (-993.332) [-1000.622] (-994.226) * (-992.800) [-997.345] (-991.921) (-996.203) -- 0:01:03
671500 -- (-996.017) (-993.454) (-999.423) [-990.114] * (-992.377) (-997.710) [-991.997] (-1000.685) -- 0:01:03
672000 -- (-998.868) [-992.765] (-997.879) (-993.343) * (-998.345) [-992.854] (-992.611) (-996.559) -- 0:01:02
672500 -- (-993.114) (-996.010) [-992.125] (-992.239) * (-995.485) (-994.930) [-993.792] (-997.402) -- 0:01:02
673000 -- (-1004.734) (-994.599) [-999.147] (-994.211) * (-992.214) [-992.306] (-991.660) (-999.963) -- 0:01:02
673500 -- (-997.354) [-996.706] (-997.963) (-998.133) * [-991.421] (-992.968) (-998.769) (-995.950) -- 0:01:02
674000 -- [-993.826] (-995.087) (-995.939) (-995.837) * (-998.631) [-991.889] (-1007.999) (-996.024) -- 0:01:02
674500 -- (-997.729) [-993.176] (-994.037) (-996.193) * [-994.089] (-994.211) (-996.036) (-999.475) -- 0:01:02
675000 -- [-993.024] (-996.837) (-996.463) (-999.076) * (-996.092) [-994.142] (-992.796) (-994.622) -- 0:01:02
Average standard deviation of split frequencies: 0.000697
675500 -- (-992.878) [-991.663] (-994.096) (-991.425) * (-992.857) [-995.450] (-991.076) (-995.073) -- 0:01:02
676000 -- (-998.619) [-996.964] (-990.437) (-991.060) * [-995.223] (-995.495) (-994.350) (-991.172) -- 0:01:02
676500 -- [-993.151] (-997.536) (-994.980) (-1002.407) * (-996.236) [-999.430] (-1004.481) (-991.003) -- 0:01:02
677000 -- (-991.106) (-993.723) (-991.763) [-992.799] * (-998.340) (-995.490) [-996.145] (-992.512) -- 0:01:02
677500 -- (-992.948) (-994.856) (-996.360) [-992.774] * (-1000.187) [-996.601] (-995.808) (-995.313) -- 0:01:01
678000 -- (-995.295) (-1001.158) (-996.007) [-995.574] * (-996.043) [-993.425] (-993.603) (-991.331) -- 0:01:01
678500 -- [-995.796] (-996.964) (-1002.562) (-998.857) * (-1002.679) [-991.507] (-993.437) (-995.131) -- 0:01:01
679000 -- (-993.216) [-990.866] (-996.801) (-991.966) * (-997.064) (-996.184) (-990.656) [-993.455] -- 0:01:01
679500 -- (-997.723) [-992.258] (-992.744) (-1001.086) * (-994.839) (-996.138) [-990.334] (-994.605) -- 0:01:01
680000 -- (-1006.909) (-993.752) (-989.013) [-996.540] * [-995.320] (-992.704) (-994.117) (-998.605) -- 0:01:01
Average standard deviation of split frequencies: 0.000000
680500 -- (-997.263) (-993.930) [-990.248] (-999.357) * (-999.164) [-993.090] (-997.004) (-991.641) -- 0:01:01
681000 -- [-995.297] (-993.947) (-992.023) (-999.690) * [-993.981] (-998.653) (-995.588) (-989.722) -- 0:01:01
681500 -- (-996.060) (-995.627) [-990.443] (-998.901) * (-994.242) (-994.842) [-993.265] (-993.459) -- 0:01:01
682000 -- (-998.355) (-991.148) [-993.788] (-996.392) * [-992.641] (-997.312) (-994.068) (-995.146) -- 0:01:01
682500 -- (-999.283) (-994.183) [-993.918] (-999.736) * [-992.466] (-994.908) (-994.435) (-990.518) -- 0:01:00
683000 -- (-994.277) (-991.608) [-992.199] (-997.177) * [-992.336] (-993.370) (-997.674) (-1003.219) -- 0:01:00
683500 -- [-990.226] (-998.112) (-999.751) (-1002.411) * (-997.395) [-1000.456] (-1000.260) (-996.403) -- 0:01:00
684000 -- (-998.390) (-994.361) [-995.804] (-994.444) * (-995.741) (-997.192) [-994.423] (-1003.735) -- 0:01:00
684500 -- (-996.844) (-997.948) (-995.386) [-996.758] * (-996.194) (-996.498) [-994.904] (-998.212) -- 0:01:00
685000 -- (-993.231) (-990.033) (-992.395) [-993.300] * (-994.509) (-1002.359) (-994.584) [-992.286] -- 0:01:00
Average standard deviation of split frequencies: 0.000344
685500 -- (-992.138) (-995.417) (-994.237) [-999.157] * (-996.667) (-1006.950) [-997.196] (-991.078) -- 0:01:00
686000 -- (-999.366) [-991.080] (-992.999) (-996.704) * (-1000.116) (-997.786) [-990.315] (-988.966) -- 0:01:00
686500 -- (-995.966) [-997.003] (-999.440) (-995.899) * (-995.768) (-994.705) (-993.092) [-993.277] -- 0:01:00
687000 -- [-991.700] (-1000.114) (-989.658) (-995.289) * (-992.576) (-996.895) (-993.411) [-996.688] -- 0:01:00
687500 -- (-995.166) (-988.070) [-999.375] (-989.493) * [-994.220] (-989.940) (-991.858) (-991.576) -- 0:01:00
688000 -- [-992.245] (-994.053) (-995.608) (-994.444) * (-1003.431) (-999.745) (-1003.662) [-996.506] -- 0:00:59
688500 -- (-992.360) [-996.380] (-994.335) (-993.286) * (-1000.766) (-994.604) [-997.110] (-1000.246) -- 0:00:59
689000 -- (-993.146) [-994.973] (-999.489) (-991.565) * (-998.828) (-993.135) [-996.650] (-998.574) -- 0:01:00
689500 -- (-995.172) (-994.363) [-1000.044] (-995.035) * [-1001.737] (-991.838) (-997.064) (-998.293) -- 0:00:59
690000 -- [-994.829] (-997.693) (-993.981) (-994.051) * [-1000.343] (-1004.642) (-1000.619) (-995.107) -- 0:00:59
Average standard deviation of split frequencies: 0.000341
690500 -- [-997.846] (-995.515) (-998.823) (-995.184) * (-1004.539) (-994.351) [-993.791] (-995.509) -- 0:00:59
691000 -- (-992.968) [-992.610] (-998.378) (-993.950) * (-1003.671) (-999.337) [-995.049] (-1001.774) -- 0:00:59
691500 -- (-995.997) [-995.447] (-1003.099) (-997.127) * (-998.626) (-999.218) (-998.999) [-994.620] -- 0:00:59
692000 -- (-995.852) (-992.238) (-1000.157) [-991.043] * (-993.816) (-1000.725) (-999.195) [-996.045] -- 0:00:59
692500 -- [-992.336] (-992.801) (-998.396) (-994.959) * [-990.165] (-992.879) (-1003.539) (-997.447) -- 0:00:59
693000 -- (-998.775) (-998.900) (-994.895) [-992.502] * (-996.799) (-993.820) (-992.877) [-998.401] -- 0:00:58
693500 -- (-999.054) (-999.801) (-994.306) [-991.738] * (-992.343) (-994.920) [-996.405] (-993.231) -- 0:00:58
694000 -- (-997.237) [-996.597] (-997.554) (-994.873) * (-992.397) [-992.300] (-995.716) (-995.493) -- 0:00:58
694500 -- (-989.658) [-1000.557] (-992.007) (-993.861) * (-995.736) [-996.515] (-994.110) (-995.958) -- 0:00:58
695000 -- (-998.730) (-990.024) (-1000.002) [-996.684] * [-992.831] (-997.210) (-1000.262) (-999.099) -- 0:00:58
Average standard deviation of split frequencies: 0.000339
695500 -- (-992.488) [-991.620] (-995.115) (-1004.333) * [-995.684] (-998.355) (-996.364) (-999.180) -- 0:00:58
696000 -- [-991.876] (-993.891) (-998.922) (-999.211) * (-993.481) [-993.074] (-991.344) (-998.586) -- 0:00:58
696500 -- [-995.441] (-1000.055) (-993.098) (-998.725) * [-990.418] (-993.832) (-997.512) (-998.898) -- 0:00:58
697000 -- (-994.427) (-996.574) (-995.548) [-994.098] * [-993.764] (-993.090) (-997.637) (-994.717) -- 0:00:58
697500 -- (-999.650) [-993.906] (-1001.646) (-1002.427) * (-994.944) [-994.152] (-997.825) (-994.571) -- 0:00:58
698000 -- (-998.228) (-992.032) [-1002.646] (-996.163) * (-1004.201) (-991.833) [-996.642] (-998.350) -- 0:00:57
698500 -- (-997.724) (-996.365) (-1000.855) [-998.380] * (-998.448) (-996.955) [-992.991] (-994.430) -- 0:00:57
699000 -- [-994.763] (-995.901) (-998.952) (-998.227) * (-997.183) (-996.752) (-993.199) [-995.344] -- 0:00:57
699500 -- [-992.325] (-994.740) (-991.536) (-991.345) * (-995.590) (-999.411) [-992.186] (-996.740) -- 0:00:57
700000 -- (-999.582) [-990.668] (-998.402) (-991.701) * (-994.594) (-995.018) (-995.281) [-994.577] -- 0:00:57
Average standard deviation of split frequencies: 0.000673
700500 -- (-997.443) (-991.324) (-995.024) [-991.485] * (-1000.927) (-993.299) [-996.314] (-1001.254) -- 0:00:57
701000 -- (-995.709) (-992.774) [-990.696] (-1002.037) * [-989.949] (-993.712) (-997.706) (-993.744) -- 0:00:57
701500 -- (-996.681) [-989.952] (-996.837) (-996.906) * (-990.996) [-991.115] (-993.569) (-999.933) -- 0:00:57
702000 -- [-994.333] (-989.297) (-1004.280) (-993.192) * (-1001.694) (-998.832) (-993.618) [-994.762] -- 0:00:57
702500 -- (-996.549) (-993.460) [-992.559] (-999.866) * (-993.606) [-995.931] (-997.483) (-1003.931) -- 0:00:57
703000 -- (-996.704) [-1001.201] (-994.582) (-1001.896) * (-998.916) [-992.192] (-996.367) (-999.282) -- 0:00:57
703500 -- (-998.410) (-997.036) (-997.306) [-995.428] * (-996.493) [-995.355] (-998.015) (-1001.740) -- 0:00:56
704000 -- (-998.739) [-993.476] (-1001.374) (-994.534) * (-992.738) (-996.714) [-996.987] (-1007.882) -- 0:00:56
704500 -- (-999.426) (-995.679) [-994.575] (-1002.301) * [-993.951] (-992.485) (-996.823) (-995.982) -- 0:00:56
705000 -- [-994.501] (-1000.865) (-991.082) (-997.798) * (-996.062) (-990.573) [-998.402] (-997.505) -- 0:00:56
Average standard deviation of split frequencies: 0.000668
705500 -- (-996.575) [-996.941] (-997.661) (-994.614) * [-993.828] (-999.110) (-996.510) (-994.861) -- 0:00:56
706000 -- (-994.055) (-995.706) [-990.935] (-998.385) * (-995.466) [-990.948] (-996.790) (-999.796) -- 0:00:56
706500 -- [-996.758] (-990.884) (-996.984) (-999.107) * (-992.746) (-998.171) [-991.361] (-997.676) -- 0:00:56
707000 -- (-994.329) [-996.834] (-992.909) (-1005.203) * (-993.760) (-992.166) [-994.735] (-993.856) -- 0:00:56
707500 -- (-999.265) [-1003.865] (-993.341) (-998.867) * (-993.099) [-990.203] (-996.752) (-996.156) -- 0:00:56
708000 -- [-993.211] (-1005.489) (-996.355) (-997.400) * (-991.509) (-1006.036) (-1000.637) [-990.019] -- 0:00:56
708500 -- [-991.789] (-1000.953) (-992.506) (-997.147) * (-995.434) (-995.007) [-992.858] (-992.758) -- 0:00:55
709000 -- (-991.559) (-995.812) (-998.008) [-993.851] * (-994.185) (-993.643) (-995.572) [-993.657] -- 0:00:55
709500 -- [-993.701] (-996.576) (-993.348) (-992.124) * (-997.992) [-994.473] (-990.744) (-993.602) -- 0:00:55
710000 -- (-998.864) [-996.772] (-993.797) (-993.831) * (-992.622) (-996.384) [-993.232] (-994.529) -- 0:00:55
Average standard deviation of split frequencies: 0.000663
710500 -- (-991.637) (-1002.145) (-990.350) [-993.706] * [-997.761] (-998.314) (-999.049) (-994.627) -- 0:00:55
711000 -- (-996.395) [-996.025] (-995.399) (-991.959) * (-995.668) [-992.629] (-992.859) (-994.115) -- 0:00:55
711500 -- [-995.302] (-999.658) (-995.124) (-994.802) * (-994.653) [-993.917] (-996.610) (-996.732) -- 0:00:55
712000 -- (-1005.121) (-997.422) (-995.003) [-994.473] * (-995.449) (-1003.446) (-999.767) [-994.566] -- 0:00:55
712500 -- (-1001.947) (-996.104) (-997.970) [-996.333] * [-992.491] (-996.180) (-995.649) (-994.864) -- 0:00:55
713000 -- [-993.539] (-993.117) (-1005.551) (-996.392) * (-997.801) (-991.363) (-994.179) [-995.346] -- 0:00:55
713500 -- (-990.116) (-990.851) [-992.783] (-999.288) * (-994.673) (-994.502) (-993.947) [-993.505] -- 0:00:55
714000 -- (-995.629) (-991.080) (-997.530) [-998.486] * (-999.491) [-995.089] (-994.185) (-998.258) -- 0:00:54
714500 -- [-1001.715] (-994.265) (-998.109) (-1001.292) * [-989.430] (-999.432) (-991.857) (-1000.636) -- 0:00:54
715000 -- (-1001.620) (-995.632) (-1003.116) [-992.513] * (-1000.488) (-998.465) (-997.423) [-996.624] -- 0:00:54
Average standard deviation of split frequencies: 0.000658
715500 -- (-992.380) (-996.496) (-1004.097) [-992.272] * (-996.830) (-998.693) (-1000.990) [-1002.713] -- 0:00:54
716000 -- (-997.297) (-1002.639) (-1004.780) [-991.839] * (-994.712) (-993.540) (-991.369) [-1000.245] -- 0:00:54
716500 -- (-997.102) (-1000.822) (-1000.658) [-991.524] * (-994.898) (-997.071) (-993.599) [-992.339] -- 0:00:54
717000 -- (-993.105) (-994.406) [-994.419] (-997.526) * (-1004.913) (-992.918) (-998.870) [-995.675] -- 0:00:54
717500 -- [-993.272] (-994.399) (-995.771) (-992.737) * (-1004.315) (-992.243) (-994.027) [-994.636] -- 0:00:54
718000 -- (-993.777) [-992.205] (-1006.680) (-998.460) * (-998.350) (-991.057) (-997.386) [-993.006] -- 0:00:54
718500 -- (-997.673) (-991.684) (-1008.744) [-999.950] * (-1001.664) (-992.062) [-993.904] (-994.975) -- 0:00:54
719000 -- (-995.902) (-990.937) [-1006.335] (-998.289) * (-995.249) [-991.542] (-995.883) (-995.693) -- 0:00:53
719500 -- (-990.808) (-992.569) (-1003.108) [-1003.738] * (-998.903) (-996.283) [-995.914] (-1001.442) -- 0:00:53
720000 -- (-994.041) (-1004.016) (-997.441) [-991.965] * (-997.912) [-992.647] (-993.154) (-997.817) -- 0:00:53
Average standard deviation of split frequencies: 0.000000
720500 -- (-996.423) (-1002.060) (-993.836) [-990.782] * (-995.946) (-994.896) [-992.799] (-992.021) -- 0:00:53
721000 -- [-994.687] (-995.893) (-1000.101) (-997.889) * [-1003.359] (-996.496) (-989.296) (-993.714) -- 0:00:53
721500 -- (-997.585) [-994.408] (-997.239) (-998.766) * (-1001.191) [-993.178] (-991.966) (-996.449) -- 0:00:53
722000 -- [-995.643] (-997.213) (-996.814) (-1005.537) * (-1001.842) (-997.690) (-991.707) [-993.749] -- 0:00:53
722500 -- [-1000.562] (-1003.084) (-999.169) (-994.100) * (-1002.497) (-1001.899) [-995.335] (-992.818) -- 0:00:53
723000 -- (-995.286) (-1001.402) [-991.551] (-1002.981) * [-1000.616] (-998.628) (-992.784) (-996.841) -- 0:00:53
723500 -- (-996.820) (-995.775) (-990.656) [-995.284] * (-999.615) (-1002.730) [-993.188] (-1001.741) -- 0:00:53
724000 -- (-1002.626) (-997.079) [-997.214] (-992.282) * (-1001.069) (-991.355) (-996.929) [-993.894] -- 0:00:52
724500 -- (-995.968) [-998.766] (-1000.187) (-1000.025) * (-1008.211) (-996.949) (-994.740) [-995.936] -- 0:00:52
725000 -- [-995.560] (-1000.375) (-999.133) (-993.817) * (-998.900) (-995.958) [-998.540] (-1001.201) -- 0:00:52
Average standard deviation of split frequencies: 0.000000
725500 -- (-999.193) (-998.772) [-994.305] (-991.441) * (-994.144) [-994.672] (-998.101) (-998.316) -- 0:00:52
726000 -- [-996.447] (-997.497) (-994.464) (-994.110) * [-990.532] (-994.823) (-1005.805) (-994.364) -- 0:00:52
726500 -- (-992.873) (-998.942) [-995.168] (-994.525) * (-999.265) (-994.977) [-999.926] (-999.741) -- 0:00:52
727000 -- (-996.945) (-999.564) [-998.850] (-992.125) * [-997.561] (-993.078) (-1003.885) (-998.631) -- 0:00:52
727500 -- (-996.872) [-995.369] (-1002.410) (-992.708) * (-997.946) [-994.194] (-1004.053) (-998.826) -- 0:00:52
728000 -- (-1005.222) (-998.965) (-991.930) [-998.169] * (-1001.788) (-990.498) (-1003.565) [-993.617] -- 0:00:52
728500 -- (-992.049) [-989.560] (-995.464) (-995.568) * (-1000.849) (-991.531) [-1000.023] (-996.737) -- 0:00:52
729000 -- [-994.349] (-996.997) (-1000.808) (-1002.402) * (-993.529) [-993.925] (-1000.372) (-995.320) -- 0:00:52
729500 -- (-993.333) [-999.104] (-995.302) (-998.711) * (-993.780) (-993.581) [-994.229] (-993.542) -- 0:00:51
730000 -- (-994.225) [-990.728] (-993.046) (-996.116) * [-994.547] (-995.516) (-993.171) (-994.407) -- 0:00:51
Average standard deviation of split frequencies: 0.000323
730500 -- [-998.568] (-995.572) (-991.815) (-997.236) * [-1000.313] (-994.235) (-995.657) (-989.071) -- 0:00:51
731000 -- [-996.716] (-994.455) (-992.820) (-996.126) * (-993.755) (-993.789) [-993.808] (-992.489) -- 0:00:51
731500 -- (-998.765) (-998.180) (-994.216) [-994.324] * (-989.887) (-991.501) [-997.852] (-1000.422) -- 0:00:51
732000 -- (-995.723) (-999.430) (-990.736) [-992.928] * (-995.547) [-998.120] (-1002.907) (-998.373) -- 0:00:51
732500 -- (-996.454) (-992.019) (-992.702) [-996.674] * (-996.736) (-996.105) [-991.955] (-995.894) -- 0:00:51
733000 -- (-995.043) (-989.763) [-996.317] (-995.531) * (-997.207) [-990.465] (-993.221) (-992.217) -- 0:00:51
733500 -- (-998.263) (-992.579) [-991.161] (-994.313) * (-998.406) (-993.524) (-990.436) [-989.502] -- 0:00:51
734000 -- [-993.512] (-996.353) (-991.023) (-997.286) * (-994.146) [-991.542] (-994.014) (-998.457) -- 0:00:51
734500 -- (-996.570) (-996.936) (-997.823) [-997.150] * (-995.450) (-991.937) [-997.815] (-993.836) -- 0:00:50
735000 -- (-995.835) (-991.454) (-990.870) [-990.207] * [-995.477] (-995.558) (-994.951) (-1002.493) -- 0:00:50
Average standard deviation of split frequencies: 0.000640
735500 -- (-1000.327) (-994.918) (-994.392) [-997.169] * (-997.302) (-991.227) [-994.344] (-992.018) -- 0:00:50
736000 -- (-1001.239) (-992.930) (-991.773) [-989.881] * (-998.442) (-995.078) (-996.717) [-992.619] -- 0:00:50
736500 -- (-996.121) (-997.851) (-1001.306) [-994.091] * (-1001.491) (-997.334) [-993.776] (-998.395) -- 0:00:50
737000 -- (-995.005) [-989.560] (-1004.556) (-994.623) * [-996.466] (-999.517) (-992.839) (-999.508) -- 0:00:50
737500 -- [-994.585] (-991.698) (-1004.094) (-999.044) * [-996.777] (-999.077) (-997.680) (-1003.488) -- 0:00:50
738000 -- (-995.695) (-991.100) (-996.030) [-992.270] * [-994.746] (-998.387) (-995.303) (-999.728) -- 0:00:50
738500 -- [-995.829] (-995.063) (-997.957) (-1001.089) * [-1001.877] (-1000.848) (-992.972) (-991.721) -- 0:00:50
739000 -- (-1004.005) (-1000.361) (-997.346) [-991.815] * (-993.930) (-1002.397) [-991.964] (-995.355) -- 0:00:50
739500 -- [-996.281] (-988.933) (-995.224) (-1003.443) * [-990.606] (-1000.196) (-1003.336) (-990.741) -- 0:00:50
740000 -- (-1001.765) (-994.742) (-995.404) [-992.632] * (-1001.620) (-997.594) [-996.467] (-993.085) -- 0:00:49
Average standard deviation of split frequencies: 0.000636
740500 -- (-999.108) (-990.353) [-995.243] (-992.546) * [-1000.176] (-1005.177) (-993.318) (-997.625) -- 0:00:49
741000 -- (-993.062) [-988.085] (-993.992) (-999.826) * [-994.148] (-1003.720) (-1006.038) (-995.639) -- 0:00:49
741500 -- (-996.357) [-992.056] (-993.957) (-1000.003) * (-998.415) (-996.377) (-1006.190) [-996.780] -- 0:00:49
742000 -- [-995.885] (-1000.484) (-995.504) (-992.785) * (-993.760) [-997.890] (-1003.747) (-1000.183) -- 0:00:49
742500 -- (-990.945) (-995.942) (-1002.942) [-994.073] * (-994.644) (-999.938) (-1001.159) [-990.399] -- 0:00:49
743000 -- [-991.924] (-993.300) (-1002.756) (-1002.422) * (-994.508) [-997.323] (-1000.452) (-996.270) -- 0:00:49
743500 -- (-996.096) (-1000.299) [-992.113] (-996.568) * [-992.223] (-997.586) (-1005.361) (-994.983) -- 0:00:49
744000 -- [-994.674] (-998.385) (-993.864) (-992.219) * [-998.293] (-1000.699) (-999.493) (-1000.490) -- 0:00:49
744500 -- (-995.049) (-997.516) [-998.706] (-999.662) * (-994.121) (-1003.303) (-995.408) [-993.865] -- 0:00:49
745000 -- (-998.428) [-993.717] (-993.185) (-996.608) * (-997.063) (-994.798) [-991.599] (-997.290) -- 0:00:48
Average standard deviation of split frequencies: 0.000948
745500 -- (-991.584) [-995.456] (-997.401) (-1000.109) * [-997.237] (-997.675) (-994.856) (-994.995) -- 0:00:48
746000 -- (-996.564) [-996.427] (-994.789) (-1004.905) * (-996.595) (-999.763) (-996.306) [-991.113] -- 0:00:48
746500 -- (-993.739) [-994.366] (-992.918) (-994.315) * (-1001.956) (-999.320) (-995.731) [-990.985] -- 0:00:48
747000 -- (-997.532) (-998.029) (-991.087) [-990.746] * (-997.723) (-992.750) (-994.526) [-997.756] -- 0:00:48
747500 -- (-993.317) (-995.938) (-997.960) [-991.040] * (-993.231) [-992.605] (-1004.096) (-996.429) -- 0:00:48
748000 -- (-997.474) (-994.188) (-994.983) [-993.957] * [-990.236] (-994.669) (-994.356) (-1005.151) -- 0:00:48
748500 -- [-994.506] (-995.559) (-996.688) (-995.237) * (-992.535) [-997.334] (-993.450) (-994.667) -- 0:00:48
749000 -- (-993.334) (-1000.038) (-995.775) [-990.591] * (-996.367) (-992.590) [-992.887] (-992.042) -- 0:00:48
749500 -- (-1000.474) [-997.282] (-996.771) (-994.704) * (-992.071) [-994.909] (-993.813) (-996.648) -- 0:00:48
750000 -- [-1000.952] (-999.195) (-996.651) (-997.695) * (-1000.873) [-996.122] (-995.632) (-995.663) -- 0:00:48
Average standard deviation of split frequencies: 0.000942
750500 -- (-994.703) [-993.002] (-999.303) (-993.487) * (-994.181) (-998.455) [-995.727] (-999.621) -- 0:00:48
751000 -- (-998.377) (-1001.259) (-994.104) [-993.498] * (-998.477) (-1001.392) (-995.007) [-995.315] -- 0:00:48
751500 -- (-995.748) [-996.508] (-993.373) (-996.812) * (-994.585) (-994.650) (-995.351) [-998.621] -- 0:00:47
752000 -- (-1001.137) (-993.185) (-997.003) [-998.889] * (-996.978) (-995.872) (-997.314) [-994.876] -- 0:00:47
752500 -- (-994.088) [-990.406] (-999.542) (-994.175) * [-993.512] (-993.016) (-998.867) (-998.885) -- 0:00:47
753000 -- [-996.386] (-993.039) (-996.230) (-996.672) * (-995.149) (-994.948) [-997.491] (-996.376) -- 0:00:47
753500 -- [-994.263] (-996.403) (-995.874) (-1004.281) * (-996.974) [-993.475] (-997.705) (-995.713) -- 0:00:47
754000 -- (-1004.290) [-994.361] (-997.759) (-1001.460) * (-1002.362) [-990.579] (-992.686) (-996.016) -- 0:00:47
754500 -- [-990.061] (-1000.540) (-999.700) (-1002.333) * (-994.204) [-998.623] (-996.965) (-999.530) -- 0:00:47
755000 -- (-994.638) (-1000.217) [-994.704] (-1002.468) * (-993.943) (-993.412) (-993.086) [-993.874] -- 0:00:47
Average standard deviation of split frequencies: 0.000624
755500 -- (-994.190) (-1006.446) [-1003.531] (-997.473) * (-996.879) [-994.343] (-1002.985) (-1001.902) -- 0:00:47
756000 -- (-997.708) (-1004.567) (-998.836) [-994.951] * (-995.299) (-991.882) (-1000.445) [-992.594] -- 0:00:47
756500 -- [-996.445] (-1002.909) (-999.050) (-996.516) * (-996.507) [-997.855] (-1003.874) (-992.891) -- 0:00:46
757000 -- (-996.416) (-1010.779) [-997.905] (-993.538) * [-998.562] (-998.489) (-1000.630) (-1001.660) -- 0:00:46
757500 -- [-995.810] (-1004.246) (-991.390) (-994.470) * (-993.913) (-1000.912) (-992.641) [-993.761] -- 0:00:46
758000 -- [-992.198] (-1001.136) (-991.839) (-996.563) * [-995.060] (-996.984) (-992.767) (-1003.417) -- 0:00:46
758500 -- (-993.958) (-994.303) [-995.002] (-1001.097) * (-996.545) (-993.143) (-991.966) [-992.761] -- 0:00:46
759000 -- (-997.744) (-997.717) [-998.083] (-995.525) * (-999.242) (-995.346) [-994.824] (-991.398) -- 0:00:46
759500 -- [-991.056] (-999.798) (-994.371) (-992.889) * [-995.394] (-993.692) (-995.006) (-995.233) -- 0:00:46
760000 -- [-997.056] (-997.790) (-1001.919) (-994.263) * [-991.849] (-994.572) (-1001.816) (-997.272) -- 0:00:46
Average standard deviation of split frequencies: 0.000620
760500 -- (-996.235) [-999.235] (-1000.612) (-995.550) * (-996.812) (-995.529) [-993.147] (-1001.751) -- 0:00:46
761000 -- (-998.999) (-997.344) (-997.836) [-999.569] * (-998.198) (-996.928) [-995.313] (-991.876) -- 0:00:46
761500 -- (-993.420) (-995.139) (-997.849) [-991.836] * (-997.109) (-993.573) [-1004.662] (-991.689) -- 0:00:46
762000 -- (-993.577) (-990.982) (-997.458) [-1000.239] * [-995.624] (-995.451) (-998.929) (-996.008) -- 0:00:45
762500 -- (-992.156) [-993.130] (-994.720) (-991.878) * (-996.734) (-994.782) (-996.395) [-994.366] -- 0:00:45
763000 -- (-995.182) (-993.791) [-996.765] (-988.219) * (-997.017) [-989.325] (-989.969) (-989.918) -- 0:00:45
763500 -- [-993.726] (-992.616) (-998.896) (-996.266) * (-1006.879) (-992.477) [-997.471] (-994.152) -- 0:00:45
764000 -- [-999.158] (-994.152) (-995.750) (-998.513) * (-994.726) (-996.577) [-995.468] (-997.905) -- 0:00:45
764500 -- (-994.772) [-990.434] (-1001.001) (-998.779) * [-997.049] (-997.697) (-993.714) (-997.066) -- 0:00:45
765000 -- (-995.557) (-993.184) (-994.603) [-991.846] * (-1000.511) (-992.267) (-997.843) [-1000.681] -- 0:00:45
Average standard deviation of split frequencies: 0.000308
765500 -- (-991.430) (-993.975) (-995.617) [-993.673] * (-997.200) (-993.694) (-997.235) [-991.977] -- 0:00:45
766000 -- (-996.767) [-991.558] (-995.674) (-990.943) * (-997.840) (-1000.693) (-995.247) [-995.122] -- 0:00:45
766500 -- (-999.929) (-993.479) [-994.100] (-996.253) * (-1006.220) [-993.982] (-996.724) (-996.626) -- 0:00:45
767000 -- [-994.111] (-994.280) (-994.603) (-991.654) * (-997.024) [-991.084] (-1000.708) (-994.542) -- 0:00:44
767500 -- [-991.670] (-993.875) (-992.171) (-998.666) * (-1001.266) (-1000.507) [-993.786] (-999.345) -- 0:00:44
768000 -- [-992.834] (-998.601) (-995.556) (-1002.528) * (-996.326) (-994.628) [-992.810] (-998.358) -- 0:00:44
768500 -- (-997.378) (-998.369) (-1000.250) [-991.771] * (-998.718) [-992.148] (-990.823) (-992.992) -- 0:00:44
769000 -- [-997.724] (-992.704) (-997.435) (-991.816) * (-1001.874) (-993.353) [-991.178] (-996.502) -- 0:00:44
769500 -- (-993.704) [-1005.723] (-1008.742) (-991.436) * (-995.444) (-993.420) (-991.879) [-989.542] -- 0:00:44
770000 -- [-990.008] (-996.897) (-1002.300) (-1000.030) * (-994.357) (-992.074) [-991.150] (-998.678) -- 0:00:44
Average standard deviation of split frequencies: 0.000306
770500 -- (-996.574) (-993.447) [-995.735] (-991.946) * (-997.639) (-996.313) [-992.105] (-1000.016) -- 0:00:44
771000 -- (-992.146) [-993.968] (-997.342) (-994.185) * (-995.483) [-988.835] (-994.374) (-991.426) -- 0:00:44
771500 -- (-994.946) (-999.042) (-997.382) [-991.454] * (-995.680) [-997.689] (-995.061) (-997.929) -- 0:00:44
772000 -- (-995.280) [-997.701] (-993.573) (-998.021) * (-997.374) (-1003.204) (-999.177) [-993.291] -- 0:00:44
772500 -- (-995.087) (-996.929) (-995.432) [-997.561] * [-997.543] (-995.334) (-993.511) (-1000.210) -- 0:00:43
773000 -- [-992.386] (-997.627) (-996.446) (-991.556) * (-998.328) [-994.840] (-994.093) (-1004.869) -- 0:00:43
773500 -- (-995.096) (-1003.835) (-995.440) [-992.407] * (-996.747) [-993.012] (-996.422) (-997.791) -- 0:00:43
774000 -- (-1000.080) (-998.975) (-998.693) [-993.947] * [-999.754] (-992.261) (-991.316) (-996.895) -- 0:00:43
774500 -- [-989.021] (-995.105) (-989.204) (-998.932) * (-999.722) (-1000.068) [-993.804] (-995.387) -- 0:00:43
775000 -- (-993.833) (-1010.496) [-994.677] (-994.011) * [-991.650] (-1000.598) (-991.719) (-997.645) -- 0:00:43
Average standard deviation of split frequencies: 0.000304
775500 -- (-999.568) [-994.051] (-997.139) (-992.149) * (-997.171) [-999.723] (-993.439) (-995.941) -- 0:00:43
776000 -- (-993.228) [-999.009] (-994.219) (-1002.496) * (-994.105) (-1000.371) (-993.733) [-991.747] -- 0:00:43
776500 -- (-994.583) [-994.427] (-995.337) (-1009.921) * [-997.967] (-995.644) (-996.027) (-995.597) -- 0:00:43
777000 -- (-992.822) (-993.631) [-992.437] (-1002.433) * (-1000.261) (-1000.270) [-999.653] (-994.460) -- 0:00:43
777500 -- (-1000.611) (-996.193) (-993.914) [-993.342] * [-994.660] (-1000.613) (-993.957) (-996.307) -- 0:00:42
778000 -- (-990.585) (-991.955) (-996.639) [-996.118] * (-998.420) [-993.301] (-991.145) (-994.199) -- 0:00:42
778500 -- (-991.500) (-995.321) [-997.097] (-993.602) * (-999.782) (-996.024) [-995.033] (-997.787) -- 0:00:42
779000 -- (-995.922) (-989.413) (-1000.061) [-991.738] * (-993.579) [-994.277] (-996.041) (-996.541) -- 0:00:42
779500 -- [-994.978] (-993.598) (-993.930) (-995.332) * (-992.690) (-994.084) (-994.608) [-994.582] -- 0:00:42
780000 -- [-995.937] (-998.700) (-990.348) (-1003.800) * (-994.490) (-994.351) [-998.689] (-995.568) -- 0:00:42
Average standard deviation of split frequencies: 0.000000
780500 -- (-994.730) (-993.726) (-994.875) [-992.741] * [-992.592] (-993.722) (-992.783) (-990.871) -- 0:00:42
781000 -- [-992.824] (-995.366) (-992.544) (-999.990) * [-990.100] (-996.226) (-996.757) (-1000.629) -- 0:00:42
781500 -- [-998.741] (-996.971) (-997.830) (-996.057) * (-1002.233) [-995.257] (-992.707) (-995.973) -- 0:00:42
782000 -- (-991.208) [-991.886] (-1001.521) (-995.818) * (-995.213) (-994.541) (-993.765) [-998.732] -- 0:00:42
782500 -- (-994.844) (-996.907) [-994.636] (-997.949) * (-998.997) [-991.206] (-993.024) (-990.800) -- 0:00:41
783000 -- (-995.462) [-994.227] (-992.346) (-994.334) * [-998.586] (-991.232) (-992.349) (-991.363) -- 0:00:41
783500 -- (-996.787) (-993.419) (-996.933) [-989.323] * (-994.740) (-990.917) (-1001.089) [-992.501] -- 0:00:41
784000 -- (-998.954) [-992.161] (-989.863) (-989.689) * [-992.960] (-992.574) (-993.040) (-1001.758) -- 0:00:41
784500 -- (-995.246) (-995.290) (-995.385) [-994.033] * (-1001.089) [-992.851] (-1005.668) (-996.093) -- 0:00:41
785000 -- (-995.096) [-997.634] (-995.015) (-995.750) * (-994.847) (-1001.304) (-999.852) [-989.987] -- 0:00:41
Average standard deviation of split frequencies: 0.000000
785500 -- (-999.590) [-997.223] (-994.936) (-995.016) * (-999.426) [-993.968] (-1000.349) (-993.444) -- 0:00:41
786000 -- [-991.231] (-995.001) (-991.166) (-997.024) * (-998.242) (-997.205) (-1001.402) [-994.408] -- 0:00:41
786500 -- (-997.956) (-1004.030) [-991.338] (-991.318) * (-1002.577) [-993.530] (-993.437) (-992.768) -- 0:00:40
787000 -- (-995.037) (-1006.709) (-994.797) [-991.502] * (-992.749) (-999.585) [-993.557] (-997.017) -- 0:00:41
787500 -- (-995.830) (-1002.290) (-991.531) [-997.988] * (-993.986) (-1002.518) (-996.876) [-992.585] -- 0:00:41
788000 -- (-994.436) (-999.886) [-991.234] (-993.845) * [-990.804] (-989.302) (-995.745) (-995.446) -- 0:00:40
788500 -- (-991.428) [-991.600] (-995.196) (-1000.203) * (-992.167) [-994.126] (-995.479) (-991.608) -- 0:00:40
789000 -- (-999.877) (-994.161) (-992.579) [-994.040] * [-994.326] (-994.489) (-995.813) (-995.228) -- 0:00:40
789500 -- (-990.783) [-992.561] (-999.895) (-999.208) * (-991.573) (-989.512) (-992.304) [-999.376] -- 0:00:40
790000 -- [-990.807] (-994.450) (-999.677) (-995.451) * (-996.076) (-994.138) [-997.703] (-998.322) -- 0:00:40
Average standard deviation of split frequencies: 0.000000
790500 -- (-995.422) (-996.681) [-997.987] (-995.068) * (-994.870) (-996.654) (-996.561) [-998.433] -- 0:00:40
791000 -- (-990.490) (-996.586) [-992.438] (-994.924) * (-1002.051) [-994.792] (-1002.390) (-998.329) -- 0:00:40
791500 -- (-999.964) [-993.102] (-995.126) (-999.245) * (-1004.942) (-998.530) (-998.103) [-996.091] -- 0:00:40
792000 -- (-996.606) (-994.453) [-992.688] (-1000.542) * (-1004.796) (-999.500) (-993.577) [-993.736] -- 0:00:39
792500 -- (-995.783) (-994.365) (-997.448) [-995.885] * (-1005.443) (-995.435) [-1001.098] (-992.631) -- 0:00:40
793000 -- [-997.611] (-990.695) (-993.721) (-1001.549) * (-1003.564) (-992.216) [-993.439] (-992.151) -- 0:00:39
793500 -- (-1000.393) (-991.841) [-992.095] (-992.392) * [-995.673] (-993.816) (-996.459) (-992.291) -- 0:00:39
794000 -- (-996.900) (-995.918) (-995.777) [-995.394] * (-995.886) (-995.631) (-1000.271) [-994.065] -- 0:00:39
794500 -- [-995.051] (-999.966) (-992.425) (-991.655) * [-991.779] (-996.510) (-1001.916) (-994.224) -- 0:00:39
795000 -- [-990.958] (-995.777) (-998.637) (-992.777) * (-999.859) (-991.127) (-993.414) [-997.185] -- 0:00:39
Average standard deviation of split frequencies: 0.000592
795500 -- (-995.143) (-997.159) (-993.275) [-988.166] * (-998.470) [-992.114] (-997.740) (-1002.234) -- 0:00:39
796000 -- (-995.058) [-992.782] (-1002.056) (-991.563) * (-1000.654) (-997.789) (-997.882) [-1000.358] -- 0:00:39
796500 -- (-1006.862) [-994.738] (-997.869) (-991.781) * (-1002.178) (-1001.018) (-994.471) [-993.330] -- 0:00:39
797000 -- (-997.635) [-992.872] (-996.469) (-990.757) * [-992.728] (-993.592) (-992.211) (-996.395) -- 0:00:38
797500 -- [-995.518] (-990.937) (-990.469) (-991.845) * (-991.333) (-999.561) (-998.932) [-998.600] -- 0:00:39
798000 -- [-995.210] (-995.633) (-998.259) (-995.892) * (-996.829) [-997.459] (-996.176) (-1002.487) -- 0:00:38
798500 -- [-995.767] (-995.336) (-995.332) (-992.263) * (-994.655) (-996.936) [-995.907] (-1003.297) -- 0:00:38
799000 -- [-997.861] (-992.183) (-999.488) (-994.200) * [-999.321] (-1000.364) (-991.555) (-998.059) -- 0:00:38
799500 -- (-995.891) [-994.448] (-1000.827) (-996.832) * (-994.384) (-993.300) [-991.077] (-997.308) -- 0:00:38
800000 -- (-991.495) (-993.632) (-996.279) [-994.564] * (-997.654) (-992.833) (-1003.702) [-997.599] -- 0:00:38
Average standard deviation of split frequencies: 0.000883
800500 -- (-997.512) (-994.184) (-992.462) [-994.120] * (-994.146) [-993.132] (-999.425) (-995.643) -- 0:00:38
801000 -- (-998.348) (-997.578) [-996.982] (-996.655) * [-994.798] (-1002.121) (-998.741) (-997.137) -- 0:00:38
801500 -- [-996.581] (-1000.381) (-991.852) (-993.690) * (-991.423) [-991.253] (-999.217) (-993.737) -- 0:00:38
802000 -- (-999.312) (-1002.702) [-990.353] (-997.620) * [-996.503] (-997.844) (-997.132) (-996.087) -- 0:00:38
802500 -- [-997.301] (-993.175) (-998.259) (-995.450) * (-996.745) (-996.144) [-999.030] (-992.348) -- 0:00:37
803000 -- (-998.766) (-999.058) (-992.188) [-1000.134] * (-1004.888) (-995.331) [-994.012] (-994.075) -- 0:00:38
803500 -- [-1001.228] (-990.514) (-993.832) (-998.107) * [-993.851] (-996.691) (-994.997) (-999.637) -- 0:00:37
804000 -- (-996.052) (-995.968) (-993.854) [-1000.553] * [-997.190] (-992.991) (-1000.032) (-1005.720) -- 0:00:37
804500 -- (-991.871) (-997.590) [-991.351] (-991.532) * (-997.357) (-996.314) [-998.054] (-991.434) -- 0:00:37
805000 -- (-991.568) (-997.108) (-999.742) [-992.279] * [-996.341] (-997.247) (-1000.605) (-992.688) -- 0:00:37
Average standard deviation of split frequencies: 0.000877
805500 -- [-992.018] (-994.216) (-998.544) (-999.877) * (-1004.045) [-999.814] (-999.819) (-996.177) -- 0:00:37
806000 -- (-992.250) (-1001.637) (-994.470) [-991.116] * (-996.105) (-999.160) (-994.458) [-994.999] -- 0:00:37
806500 -- [-993.281] (-1003.133) (-993.958) (-992.120) * (-1000.141) (-1004.224) (-998.453) [-994.038] -- 0:00:37
807000 -- (-996.805) (-992.905) [-995.446] (-993.102) * (-1000.899) (-999.396) [-991.220] (-996.643) -- 0:00:37
807500 -- [-997.114] (-998.193) (-999.456) (-997.269) * (-993.402) [-996.234] (-994.544) (-993.584) -- 0:00:36
808000 -- (-994.575) [-995.086] (-990.613) (-992.801) * (-993.516) (-992.426) [-994.844] (-992.903) -- 0:00:37
808500 -- (-991.453) (-995.460) [-990.250] (-991.569) * [-990.352] (-993.388) (-997.741) (-1003.187) -- 0:00:36
809000 -- (-997.465) (-997.578) (-989.926) [-990.898] * [-991.379] (-992.491) (-1002.136) (-992.241) -- 0:00:36
809500 -- (-999.471) (-993.738) [-993.816] (-993.450) * (-995.248) (-990.150) [-993.048] (-990.349) -- 0:00:36
810000 -- (-1006.599) (-996.532) (-992.964) [-996.282] * (-990.945) (-995.364) (-994.956) [-993.243] -- 0:00:36
Average standard deviation of split frequencies: 0.000872
810500 -- (-999.691) [-997.914] (-992.668) (-995.520) * [-991.826] (-991.633) (-998.437) (-991.659) -- 0:00:36
811000 -- [-994.053] (-995.959) (-996.135) (-995.415) * (-993.239) [-997.696] (-995.495) (-994.696) -- 0:00:36
811500 -- [-990.835] (-998.689) (-999.270) (-995.131) * (-995.766) (-996.921) (-994.307) [-988.339] -- 0:00:36
812000 -- (-991.835) (-997.937) [-993.261] (-996.389) * (-994.094) (-995.336) (-995.579) [-991.994] -- 0:00:36
812500 -- (-991.931) [-996.714] (-989.612) (-996.521) * (-993.844) (-994.102) [-992.911] (-991.154) -- 0:00:36
813000 -- [-996.205] (-994.778) (-995.039) (-1001.302) * (-995.788) (-994.414) (-999.282) [-995.189] -- 0:00:35
813500 -- (-996.969) [-994.326] (-994.066) (-998.846) * (-996.765) (-999.677) (-993.440) [-994.099] -- 0:00:35
814000 -- (-998.489) [-993.988] (-1000.475) (-997.458) * [-992.487] (-996.401) (-995.939) (-989.703) -- 0:00:35
814500 -- (-998.814) [-993.583] (-995.080) (-995.136) * (-999.385) (-992.681) [-990.241] (-997.440) -- 0:00:35
815000 -- (-997.310) (-995.222) (-996.446) [-991.436] * (-1002.332) (-998.941) [-998.315] (-997.871) -- 0:00:35
Average standard deviation of split frequencies: 0.000867
815500 -- (-996.480) (-995.781) [-994.010] (-1000.858) * (-997.960) (-996.215) (-998.238) [-990.471] -- 0:00:35
816000 -- [-992.876] (-993.632) (-993.365) (-994.885) * (-997.574) [-992.827] (-1005.970) (-995.077) -- 0:00:35
816500 -- (-995.137) (-991.430) (-997.131) [-993.927] * (-997.902) [-991.545] (-998.330) (-997.953) -- 0:00:35
817000 -- (-991.788) (-993.155) (-998.671) [-997.255] * (-996.275) [-991.513] (-1000.548) (-995.671) -- 0:00:35
817500 -- (-991.856) (-995.564) [-991.174] (-995.772) * (-998.140) [-992.364] (-992.698) (-996.154) -- 0:00:35
818000 -- (-992.496) [-996.322] (-996.899) (-993.656) * (-998.267) [-994.154] (-1000.688) (-994.861) -- 0:00:34
818500 -- (-989.854) [-990.612] (-997.260) (-995.464) * (-1000.033) (-998.783) (-1000.809) [-994.564] -- 0:00:34
819000 -- (-995.852) (-995.468) (-1004.716) [-993.835] * (-997.932) (-996.567) (-994.661) [-992.297] -- 0:00:34
819500 -- (-1005.110) (-993.451) (-996.495) [-992.366] * (-1001.818) [-995.614] (-994.446) (-995.177) -- 0:00:34
820000 -- (-993.845) (-1002.219) [-997.583] (-996.909) * (-1005.207) (-993.912) [-995.389] (-996.930) -- 0:00:34
Average standard deviation of split frequencies: 0.000574
820500 -- [-993.755] (-998.773) (-993.954) (-995.451) * (-1000.656) (-989.974) [-998.719] (-995.343) -- 0:00:34
821000 -- [-991.295] (-1001.110) (-994.255) (-995.390) * [-1003.436] (-994.489) (-999.335) (-994.322) -- 0:00:34
821500 -- [-991.789] (-1001.991) (-993.111) (-996.985) * (-1001.556) (-990.949) (-996.470) [-989.901] -- 0:00:34
822000 -- [-995.731] (-997.237) (-1000.028) (-995.827) * [-993.279] (-990.312) (-998.143) (-993.151) -- 0:00:34
822500 -- (-998.521) (-994.736) [-993.838] (-999.079) * (-995.891) (-997.085) (-996.016) [-990.481] -- 0:00:34
823000 -- [-997.313] (-996.305) (-997.180) (-996.616) * (-999.501) (-998.818) [-992.907] (-994.844) -- 0:00:33
823500 -- (-996.257) (-994.876) (-993.191) [-993.970] * [-990.724] (-994.339) (-996.923) (-995.480) -- 0:00:33
824000 -- [-999.803] (-997.384) (-996.853) (-1001.682) * (-994.858) (-993.454) (-1004.078) [-995.354] -- 0:00:33
824500 -- (-998.883) (-993.629) [-989.997] (-993.180) * [-993.782] (-999.821) (-992.567) (-995.940) -- 0:00:33
825000 -- (-996.377) [-990.881] (-995.179) (-996.863) * [-992.623] (-999.920) (-995.708) (-997.380) -- 0:00:33
Average standard deviation of split frequencies: 0.001427
825500 -- [-1000.660] (-993.389) (-994.345) (-997.692) * [-992.559] (-997.810) (-996.774) (-992.775) -- 0:00:33
826000 -- [-996.827] (-996.175) (-997.670) (-1003.149) * (-994.545) [-996.030] (-1001.046) (-999.424) -- 0:00:33
826500 -- (-1000.778) (-993.147) (-995.189) [-995.955] * (-997.190) (-992.556) [-993.205] (-998.091) -- 0:00:33
827000 -- (-998.300) (-994.510) [-990.244] (-993.700) * [-1000.317] (-997.763) (-996.219) (-1002.135) -- 0:00:33
827500 -- (-994.889) (-993.499) [-991.838] (-1006.797) * (-996.939) (-997.154) [-993.438] (-997.862) -- 0:00:33
828000 -- [-997.564] (-995.621) (-994.086) (-994.757) * (-999.033) (-1000.336) (-991.575) [-993.102] -- 0:00:33
828500 -- (-995.862) (-996.970) [-995.972] (-991.119) * (-998.130) [-990.243] (-991.178) (-997.248) -- 0:00:32
829000 -- (-1000.316) [-992.906] (-993.625) (-995.242) * [-998.231] (-995.682) (-999.846) (-998.747) -- 0:00:32
829500 -- (-993.100) (-999.979) (-990.767) [-995.553] * (-1000.383) [-996.231] (-992.755) (-996.549) -- 0:00:32
830000 -- [-995.080] (-1000.402) (-991.611) (-997.958) * [-996.250] (-996.987) (-992.038) (-1001.089) -- 0:00:32
Average standard deviation of split frequencies: 0.001419
830500 -- (-995.098) (-997.688) (-997.853) [-993.994] * (-998.146) (-991.014) (-995.176) [-996.777] -- 0:00:32
831000 -- (-998.194) (-995.903) [-995.300] (-993.274) * (-998.525) [-994.238] (-995.974) (-992.685) -- 0:00:32
831500 -- (-992.143) (-998.799) (-992.063) [-992.804] * (-1001.467) (-992.393) [-995.708] (-997.813) -- 0:00:32
832000 -- [-992.751] (-1002.935) (-1000.300) (-992.355) * (-995.246) (-991.597) (-998.280) [-992.398] -- 0:00:32
832500 -- (-993.004) (-994.625) [-997.283] (-996.721) * [-995.364] (-999.128) (-997.511) (-994.164) -- 0:00:32
833000 -- [-995.094] (-1001.042) (-995.183) (-998.597) * [-994.917] (-996.006) (-1000.777) (-992.118) -- 0:00:32
833500 -- (-994.015) [-999.839] (-995.406) (-992.614) * [-1001.052] (-991.873) (-995.149) (-1001.847) -- 0:00:31
834000 -- [-988.582] (-992.520) (-991.831) (-998.332) * (-995.763) (-992.489) [-995.510] (-997.663) -- 0:00:31
834500 -- (-998.094) [-998.865] (-996.801) (-995.028) * [-994.190] (-992.436) (-993.645) (-991.946) -- 0:00:31
835000 -- (-992.597) (-997.103) (-997.169) [-994.315] * (-999.564) [-990.952] (-992.118) (-1000.124) -- 0:00:31
Average standard deviation of split frequencies: 0.001410
835500 -- (-996.959) [-994.346] (-990.446) (-1002.104) * (-994.655) [-998.161] (-999.587) (-996.702) -- 0:00:31
836000 -- (-998.341) [-993.037] (-994.498) (-1000.518) * (-996.260) [-996.339] (-995.078) (-1002.923) -- 0:00:31
836500 -- [-996.222] (-993.604) (-999.769) (-992.778) * [-1001.590] (-998.948) (-994.093) (-1003.401) -- 0:00:31
837000 -- [-992.897] (-1000.707) (-995.394) (-997.827) * (-992.009) (-1005.515) [-992.093] (-993.799) -- 0:00:31
837500 -- (-996.597) (-999.800) [-996.160] (-995.787) * (-1001.099) (-997.777) (-997.540) [-997.226] -- 0:00:31
838000 -- (-999.087) (-999.454) (-994.328) [-988.036] * [-996.968] (-997.996) (-996.061) (-996.598) -- 0:00:31
838500 -- (-994.233) (-991.671) [-994.810] (-996.575) * [-992.345] (-1004.183) (-995.157) (-993.369) -- 0:00:31
839000 -- (-995.169) [-993.030] (-996.984) (-998.085) * [-993.781] (-994.314) (-992.927) (-996.227) -- 0:00:30
839500 -- [-996.996] (-996.243) (-992.723) (-994.064) * (-997.958) (-992.300) (-997.882) [-992.100] -- 0:00:30
840000 -- (-995.102) [-998.480] (-994.244) (-1000.256) * (-995.816) (-998.740) [-995.078] (-996.997) -- 0:00:30
Average standard deviation of split frequencies: 0.001402
840500 -- (-997.366) (-993.814) [-999.025] (-991.052) * (-997.500) (-993.436) [-991.340] (-996.674) -- 0:00:30
841000 -- (-992.186) (-996.751) [-993.816] (-992.454) * (-1000.136) [-1001.353] (-995.310) (-991.902) -- 0:00:30
841500 -- (-1002.891) (-999.482) (-991.802) [-996.587] * [-993.671] (-1002.913) (-993.586) (-998.243) -- 0:00:30
842000 -- (-1001.562) (-994.494) (-995.505) [-996.584] * [-995.223] (-1000.756) (-996.412) (-992.841) -- 0:00:30
842500 -- [-998.530] (-995.637) (-997.104) (-1002.447) * (-992.354) [-1001.792] (-999.189) (-1000.192) -- 0:00:30
843000 -- (-996.159) [-990.851] (-996.839) (-998.113) * (-998.365) (-999.012) (-996.731) [-991.145] -- 0:00:30
843500 -- (-996.967) [-993.630] (-993.576) (-1003.649) * (-989.916) [-996.634] (-996.293) (-996.019) -- 0:00:30
844000 -- (-1000.391) (-994.365) [-995.023] (-1002.793) * (-991.257) (-994.715) [-995.554] (-1000.632) -- 0:00:29
844500 -- (-991.444) [-994.828] (-1003.299) (-1002.239) * [-991.698] (-992.968) (-993.649) (-997.788) -- 0:00:29
845000 -- [-992.564] (-995.705) (-996.247) (-999.157) * [-993.225] (-994.619) (-993.756) (-1000.291) -- 0:00:29
Average standard deviation of split frequencies: 0.001114
845500 -- (-994.521) (-990.822) (-993.184) [-998.164] * [-995.732] (-992.628) (-999.435) (-1002.370) -- 0:00:29
846000 -- (-997.532) (-997.242) (-994.076) [-992.520] * (-990.853) (-993.172) (-993.516) [-1002.817] -- 0:00:29
846500 -- (-994.141) (-999.870) [-992.985] (-999.609) * [-991.527] (-999.519) (-993.561) (-993.842) -- 0:00:29
847000 -- (-1003.379) (-1001.578) [-996.686] (-991.853) * (-990.899) [-992.766] (-996.043) (-991.357) -- 0:00:29
847500 -- (-994.426) (-1000.642) (-989.588) [-992.311] * (-995.992) [-990.216] (-995.274) (-996.313) -- 0:00:29
848000 -- (-990.372) [-992.569] (-990.908) (-994.024) * (-995.103) [-994.505] (-995.446) (-999.115) -- 0:00:29
848500 -- (-995.116) (-994.328) (-995.457) [-993.956] * (-991.829) (-992.543) [-993.863] (-992.995) -- 0:00:29
849000 -- [-993.425] (-998.481) (-997.644) (-995.535) * (-993.998) [-994.220] (-995.858) (-1001.626) -- 0:00:28
849500 -- (-991.994) (-993.623) [-990.314] (-997.010) * (-993.481) (-991.607) [-997.288] (-992.923) -- 0:00:28
850000 -- (-994.288) (-1002.195) [-993.893] (-1005.040) * (-992.219) (-993.800) (-999.853) [-991.211] -- 0:00:28
Average standard deviation of split frequencies: 0.001662
850500 -- (-993.059) (-1002.952) (-998.780) [-1000.898] * [-990.970] (-991.006) (-992.935) (-991.767) -- 0:00:28
851000 -- (-989.274) (-1006.920) (-1000.982) [-996.499] * (-995.591) (-996.624) [-997.093] (-1006.307) -- 0:00:28
851500 -- (-991.903) (-998.740) [-996.525] (-993.581) * (-1003.701) (-1000.091) [-993.487] (-1000.238) -- 0:00:28
852000 -- (-990.461) (-994.550) (-998.127) [-991.520] * [-993.414] (-992.293) (-991.496) (-1003.754) -- 0:00:28
852500 -- [-992.053] (-995.798) (-994.895) (-991.554) * (-993.922) (-989.373) [-993.591] (-994.068) -- 0:00:28
853000 -- (-990.506) (-999.940) (-995.790) [-994.204] * [-991.596] (-993.867) (-993.504) (-1002.275) -- 0:00:28
853500 -- (-991.069) (-996.952) [-994.830] (-998.026) * (-996.153) (-991.772) (-999.576) [-993.051] -- 0:00:28
854000 -- (-995.597) (-995.301) [-989.814] (-992.367) * (-993.813) [-995.457] (-998.473) (-997.719) -- 0:00:28
854500 -- (-990.798) (-1002.944) (-1002.072) [-993.930] * (-995.568) [-995.113] (-992.531) (-996.416) -- 0:00:27
855000 -- (-994.870) [-997.987] (-992.899) (-996.775) * (-999.849) (-1004.958) [-990.684] (-989.966) -- 0:00:27
Average standard deviation of split frequencies: 0.001652
855500 -- (-999.118) [-994.873] (-996.602) (-998.488) * [-997.903] (-993.488) (-996.294) (-993.190) -- 0:00:27
856000 -- (-990.116) [-992.820] (-995.016) (-998.714) * (-997.002) [-991.669] (-991.988) (-995.586) -- 0:00:27
856500 -- (-991.015) (-997.830) [-994.644] (-995.778) * (-990.367) (-994.995) [-995.595] (-996.064) -- 0:00:27
857000 -- [-994.656] (-995.019) (-993.257) (-998.888) * (-993.865) (-992.334) (-992.802) [-994.664] -- 0:00:27
857500 -- (-993.686) (-998.026) (-996.817) [-994.207] * (-999.864) (-994.324) [-999.848] (-991.928) -- 0:00:27
858000 -- (-996.993) (-998.020) (-994.843) [-991.433] * (-993.666) (-994.736) (-992.870) [-991.389] -- 0:00:27
858500 -- (-997.972) (-994.848) (-993.980) [-994.906] * (-989.736) (-994.125) (-993.306) [-991.895] -- 0:00:27
859000 -- (-997.468) (-996.895) [-996.415] (-994.448) * [-990.135] (-998.742) (-995.941) (-993.929) -- 0:00:27
859500 -- (-997.003) [-995.069] (-997.865) (-998.492) * (-995.982) (-1004.332) [-993.955] (-994.388) -- 0:00:26
860000 -- (-995.515) (-1000.234) [-995.080] (-992.854) * (-994.156) (-998.493) (-998.817) [-993.792] -- 0:00:26
Average standard deviation of split frequencies: 0.001369
860500 -- (-1001.349) [-993.267] (-997.661) (-998.687) * [-993.848] (-999.230) (-994.841) (-998.882) -- 0:00:26
861000 -- (-1009.998) (-996.773) [-993.916] (-1002.908) * (-992.489) [-990.791] (-1002.894) (-996.722) -- 0:00:26
861500 -- (-998.643) (-998.528) [-997.014] (-998.099) * (-997.211) [-990.914] (-996.245) (-997.196) -- 0:00:26
862000 -- (-1002.744) [-995.471] (-991.204) (-997.916) * (-995.477) (-992.806) [-996.109] (-994.876) -- 0:00:26
862500 -- (-994.912) [-992.478] (-993.404) (-995.905) * [-997.197] (-997.382) (-995.669) (-991.468) -- 0:00:26
863000 -- [-998.947] (-994.746) (-993.759) (-995.211) * (-994.397) [-998.299] (-992.208) (-1001.131) -- 0:00:26
863500 -- [-995.373] (-993.387) (-999.995) (-996.196) * (-997.533) (-991.268) [-990.120] (-995.670) -- 0:00:26
864000 -- [-995.484] (-1002.070) (-996.791) (-993.679) * (-995.240) (-996.286) (-998.616) [-991.493] -- 0:00:26
864500 -- (-994.363) (-997.119) [-996.454] (-993.876) * (-991.513) (-998.951) [-997.437] (-999.239) -- 0:00:26
865000 -- [-991.480] (-999.284) (-995.143) (-996.904) * (-992.493) (-997.468) [-994.910] (-995.753) -- 0:00:25
Average standard deviation of split frequencies: 0.000817
865500 -- (-994.873) (-1004.871) (-990.622) [-992.515] * (-1004.956) (-996.613) (-994.846) [-990.129] -- 0:00:25
866000 -- (-994.884) (-1000.732) (-994.076) [-993.812] * (-995.663) (-996.361) (-996.682) [-995.872] -- 0:00:25
866500 -- (-997.168) (-1007.369) (-992.597) [-992.305] * (-996.426) [-994.859] (-1002.191) (-990.382) -- 0:00:25
867000 -- (-996.476) (-994.989) [-996.264] (-993.671) * (-998.434) [-994.863] (-992.533) (-1000.079) -- 0:00:25
867500 -- (-993.485) [-995.767] (-995.616) (-997.759) * (-1000.779) [-996.429] (-991.256) (-998.421) -- 0:00:25
868000 -- [-991.449] (-990.179) (-993.355) (-995.754) * (-997.723) (-998.546) (-992.520) [-991.078] -- 0:00:25
868500 -- (-998.312) (-994.037) [-992.422] (-994.166) * (-997.834) (-999.078) [-994.365] (-992.457) -- 0:00:25
869000 -- (-997.186) (-994.660) [-998.067] (-991.826) * [-997.711] (-999.608) (-996.419) (-996.171) -- 0:00:25
869500 -- (-990.950) (-995.618) (-1000.357) [-998.170] * (-996.391) (-1001.363) [-993.133] (-996.936) -- 0:00:25
870000 -- (-991.651) (-995.200) (-999.530) [-1006.701] * [-1005.247] (-1003.777) (-991.168) (-994.971) -- 0:00:24
Average standard deviation of split frequencies: 0.001083
870500 -- [-990.443] (-1001.572) (-998.091) (-1000.991) * [-1004.146] (-996.567) (-993.867) (-999.071) -- 0:00:24
871000 -- (-994.159) (-998.451) [-999.900] (-997.011) * (-1003.259) (-993.536) (-992.313) [-991.547] -- 0:00:24
871500 -- (-994.903) (-998.871) [-991.755] (-999.474) * (-1007.979) (-993.434) (-998.514) [-997.088] -- 0:00:24
872000 -- (-998.346) [-993.364] (-992.861) (-989.766) * (-1008.413) (-998.597) (-990.250) [-997.938] -- 0:00:24
872500 -- (-994.956) (-997.075) (-997.104) [-991.027] * (-1006.396) [-992.609] (-994.886) (-992.659) -- 0:00:24
873000 -- [-995.450] (-994.987) (-998.810) (-993.793) * [-998.822] (-996.881) (-991.402) (-996.486) -- 0:00:24
873500 -- [-993.971] (-991.859) (-1000.229) (-998.001) * (-997.167) (-995.382) [-998.507] (-996.629) -- 0:00:24
874000 -- (-994.960) [-995.036] (-996.747) (-997.800) * (-998.237) [-992.090] (-997.198) (-995.136) -- 0:00:24
874500 -- (-994.979) (-1000.325) (-994.499) [-990.563] * (-992.496) (-1007.059) (-995.124) [-996.696] -- 0:00:24
875000 -- (-990.543) (-1002.713) (-996.724) [-995.306] * (-994.047) (-998.445) [-990.060] (-997.272) -- 0:00:24
Average standard deviation of split frequencies: 0.001345
875500 -- (-994.945) [-997.838] (-995.804) (-1000.808) * (-993.890) (-1005.547) (-992.455) [-992.743] -- 0:00:23
876000 -- (-993.248) (-999.305) (-997.479) [-999.374] * (-999.828) (-993.948) (-999.270) [-993.765] -- 0:00:23
876500 -- (-993.654) (-994.804) (-993.921) [-996.479] * (-1002.240) (-995.262) [-996.100] (-1001.121) -- 0:00:23
877000 -- (-995.117) [-992.701] (-992.433) (-995.777) * (-1000.532) [-993.636] (-991.274) (-992.223) -- 0:00:23
877500 -- [-997.384] (-994.223) (-997.797) (-990.971) * (-995.059) [-993.266] (-996.754) (-993.175) -- 0:00:23
878000 -- (-992.394) (-997.463) (-996.022) [-995.131] * (-1002.393) [-993.678] (-998.415) (-996.974) -- 0:00:23
878500 -- (-998.027) (-1006.454) [-995.829] (-999.558) * (-999.300) (-992.835) (-998.319) [-999.449] -- 0:00:23
879000 -- [-997.276] (-999.109) (-994.448) (-989.035) * (-1000.105) [-991.484] (-994.023) (-995.879) -- 0:00:23
879500 -- (-995.757) [-994.850] (-998.194) (-997.763) * (-1000.643) (-993.882) [-991.193] (-998.270) -- 0:00:23
880000 -- (-997.317) (-993.007) [-992.265] (-998.963) * (-995.128) [-990.941] (-998.316) (-996.908) -- 0:00:23
Average standard deviation of split frequencies: 0.001606
880500 -- (-1001.060) [-992.112] (-996.403) (-995.854) * [-997.022] (-997.344) (-995.706) (-994.132) -- 0:00:22
881000 -- [-994.886] (-997.333) (-1007.887) (-999.486) * (-1005.777) (-998.469) [-996.967] (-1002.876) -- 0:00:22
881500 -- (-994.038) (-990.532) (-999.546) [-993.972] * (-1002.946) (-992.412) [-998.353] (-998.440) -- 0:00:22
882000 -- [-997.690] (-991.344) (-993.931) (-1004.789) * (-1001.503) (-992.239) [-994.203] (-994.570) -- 0:00:22
882500 -- (-994.412) (-992.676) [-990.750] (-993.991) * (-997.419) (-996.841) (-990.789) [-991.273] -- 0:00:22
883000 -- (-996.022) (-994.623) [-991.675] (-1000.096) * [-997.480] (-997.670) (-989.036) (-993.708) -- 0:00:22
883500 -- (-993.862) [-991.701] (-1000.470) (-992.718) * (-993.585) (-994.477) [-997.184] (-995.144) -- 0:00:22
884000 -- (-999.479) [-989.118] (-1000.844) (-990.831) * (-1000.459) (-992.352) (-995.921) [-994.087] -- 0:00:22
884500 -- [-991.052] (-994.645) (-994.409) (-992.071) * (-998.747) (-997.155) (-998.609) [-989.843] -- 0:00:22
885000 -- [-994.777] (-991.317) (-994.617) (-997.480) * (-994.069) (-991.205) (-1002.762) [-995.713] -- 0:00:22
Average standard deviation of split frequencies: 0.001596
885500 -- [-993.076] (-996.719) (-996.256) (-993.501) * (-994.499) (-991.030) (-1003.515) [-992.468] -- 0:00:21
886000 -- (-999.183) (-995.951) (-998.810) [-998.499] * (-995.588) (-1000.185) [-997.127] (-990.349) -- 0:00:21
886500 -- [-997.497] (-996.031) (-1006.316) (-995.889) * (-1000.222) (-991.884) (-989.656) [-993.716] -- 0:00:21
887000 -- [-993.764] (-995.187) (-1003.967) (-991.519) * (-999.156) (-992.704) [-998.686] (-995.549) -- 0:00:21
887500 -- (-1001.482) (-992.820) (-998.795) [-990.732] * (-1001.302) (-992.399) [-1002.827] (-993.888) -- 0:00:21
888000 -- [-994.411] (-995.173) (-993.907) (-995.745) * (-994.532) (-994.808) [-994.061] (-997.902) -- 0:00:21
888500 -- [-993.774] (-997.221) (-995.500) (-996.074) * (-992.972) (-994.210) [-990.635] (-991.022) -- 0:00:21
889000 -- (-989.809) (-995.671) [-994.299] (-993.497) * (-994.969) [-992.786] (-995.874) (-992.427) -- 0:00:21
889500 -- (-994.593) (-995.658) [-994.472] (-1001.511) * (-993.373) [-993.181] (-1002.469) (-993.912) -- 0:00:21
890000 -- [-994.051] (-995.819) (-997.919) (-993.277) * (-994.772) (-992.945) [-994.719] (-996.977) -- 0:00:21
Average standard deviation of split frequencies: 0.001588
890500 -- (-993.975) (-999.191) (-999.924) [-993.886] * (-997.526) (-993.585) [-996.689] (-995.072) -- 0:00:21
891000 -- (-999.272) (-1003.836) [-1000.787] (-997.794) * [-992.491] (-994.635) (-993.689) (-1001.851) -- 0:00:20
891500 -- (-991.907) (-992.751) (-992.692) [-993.972] * (-1000.087) (-998.896) [-997.449] (-997.734) -- 0:00:20
892000 -- (-997.282) (-1001.656) (-994.963) [-989.972] * (-993.706) (-992.496) (-997.988) [-992.808] -- 0:00:20
892500 -- (-997.880) (-994.079) (-992.751) [-992.399] * (-991.594) (-998.807) [-992.111] (-992.021) -- 0:00:20
893000 -- (-996.115) (-997.958) (-991.789) [-993.536] * [-995.288] (-994.946) (-994.516) (-1001.150) -- 0:00:20
893500 -- (-991.195) [-994.375] (-998.841) (-996.069) * [-1006.068] (-998.182) (-995.575) (-1000.878) -- 0:00:20
894000 -- (-996.303) (-996.501) [-991.577] (-1001.513) * [-991.174] (-994.105) (-993.159) (-997.906) -- 0:00:20
894500 -- (-995.666) (-991.804) (-995.306) [-993.901] * (-991.965) [-992.786] (-999.690) (-1000.194) -- 0:00:20
895000 -- [-995.116] (-997.248) (-993.125) (-990.608) * (-995.197) (-996.411) (-1009.357) [-994.839] -- 0:00:20
Average standard deviation of split frequencies: 0.001578
895500 -- (-997.296) (-994.679) [-994.727] (-994.684) * [-995.725] (-996.815) (-996.700) (-999.348) -- 0:00:20
896000 -- (-995.476) (-998.331) (-996.930) [-999.532] * [-993.406] (-994.842) (-999.469) (-995.711) -- 0:00:19
896500 -- (-995.381) (-1001.969) [-993.068] (-991.509) * [-995.338] (-992.373) (-1000.845) (-990.983) -- 0:00:19
897000 -- (-995.012) (-998.912) [-994.437] (-997.327) * (-991.177) (-993.039) (-993.664) [-992.212] -- 0:00:19
897500 -- (-998.795) (-1001.181) (-992.028) [-997.941] * (-996.571) (-990.681) [-990.474] (-996.491) -- 0:00:19
898000 -- [-993.685] (-998.720) (-992.585) (-993.370) * (-997.341) (-1002.537) [-992.464] (-993.430) -- 0:00:19
898500 -- (-995.059) (-999.462) (-992.514) [-993.784] * (-1000.391) (-992.047) [-991.602] (-991.639) -- 0:00:19
899000 -- (-996.031) (-1003.510) [-994.229] (-991.806) * (-993.559) [-992.382] (-1003.251) (-991.449) -- 0:00:19
899500 -- [-995.274] (-1001.808) (-989.506) (-995.520) * (-997.325) (-995.473) [-998.137] (-990.798) -- 0:00:19
900000 -- (-995.109) (-1002.935) [-993.590] (-994.785) * [-994.699] (-994.183) (-993.380) (-991.718) -- 0:00:19
Average standard deviation of split frequencies: 0.001570
900500 -- [-989.775] (-1004.596) (-992.373) (-997.848) * (-990.751) (-994.052) (-993.691) [-990.244] -- 0:00:19
901000 -- (-995.669) (-1004.126) (-1001.912) [-996.844] * (-993.927) (-1000.219) (-996.878) [-989.854] -- 0:00:19
901500 -- (-995.905) [-995.214] (-995.828) (-999.899) * (-994.029) (-995.710) [-994.761] (-994.325) -- 0:00:18
902000 -- (-995.902) (-995.092) [-993.494] (-1005.196) * (-995.879) (-995.262) (-998.734) [-993.893] -- 0:00:18
902500 -- (-994.597) (-995.673) [-995.319] (-992.701) * (-991.780) (-993.641) [-992.518] (-994.148) -- 0:00:18
903000 -- (-991.704) [-993.041] (-997.210) (-994.674) * (-996.520) [-1000.326] (-995.400) (-990.423) -- 0:00:18
903500 -- (-993.407) (-998.302) [-999.053] (-989.960) * (-988.949) (-998.569) [-993.137] (-994.876) -- 0:00:18
904000 -- (-995.733) (-991.968) (-995.411) [-989.814] * [-990.618] (-1002.528) (-993.691) (-991.226) -- 0:00:18
904500 -- (-1000.433) [-996.982] (-997.960) (-994.153) * [-993.946] (-1002.478) (-991.920) (-995.234) -- 0:00:18
905000 -- (-992.489) [-991.801] (-990.723) (-1000.507) * [-996.802] (-999.572) (-996.831) (-994.992) -- 0:00:18
Average standard deviation of split frequencies: 0.001561
905500 -- (-1002.490) (-1000.880) [-992.062] (-993.892) * (-997.143) (-998.598) (-998.727) [-993.033] -- 0:00:18
906000 -- (-996.060) (-995.240) (-994.125) [-993.453] * (-993.308) (-995.220) [-996.024] (-995.461) -- 0:00:18
906500 -- (-1001.577) (-1002.209) [-997.657] (-992.653) * (-992.627) (-999.456) [-989.437] (-999.523) -- 0:00:17
907000 -- (-998.421) (-998.268) [-993.579] (-995.055) * (-996.789) (-1001.802) [-994.562] (-995.523) -- 0:00:17
907500 -- (-1001.184) [-991.161] (-1000.434) (-991.960) * [-995.429] (-994.416) (-996.351) (-1000.216) -- 0:00:17
908000 -- (-996.784) (-1000.015) (-993.307) [-992.717] * (-994.158) [-994.294] (-997.033) (-991.624) -- 0:00:17
908500 -- (-1001.772) (-1005.293) (-994.490) [-993.460] * (-992.225) (-991.476) (-994.505) [-993.407] -- 0:00:17
909000 -- (-997.747) (-994.067) [-992.646] (-994.002) * (-994.161) [-992.849] (-996.269) (-993.966) -- 0:00:17
909500 -- (-994.837) (-996.754) [-992.507] (-993.579) * [-996.524] (-996.175) (-995.279) (-999.885) -- 0:00:17
910000 -- (-994.818) (-1000.681) [-991.080] (-996.676) * [-993.794] (-1003.495) (-1001.638) (-1008.031) -- 0:00:17
Average standard deviation of split frequencies: 0.001553
910500 -- [-995.762] (-1003.517) (-995.460) (-991.636) * (-994.905) (-995.505) (-995.034) [-997.491] -- 0:00:17
911000 -- (-1000.848) (-993.841) [-994.614] (-996.963) * [-992.182] (-990.624) (-990.795) (-995.760) -- 0:00:17
911500 -- [-993.755] (-997.271) (-998.078) (-998.183) * (-992.670) (-991.437) [-994.701] (-992.119) -- 0:00:16
912000 -- (-993.794) (-997.865) [-990.574] (-998.447) * (-990.473) (-994.318) (-996.160) [-996.122] -- 0:00:16
912500 -- (-997.299) (-992.954) [-991.519] (-997.285) * (-989.354) (-997.399) (-996.728) [-993.529] -- 0:00:16
913000 -- (-996.255) [-994.176] (-999.837) (-1000.071) * (-997.824) (-990.767) [-992.249] (-1007.913) -- 0:00:16
913500 -- (-997.327) (-996.496) [-993.138] (-1002.126) * (-1003.834) (-994.547) [-992.615] (-994.967) -- 0:00:16
914000 -- (-990.862) [-993.146] (-995.900) (-998.708) * (-997.122) (-992.796) [-989.172] (-994.239) -- 0:00:16
914500 -- [-997.767] (-997.081) (-1001.465) (-999.471) * (-992.745) (-997.417) [-993.877] (-991.342) -- 0:00:16
915000 -- [-991.051] (-994.920) (-1003.073) (-997.164) * (-993.280) (-998.754) (-993.839) [-992.220] -- 0:00:16
Average standard deviation of split frequencies: 0.001544
915500 -- (-999.688) [-992.520] (-998.988) (-998.273) * (-994.040) (-996.194) [-996.913] (-995.876) -- 0:00:16
916000 -- (-993.173) (-994.124) [-996.384] (-997.940) * [-995.081] (-995.970) (-994.643) (-994.265) -- 0:00:16
916500 -- (-994.868) [-992.324] (-991.898) (-995.533) * (-997.168) (-998.945) (-996.440) [-992.178] -- 0:00:16
917000 -- (-991.102) (-992.527) (-994.862) [-993.345] * (-992.310) (-1004.306) (-993.754) [-997.165] -- 0:00:15
917500 -- [-992.962] (-994.658) (-994.132) (-991.752) * (-1009.943) (-992.243) [-994.340] (-1001.198) -- 0:00:15
918000 -- [-992.035] (-993.234) (-996.830) (-993.717) * (-1001.205) (-1007.589) [-998.238] (-992.056) -- 0:00:15
918500 -- (-992.258) (-994.450) [-994.846] (-990.979) * (-995.955) (-996.688) [-1000.810] (-994.663) -- 0:00:15
919000 -- (-1003.286) [-993.249] (-997.057) (-999.243) * [-998.281] (-993.916) (-1000.678) (-997.499) -- 0:00:15
919500 -- (-994.015) [-995.046] (-999.062) (-996.029) * [-1001.382] (-999.384) (-997.539) (-1001.614) -- 0:00:15
920000 -- (-999.723) [-999.036] (-995.168) (-995.891) * (-999.007) (-990.062) [-992.759] (-997.904) -- 0:00:15
Average standard deviation of split frequencies: 0.002048
920500 -- (-1005.152) [-1001.069] (-996.349) (-994.671) * (-993.455) (-998.660) (-1002.854) [-993.425] -- 0:00:15
921000 -- [-999.122] (-999.028) (-995.111) (-995.282) * [-993.176] (-996.121) (-993.683) (-995.275) -- 0:00:15
921500 -- (-1000.151) (-995.769) [-1000.409] (-992.810) * (-990.696) [-998.372] (-998.982) (-993.592) -- 0:00:15
922000 -- (-998.757) [-992.975] (-1000.565) (-999.833) * (-997.671) (-996.793) (-995.129) [-994.592] -- 0:00:14
922500 -- (-996.057) [-988.899] (-1008.841) (-997.918) * (-996.648) [-993.291] (-991.661) (-995.090) -- 0:00:14
923000 -- [-992.247] (-996.267) (-996.408) (-996.963) * [-1000.896] (-994.476) (-994.763) (-996.151) -- 0:00:14
923500 -- (-996.382) (-992.641) [-994.740] (-1005.317) * [-992.180] (-995.127) (-991.207) (-999.589) -- 0:00:14
924000 -- [-997.208] (-994.645) (-993.982) (-997.967) * (-995.366) (-993.623) (-991.339) [-997.352] -- 0:00:14
924500 -- [-994.111] (-994.979) (-996.501) (-994.333) * (-998.015) [-990.527] (-993.877) (-996.719) -- 0:00:14
925000 -- (-996.994) [-996.223] (-994.909) (-999.356) * (-995.802) [-999.245] (-992.262) (-997.418) -- 0:00:14
Average standard deviation of split frequencies: 0.002036
925500 -- (-1002.451) [-992.607] (-995.856) (-1000.880) * (-995.638) (-990.613) [-993.297] (-992.607) -- 0:00:14
926000 -- [-995.553] (-998.478) (-991.491) (-1008.873) * [-993.946] (-1004.128) (-991.585) (-998.309) -- 0:00:14
926500 -- (-991.256) [-993.370] (-997.696) (-994.067) * (-994.808) (-997.044) [-1000.607] (-998.716) -- 0:00:14
927000 -- (-993.433) (-993.519) (-1001.978) [-996.090] * [-999.018] (-1001.138) (-998.851) (-1011.937) -- 0:00:14
927500 -- (-995.776) [-991.594] (-993.864) (-994.382) * (-993.756) (-995.765) [-1000.284] (-1004.223) -- 0:00:13
928000 -- [-991.451] (-995.875) (-996.717) (-995.469) * (-990.097) (-995.781) [-996.629] (-1002.017) -- 0:00:13
928500 -- (-994.972) [-994.397] (-1000.183) (-993.749) * (-994.196) (-994.496) [-993.483] (-1010.325) -- 0:00:13
929000 -- [-991.793] (-996.364) (-1000.435) (-997.947) * (-991.109) (-1003.066) [-995.509] (-1002.126) -- 0:00:13
929500 -- (-989.301) (-993.808) [-993.508] (-990.151) * [-992.436] (-1001.665) (-998.967) (-1003.724) -- 0:00:13
930000 -- (-994.320) (-1003.418) (-997.544) [-992.613] * [-994.251] (-995.526) (-998.080) (-997.861) -- 0:00:13
Average standard deviation of split frequencies: 0.002026
930500 -- (-997.440) (-1008.223) [-994.175] (-994.749) * [-992.874] (-993.121) (-993.534) (-994.131) -- 0:00:13
931000 -- (-992.317) (-997.654) [-1003.126] (-999.713) * (-996.580) (-989.374) (-990.704) [-991.586] -- 0:00:13
931500 -- [-990.112] (-993.918) (-1002.314) (-995.866) * [-997.882] (-994.472) (-994.229) (-993.387) -- 0:00:13
932000 -- (-1003.361) [-996.986] (-995.736) (-1003.187) * (-992.190) (-997.531) [-990.936] (-1002.808) -- 0:00:13
932500 -- [-990.736] (-997.044) (-1002.779) (-998.229) * [-990.856] (-995.100) (-997.209) (-999.707) -- 0:00:12
933000 -- (-1003.094) (-990.691) [-995.885] (-993.878) * [-995.440] (-1001.911) (-1002.298) (-996.687) -- 0:00:12
933500 -- (-998.233) (-993.764) (-991.442) [-995.231] * (-996.676) [-990.925] (-991.654) (-994.650) -- 0:00:12
934000 -- (-995.673) [-996.448] (-993.959) (-995.556) * [-992.385] (-1004.583) (-995.350) (-995.005) -- 0:00:12
934500 -- [-996.003] (-996.647) (-993.552) (-991.703) * [-998.631] (-994.975) (-1001.343) (-1001.172) -- 0:00:12
935000 -- [-997.741] (-1000.799) (-996.966) (-990.668) * (-991.018) (-997.208) [-993.657] (-996.825) -- 0:00:12
Average standard deviation of split frequencies: 0.001511
935500 -- (-995.105) (-1002.463) [-999.130] (-994.365) * (-991.391) (-994.245) (-998.495) [-991.909] -- 0:00:12
936000 -- [-993.967] (-992.226) (-1002.909) (-993.166) * [-993.440] (-994.734) (-990.912) (-998.828) -- 0:00:12
936500 -- (-1003.019) [-993.265] (-996.172) (-994.508) * (-998.945) (-996.999) (-995.734) [-993.061] -- 0:00:12
937000 -- (-998.745) (-991.693) (-990.912) [-996.532] * (-995.906) [-997.454] (-998.836) (-996.707) -- 0:00:12
937500 -- (-1000.858) [-992.723] (-992.871) (-995.129) * [-992.754] (-992.451) (-993.642) (-998.518) -- 0:00:12
938000 -- (-998.207) [-993.644] (-997.343) (-995.734) * (-991.747) [-990.778] (-995.143) (-1000.438) -- 0:00:11
938500 -- (-998.837) (-1000.102) (-990.461) [-991.305] * (-991.194) (-1004.210) (-992.161) [-996.949] -- 0:00:11
939000 -- (-993.734) (-1004.374) [-991.686] (-995.332) * (-999.762) (-994.574) [-999.907] (-995.290) -- 0:00:11
939500 -- [-997.811] (-1001.607) (-993.868) (-992.882) * [-992.917] (-991.730) (-992.328) (-993.222) -- 0:00:11
940000 -- [-989.426] (-997.696) (-993.567) (-993.959) * (-993.637) [-999.959] (-994.723) (-993.800) -- 0:00:11
Average standard deviation of split frequencies: 0.001503
940500 -- (-997.460) (-1002.770) (-997.632) [-995.958] * [-995.080] (-996.395) (-996.541) (-997.045) -- 0:00:11
941000 -- (-995.549) (-999.135) [-993.343] (-996.810) * (-1001.041) [-995.703] (-993.338) (-998.586) -- 0:00:11
941500 -- [-998.068] (-994.765) (-995.010) (-992.814) * [-995.893] (-998.342) (-993.440) (-1002.489) -- 0:00:11
942000 -- [-996.679] (-995.369) (-995.039) (-998.607) * [-994.154] (-1002.321) (-996.111) (-1006.633) -- 0:00:11
942500 -- [-988.739] (-994.884) (-1000.228) (-1001.276) * (-996.281) (-992.589) (-1000.498) [-995.256] -- 0:00:11
943000 -- (-999.494) [-996.809] (-998.417) (-997.720) * (-995.516) [-991.734] (-998.803) (-996.635) -- 0:00:10
943500 -- (-997.262) (-995.797) [-992.780] (-997.778) * [-990.540] (-994.594) (-993.858) (-1000.257) -- 0:00:10
944000 -- (-996.239) [-992.824] (-993.161) (-1001.905) * [-991.236] (-990.877) (-995.806) (-999.060) -- 0:00:10
944500 -- (-1000.114) (-990.892) [-991.884] (-995.460) * [-995.770] (-993.220) (-994.492) (-995.457) -- 0:00:10
945000 -- (-995.682) (-993.979) (-994.924) [-996.185] * (-994.207) (-995.875) [-989.446] (-993.784) -- 0:00:10
Average standard deviation of split frequencies: 0.001495
945500 -- [-999.752] (-993.750) (-1001.687) (-997.468) * (-1004.265) (-1004.747) (-993.113) [-999.502] -- 0:00:10
946000 -- [-995.060] (-999.117) (-993.381) (-1002.696) * (-991.568) (-1003.514) [-995.422] (-1002.131) -- 0:00:10
946500 -- (-995.897) (-992.208) [-1002.160] (-999.132) * (-996.377) (-1001.160) [-1000.203] (-994.029) -- 0:00:10
947000 -- (-994.879) (-996.402) [-992.849] (-997.725) * (-996.057) (-993.649) [-997.187] (-998.941) -- 0:00:10
947500 -- [-999.295] (-994.499) (-1001.912) (-999.065) * (-990.807) (-992.387) (-998.375) [-992.106] -- 0:00:10
948000 -- (-1004.438) (-997.642) (-999.184) [-1002.762] * (-998.039) [-1003.251] (-999.182) (-995.999) -- 0:00:09
948500 -- [-990.138] (-992.001) (-995.825) (-994.154) * [-992.668] (-1000.704) (-995.964) (-995.602) -- 0:00:09
949000 -- (-990.862) (-999.293) (-995.610) [-992.583] * (-994.513) (-1003.687) (-997.136) [-990.524] -- 0:00:09
949500 -- (-997.174) (-1003.946) [-996.818] (-993.263) * (-990.837) (-1000.065) (-1007.189) [-991.257] -- 0:00:09
950000 -- [-992.189] (-997.411) (-998.380) (-996.009) * [-994.375] (-1000.046) (-1003.576) (-995.767) -- 0:00:09
Average standard deviation of split frequencies: 0.000992
950500 -- [-994.799] (-1002.483) (-993.408) (-988.667) * [-993.993] (-999.467) (-1000.347) (-992.902) -- 0:00:09
951000 -- [-989.767] (-992.839) (-992.459) (-991.770) * (-1003.033) (-999.829) (-997.429) [-992.306] -- 0:00:09
951500 -- (-998.246) (-1002.803) [-994.104] (-995.879) * (-1002.588) (-996.377) (-999.342) [-991.267] -- 0:00:09
952000 -- (-999.032) (-999.826) (-987.528) [-992.693] * (-1004.529) (-1001.565) [-993.255] (-992.245) -- 0:00:09
952500 -- (-995.512) (-993.337) [-995.889] (-998.294) * (-1007.687) (-993.314) (-1000.943) [-991.253] -- 0:00:09
953000 -- (-1003.462) (-992.022) (-1000.302) [-999.977] * (-998.463) (-991.688) (-1000.512) [-997.523] -- 0:00:09
953500 -- [-993.094] (-992.985) (-996.265) (-996.303) * (-995.248) [-989.587] (-1000.597) (-991.799) -- 0:00:08
954000 -- (-997.292) (-991.834) [-1002.206] (-995.329) * (-1000.515) (-1002.339) [-990.978] (-998.609) -- 0:00:08
954500 -- (-995.880) [-993.706] (-997.026) (-1001.447) * (-995.686) (-998.772) (-992.010) [-993.380] -- 0:00:08
955000 -- (-997.242) [-991.893] (-1002.286) (-991.282) * (-998.068) (-998.434) (-990.637) [-996.474] -- 0:00:08
Average standard deviation of split frequencies: 0.000986
955500 -- [-991.207] (-994.747) (-1004.256) (-992.036) * (-993.056) (-994.077) (-996.667) [-992.585] -- 0:00:08
956000 -- [-997.711] (-992.958) (-1007.263) (-995.172) * (-997.539) (-996.236) [-1001.361] (-998.358) -- 0:00:08
956500 -- [-995.012] (-993.167) (-1003.857) (-994.271) * (-994.515) (-992.276) [-998.973] (-995.145) -- 0:00:08
957000 -- (-994.031) [-991.204] (-992.845) (-992.657) * (-994.087) (-995.256) (-996.793) [-989.433] -- 0:00:08
957500 -- (-998.878) [-990.037] (-998.060) (-1003.439) * (-991.996) [-990.871] (-992.153) (-995.307) -- 0:00:08
958000 -- [-990.458] (-997.782) (-995.737) (-999.124) * (-994.496) (-990.320) [-995.133] (-991.395) -- 0:00:08
958500 -- [-993.375] (-992.787) (-996.073) (-993.733) * [-997.290] (-997.036) (-994.462) (-990.206) -- 0:00:07
959000 -- [-992.714] (-996.715) (-993.901) (-995.397) * [-993.633] (-991.683) (-993.412) (-996.543) -- 0:00:07
959500 -- (-994.905) (-991.526) (-998.861) [-993.960] * (-994.873) [-993.755] (-995.205) (-998.461) -- 0:00:07
960000 -- [-992.079] (-991.566) (-996.639) (-997.691) * [-1000.799] (-999.181) (-994.394) (-994.817) -- 0:00:07
Average standard deviation of split frequencies: 0.000981
960500 -- (-994.301) (-996.429) (-996.010) [-999.063] * [-996.775] (-1003.197) (-995.624) (-993.079) -- 0:00:07
961000 -- (-1001.965) (-1000.424) [-994.781] (-998.802) * (-998.129) [-991.976] (-993.543) (-996.355) -- 0:00:07
961500 -- [-995.496] (-1001.278) (-995.559) (-996.704) * (-992.074) (-991.756) (-999.381) [-993.891] -- 0:00:07
962000 -- (-1002.924) [-996.827] (-1000.791) (-993.269) * (-1007.931) [-991.901] (-997.671) (-994.597) -- 0:00:07
962500 -- [-1001.213] (-998.277) (-990.140) (-992.619) * (-1005.158) (-992.432) (-993.019) [-991.591] -- 0:00:07
963000 -- (-999.942) (-994.254) (-992.686) [-995.071] * (-993.870) (-996.943) [-994.798] (-991.965) -- 0:00:07
963500 -- (-994.610) (-1003.426) (-999.231) [-993.704] * (-996.137) [-993.043] (-991.300) (-997.747) -- 0:00:07
964000 -- (-999.108) (-998.814) [-991.720] (-999.307) * (-1008.251) (-992.581) [-993.066] (-994.429) -- 0:00:06
964500 -- (-997.317) (-994.810) [-994.844] (-996.626) * (-997.183) [-996.838] (-996.150) (-993.031) -- 0:00:06
965000 -- [-991.596] (-999.482) (-998.255) (-1008.142) * (-994.822) (-992.742) [-993.593] (-996.060) -- 0:00:06
Average standard deviation of split frequencies: 0.000732
965500 -- [-996.948] (-997.768) (-999.697) (-1000.138) * (-998.281) (-1001.386) (-997.821) [-997.637] -- 0:00:06
966000 -- (-994.166) [-991.650] (-993.947) (-995.078) * (-995.294) (-999.090) (-996.387) [-996.879] -- 0:00:06
966500 -- (-993.955) [-995.315] (-993.456) (-996.635) * (-1000.537) (-995.003) (-997.259) [-993.228] -- 0:00:06
967000 -- [-996.086] (-996.589) (-995.638) (-992.391) * (-993.503) (-992.283) (-992.232) [-993.892] -- 0:00:06
967500 -- (-1004.946) [-992.369] (-996.288) (-991.372) * (-992.857) (-993.242) (-993.072) [-994.949] -- 0:00:06
968000 -- (-999.449) [-992.025] (-995.922) (-992.854) * (-992.478) (-995.400) (-998.092) [-991.430] -- 0:00:06
968500 -- (-997.864) [-994.942] (-991.814) (-992.001) * (-991.495) (-1003.003) [-992.583] (-999.444) -- 0:00:06
969000 -- (-993.190) [-996.838] (-994.639) (-996.254) * (-992.581) (-1000.778) [-993.700] (-993.166) -- 0:00:05
969500 -- (-993.391) (-999.248) (-1009.660) [-1001.974] * (-993.962) (-1008.444) (-994.620) [-992.832] -- 0:00:05
970000 -- (-996.336) [-995.311] (-997.844) (-997.809) * (-994.753) (-1001.564) (-990.319) [-996.890] -- 0:00:05
Average standard deviation of split frequencies: 0.000728
970500 -- [-994.633] (-992.709) (-998.682) (-995.528) * [-992.036] (-995.509) (-993.297) (-995.461) -- 0:00:05
971000 -- (-1002.581) [-992.937] (-991.279) (-992.425) * (-993.921) (-1001.028) [-994.197] (-996.856) -- 0:00:05
971500 -- (-997.974) [-995.023] (-994.487) (-991.234) * (-994.254) (-992.280) [-996.255] (-995.573) -- 0:00:05
972000 -- (-999.401) [-993.154] (-994.619) (-998.567) * (-993.801) (-996.531) [-990.793] (-996.374) -- 0:00:05
972500 -- (-997.660) [-995.142] (-997.824) (-1003.155) * [-992.839] (-998.323) (-999.388) (-993.631) -- 0:00:05
973000 -- (-997.072) (-1000.858) (-992.183) [-998.247] * [-995.014] (-1002.985) (-993.900) (-993.115) -- 0:00:05
973500 -- (-991.276) (-1004.109) (-993.070) [-993.634] * [-995.050] (-1002.590) (-994.781) (-998.291) -- 0:00:05
974000 -- [-992.167] (-995.444) (-990.326) (-996.699) * [-991.359] (-994.680) (-995.333) (-1000.099) -- 0:00:04
974500 -- (-991.369) [-993.774] (-1004.892) (-993.743) * [-994.342] (-990.350) (-992.241) (-997.406) -- 0:00:04
975000 -- [-989.673] (-1005.882) (-994.459) (-995.110) * (-988.814) [-992.274] (-995.013) (-998.207) -- 0:00:04
Average standard deviation of split frequencies: 0.000724
975500 -- [-994.575] (-995.675) (-994.484) (-990.394) * [-999.236] (-996.395) (-999.568) (-997.105) -- 0:00:04
976000 -- (-994.639) (-996.755) [-994.133] (-993.311) * (-992.345) (-1001.403) [-1003.241] (-1001.354) -- 0:00:04
976500 -- (-995.671) (-995.966) [-996.317] (-997.063) * (-994.218) (-994.114) [-996.579] (-996.613) -- 0:00:04
977000 -- (-1000.328) [-992.583] (-995.885) (-995.458) * (-995.233) (-1003.313) [-993.058] (-992.508) -- 0:00:04
977500 -- (-997.836) (-998.793) [-995.906] (-1001.382) * (-994.368) [-996.857] (-999.078) (-996.199) -- 0:00:04
978000 -- (-990.611) (-997.330) (-995.010) [-994.262] * [-996.037] (-997.728) (-994.155) (-1004.594) -- 0:00:04
978500 -- (-990.384) (-999.927) (-998.633) [-996.504] * [-992.186] (-993.278) (-997.940) (-994.230) -- 0:00:04
979000 -- [-991.742] (-999.241) (-996.883) (-994.927) * (-991.799) (-993.054) (-999.617) [-992.448] -- 0:00:04
979500 -- (-994.727) (-996.582) [-992.448] (-991.578) * [-994.258] (-999.686) (-992.284) (-995.557) -- 0:00:03
980000 -- [-995.674] (-1000.387) (-995.174) (-991.691) * (-991.304) (-997.022) (-992.452) [-996.302] -- 0:00:03
Average standard deviation of split frequencies: 0.000961
980500 -- (-998.686) (-995.612) [-991.184] (-996.993) * [-992.248] (-992.764) (-1001.199) (-997.174) -- 0:00:03
981000 -- (-995.134) (-995.071) (-995.521) [-995.029] * (-990.953) (-998.495) (-991.453) [-994.216] -- 0:00:03
981500 -- (-1000.740) (-999.215) [-990.395] (-997.561) * [-998.133] (-996.380) (-996.819) (-998.315) -- 0:00:03
982000 -- (-992.694) (-997.240) (-998.589) [-995.664] * (-1004.490) [-992.144] (-998.168) (-996.708) -- 0:00:03
982500 -- (-992.915) (-1005.377) (-996.736) [-991.867] * [-993.280] (-1007.845) (-999.160) (-990.919) -- 0:00:03
983000 -- (-989.535) (-1000.969) [-991.845] (-995.346) * [-991.134] (-1001.008) (-999.084) (-1002.107) -- 0:00:03
983500 -- [-991.827] (-1004.999) (-990.573) (-994.725) * (-992.121) (-1006.093) [-996.955] (-994.773) -- 0:00:03
984000 -- (-991.297) (-999.786) (-990.469) [-994.233] * (-989.842) [-997.032] (-995.255) (-1001.388) -- 0:00:03
984500 -- (-993.603) (-998.723) [-995.151] (-994.871) * (-996.143) (-991.619) (-994.914) [-991.810] -- 0:00:02
985000 -- (-991.324) (-997.926) (-998.545) [-999.096] * (-1000.122) (-992.357) (-991.519) [-991.940] -- 0:00:02
Average standard deviation of split frequencies: 0.001195
985500 -- (-992.091) (-998.643) (-995.268) [-991.098] * (-1000.431) (-992.809) [-991.889] (-992.585) -- 0:00:02
986000 -- [-989.170] (-997.659) (-996.542) (-990.327) * (-995.470) (-998.027) (-993.039) [-991.544] -- 0:00:02
986500 -- (-994.562) (-1001.088) [-997.503] (-993.756) * (-996.893) (-995.525) [-995.217] (-990.349) -- 0:00:02
987000 -- (-995.258) (-991.749) (-1001.356) [-991.251] * (-992.583) (-998.161) [-995.375] (-992.911) -- 0:00:02
987500 -- (-992.663) (-994.067) [-993.274] (-993.646) * (-994.100) [-996.840] (-994.927) (-992.225) -- 0:00:02
988000 -- [-999.643] (-991.577) (-999.279) (-993.998) * (-1003.170) (-1001.019) (-999.830) [-988.758] -- 0:00:02
988500 -- (-996.120) (-998.804) [-992.040] (-997.729) * [-992.224] (-994.490) (-998.668) (-998.533) -- 0:00:02
989000 -- [-997.199] (-996.707) (-993.352) (-995.884) * [-992.061] (-997.511) (-995.441) (-998.824) -- 0:00:02
989500 -- [-993.438] (-991.674) (-993.907) (-996.286) * (-997.700) (-992.144) [-991.204] (-998.718) -- 0:00:02
990000 -- (-991.309) (-996.797) [-990.981] (-992.722) * [-989.714] (-994.134) (-994.316) (-993.779) -- 0:00:01
Average standard deviation of split frequencies: 0.000952
990500 -- (-1000.350) (-993.446) (-998.911) [-995.787] * (-994.244) [-993.796] (-996.214) (-996.772) -- 0:00:01
991000 -- (-1002.280) [-992.841] (-996.910) (-992.158) * (-991.323) (-997.819) [-992.214] (-990.238) -- 0:00:01
991500 -- (-1000.000) (-988.998) (-991.361) [-992.896] * (-996.766) (-993.953) (-993.829) [-991.848] -- 0:00:01
992000 -- (-996.248) (-997.664) (-997.213) [-989.876] * (-997.763) (-990.913) (-990.825) [-989.381] -- 0:00:01
992500 -- (-994.660) [-995.331] (-997.909) (-993.943) * [-999.531] (-999.173) (-997.602) (-1002.837) -- 0:00:01
993000 -- (-1001.164) (-1000.221) (-991.166) [-998.146] * (-1002.439) (-998.259) [-1002.221] (-1000.351) -- 0:00:01
993500 -- (-997.330) (-1007.729) [-996.111] (-990.637) * (-999.839) [-997.315] (-998.216) (-997.960) -- 0:00:01
994000 -- [-993.515] (-999.796) (-999.248) (-1003.527) * (-993.172) (-1004.664) (-1001.119) [-996.189] -- 0:00:01
994500 -- (-990.943) (-1001.796) [-997.159] (-998.128) * (-996.130) (-1005.617) [-996.220] (-1000.934) -- 0:00:01
995000 -- (-992.465) (-1000.708) (-996.251) [-999.800] * (-991.144) (-997.263) [-998.326] (-1000.328) -- 0:00:00
Average standard deviation of split frequencies: 0.001183
995500 -- (-995.196) (-997.013) (-1000.760) [-995.444] * (-993.546) [-994.268] (-998.044) (-993.387) -- 0:00:00
996000 -- [-995.314] (-996.650) (-999.020) (-994.756) * (-999.252) (-999.770) (-993.356) [-994.184] -- 0:00:00
996500 -- (-998.952) (-1000.431) [-998.042] (-995.699) * (-998.182) (-999.886) (-991.884) [-994.483] -- 0:00:00
997000 -- (-996.236) (-993.235) (-1001.755) [-991.560] * (-1002.092) (-996.447) [-995.234] (-994.118) -- 0:00:00
997500 -- [-991.471] (-991.483) (-997.018) (-993.494) * (-1002.504) [-998.826] (-992.682) (-1000.096) -- 0:00:00
998000 -- [-992.452] (-993.847) (-1001.997) (-997.495) * [-995.911] (-997.811) (-1000.371) (-1006.901) -- 0:00:00
998500 -- (-995.658) [-998.687] (-1004.899) (-994.262) * (-1004.190) (-994.251) (-992.006) [-991.352] -- 0:00:00
999000 -- (-995.978) (-996.671) (-999.374) [-992.035] * (-1000.665) (-992.843) [-993.386] (-995.862) -- 0:00:00
999500 -- (-1001.726) [-998.464] (-1000.571) (-990.453) * (-997.623) [-995.716] (-998.303) (-990.242) -- 0:00:00
1000000 -- [-994.664] (-997.398) (-998.743) (-997.748) * (-1003.797) [-993.954] (-992.542) (-989.658) -- 0:00:00
Average standard deviation of split frequencies: 0.000942
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -994.663771 -- 15.570660
Chain 1 -- -994.663769 -- 15.570660
Chain 2 -- -997.398323 -- 15.741865
Chain 2 -- -997.398323 -- 15.741865
Chain 3 -- -998.742644 -- 13.112771
Chain 3 -- -998.742644 -- 13.112771
Chain 4 -- -997.747991 -- 16.180327
Chain 4 -- -997.747989 -- 16.180327
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1003.796910 -- 13.190561
Chain 1 -- -1003.796910 -- 13.190561
Chain 2 -- -993.953693 -- 16.299587
Chain 2 -- -993.953692 -- 16.299587
Chain 3 -- -992.541551 -- 14.685860
Chain 3 -- -992.541551 -- 14.685860
Chain 4 -- -989.658303 -- 13.524972
Chain 4 -- -989.658305 -- 13.524972
Analysis completed in 3 mins 12 seconds
Analysis used 191.40 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -986.95
Likelihood of best state for "cold" chain of run 2 was -986.95
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
64.3 % ( 50 %) Dirichlet(Revmat{all})
75.9 % ( 63 %) Slider(Revmat{all})
30.9 % ( 30 %) Dirichlet(Pi{all})
31.0 % ( 26 %) Slider(Pi{all})
63.9 % ( 41 %) Multiplier(Alpha{1,2})
55.4 % ( 23 %) Multiplier(Alpha{3})
79.0 % ( 55 %) Slider(Pinvar{all})
2.6 % ( 4 %) ExtSPR(Tau{all},V{all})
2.5 % ( 3 %) ExtTBR(Tau{all},V{all})
2.6 % ( 5 %) NNI(Tau{all},V{all})
3.0 % ( 4 %) ParsSPR(Tau{all},V{all})
26.4 % ( 14 %) Multiplier(V{all})
35.1 % ( 32 %) Nodeslider(V{all})
25.9 % ( 19 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
63.9 % ( 56 %) Dirichlet(Revmat{all})
75.5 % ( 64 %) Slider(Revmat{all})
30.9 % ( 24 %) Dirichlet(Pi{all})
31.4 % ( 25 %) Slider(Pi{all})
62.7 % ( 24 %) Multiplier(Alpha{1,2})
56.0 % ( 31 %) Multiplier(Alpha{3})
78.5 % ( 62 %) Slider(Pinvar{all})
2.5 % ( 3 %) ExtSPR(Tau{all},V{all})
2.5 % ( 2 %) ExtTBR(Tau{all},V{all})
2.5 % ( 0 %) NNI(Tau{all},V{all})
3.0 % ( 2 %) ParsSPR(Tau{all},V{all})
26.5 % ( 24 %) Multiplier(V{all})
34.8 % ( 40 %) Nodeslider(V{all})
25.8 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.55
2 | 166340 0.84 0.70
3 | 166879 167162 0.85
4 | 166745 166135 166739
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.54
2 | 166546 0.84 0.70
3 | 166630 167065 0.85
4 | 166100 166970 166689
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -993.19
|2 1 |
| 12 2 |
| 2 1 2 1 2 2 1 1 |
| 1 2 |
| 1 1 1 1 111 2 22 |
| 1 2 2 1 1 1 |
|1 2 2 * *1 1 2 2 2 1 22 2|
| 1 1 2 2 1 1 1 1 1 1 2 |
| 12 1 1 * 1 2 1 1 12 1 2 12 1 ** 1 1|
| 2 * 2 *1 12 2 2 2 |
| 2 2 2 2 2 2 2 2 1 2 2 |
| 1 2 2 |
| 2 1 * 12 2 |
| 2 1 2 |
| 1 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -996.02
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -991.88 -1000.56
2 -992.01 -1001.59
--------------------------------------
TOTAL -991.94 -1001.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.344790 0.003869 0.236055 0.467924 0.339093 1034.14 1081.85 1.000
r(A<->C){all} 0.235404 0.003950 0.122106 0.358438 0.230435 634.98 740.64 1.000
r(A<->G){all} 0.238452 0.003584 0.117628 0.352196 0.235823 664.98 769.66 1.000
r(A<->T){all} 0.158294 0.003493 0.050633 0.272693 0.152395 555.13 610.92 1.000
r(C<->G){all} 0.058448 0.000715 0.008355 0.108863 0.054925 711.11 934.32 1.000
r(C<->T){all} 0.170204 0.002511 0.071580 0.265215 0.166629 742.52 898.72 1.000
r(G<->T){all} 0.139197 0.001937 0.058864 0.228727 0.133619 637.13 796.06 1.000
pi(A){all} 0.172183 0.000281 0.141353 0.205084 0.171470 1173.97 1200.06 1.000
pi(C){all} 0.245360 0.000383 0.206399 0.283324 0.244968 1204.59 1338.55 1.000
pi(G){all} 0.357782 0.000493 0.315657 0.400682 0.356980 1285.57 1309.22 1.000
pi(T){all} 0.224674 0.000372 0.189596 0.263825 0.224057 1019.36 1092.87 1.000
alpha{1,2} 0.175482 0.024678 0.000112 0.446969 0.143566 1034.34 1055.00 1.000
alpha{3} 1.121037 0.368506 0.235638 2.303499 0.982908 1256.08 1378.54 1.000
pinvar{all} 0.218455 0.018306 0.000079 0.457781 0.207204 1149.03 1262.53 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 2892 0.963358 0.001884 0.962025 0.964690 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.016146 0.000104 0.000027 0.035700 0.014453 1.000 2
length{all}[2] 0.015496 0.000072 0.001693 0.031666 0.014088 1.000 2
length{all}[3] 0.045504 0.000200 0.019754 0.073187 0.043736 1.002 2
length{all}[4] 0.050624 0.000367 0.016075 0.088927 0.048879 1.000 2
length{all}[5] 0.028478 0.000226 0.001699 0.057017 0.026682 1.000 2
length{all}[6] 0.167388 0.002153 0.090294 0.257231 0.160421 1.000 2
length{all}[7] 0.021661 0.000129 0.001931 0.043352 0.020111 1.001 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000942
Maximum standard deviation of split frequencies = 0.001884
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C4 (4)
|----------------100----------------+
+ \------------------------------------ C5 (5)
|
| /------------------------------------ C2 (2)
\-----------------96----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/----- C1 (1)
|
| /----------------- C4 (4)
|------------------------------------------------------+
+ \--------- C5 (5)
|
| /----- C2 (2)
\------+
\--------------- C3 (3)
|----------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 450
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sites with gaps or missing data are removed.
60 ambiguity characters in seq. 1
51 ambiguity characters in seq. 2
48 ambiguity characters in seq. 3
33 ambiguity characters in seq. 4
63 ambiguity characters in seq. 5
23 sites are removed. 57 58 59 60 61 71 72 73 74 75 76 95 104 141 142 143 144 145 146 147 148 149 150
Sequences read..
Counting site patterns.. 0:00
74 patterns at 127 / 127 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
72224 bytes for conP
10064 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, 5), (2, 3)); MP score: 60
108336 bytes for conP, adjusted
0.043057 0.245700 0.084041 0.072892 0.031689 0.043024 0.062696 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -873.082039
Iterating by ming2
Initial: fx= 873.082039
x= 0.04306 0.24570 0.08404 0.07289 0.03169 0.04302 0.06270 0.30000 1.30000
1 h-m-p 0.0000 0.0014 87.7699 +++YCCCCC 870.254343 5 0.0007 26 | 0/9
2 h-m-p 0.0006 0.0185 112.6836 +CYCCC 865.807843 4 0.0017 47 | 0/9
3 h-m-p 0.0004 0.0018 165.0359 +YYCCCC 859.961905 5 0.0012 68 | 0/9
4 h-m-p 0.0003 0.0017 148.8087 CYCCC 857.916100 4 0.0006 87 | 0/9
5 h-m-p 0.0006 0.0030 62.1708 CYCCC 856.948387 4 0.0010 106 | 0/9
6 h-m-p 0.0013 0.0106 47.1419 YCCCC 855.743653 4 0.0022 125 | 0/9
7 h-m-p 0.0012 0.0062 51.7012 CCCCC 854.794803 4 0.0019 145 | 0/9
8 h-m-p 0.0010 0.0065 101.9287 +YCCCC 852.397825 4 0.0026 165 | 0/9
9 h-m-p 0.0003 0.0013 541.9230 YCYCCCC 848.557951 6 0.0006 187 | 0/9
10 h-m-p 0.4822 2.4112 0.0973 YCC 844.622237 2 1.0415 202 | 0/9
11 h-m-p 1.0393 5.1964 0.0690 YCC 844.397818 2 0.8201 226 | 0/9
12 h-m-p 0.9346 8.0000 0.0605 +YCCC 844.144659 3 2.3882 253 | 0/9
13 h-m-p 1.6000 8.0000 0.0561 YCC 844.101668 2 0.7072 277 | 0/9
14 h-m-p 1.5627 8.0000 0.0254 YC 844.075265 1 0.9272 299 | 0/9
15 h-m-p 1.6000 8.0000 0.0060 YC 844.073742 1 1.2675 321 | 0/9
16 h-m-p 1.6000 8.0000 0.0005 YC 844.073682 1 0.7764 343 | 0/9
17 h-m-p 1.6000 8.0000 0.0001 Y 844.073680 0 1.0526 364 | 0/9
18 h-m-p 1.6000 8.0000 0.0000 Y 844.073680 0 1.2246 385 | 0/9
19 h-m-p 1.6000 8.0000 0.0000 Y 844.073680 0 1.1849 406 | 0/9
20 h-m-p 1.6000 8.0000 0.0000 C 844.073680 0 1.6000 427 | 0/9
21 h-m-p 1.6000 8.0000 0.0000 C 844.073680 0 1.6000 448 | 0/9
22 h-m-p 1.6000 8.0000 0.0000 Y 844.073680 0 1.6000 469 | 0/9
23 h-m-p 1.5278 8.0000 0.0000 -------------Y 844.073680 0 0.0000 503
Out..
lnL = -844.073680
504 lfun, 504 eigenQcodon, 3528 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, (4, 5), (2, 3)); MP score: 60
0.043057 0.245700 0.084041 0.072892 0.031689 0.043024 0.062696 1.126814 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.817015
np = 10
lnL0 = -847.127588
Iterating by ming2
Initial: fx= 847.127588
x= 0.04306 0.24570 0.08404 0.07289 0.03169 0.04302 0.06270 1.12681 0.57321 0.49224
1 h-m-p 0.0000 0.0014 61.1636 +++YCCC 846.292190 3 0.0005 23 | 0/10
2 h-m-p 0.0011 0.0072 25.6819 CCCC 845.818944 3 0.0016 42 | 0/10
3 h-m-p 0.0005 0.0072 83.3497 +YCYC 844.868479 3 0.0014 60 | 0/10
4 h-m-p 0.0006 0.0028 158.2198 +YCYCCC 841.184828 5 0.0017 82 | 0/10
5 h-m-p 0.0009 0.0046 34.4340 CCCC 840.945824 3 0.0010 101 | 0/10
6 h-m-p 0.0009 0.0047 20.7828 YYCC 840.871755 3 0.0007 118 | 0/10
7 h-m-p 0.0008 0.0073 17.3637 +CC 840.644722 1 0.0032 134 | 0/10
8 h-m-p 0.0015 0.0075 13.0955 YCCC 840.524119 3 0.0029 152 | 0/10
9 h-m-p 0.0005 0.0027 25.7009 +YCC 840.407535 2 0.0016 169 | 0/10
10 h-m-p 0.0208 0.1041 1.0902 ++ 839.799075 m 0.1041 182 | 0/10
11 h-m-p -0.0000 -0.0000 1.3174
h-m-p: -1.10296477e-18 -5.51482385e-18 1.31742003e+00 839.799075
.. | 0/10
12 h-m-p 0.0000 0.0017 38.0763 +++YYCCCCC 839.234792 6 0.0007 218 | 0/10
13 h-m-p 0.0007 0.0062 35.8989 YCCC 838.713645 3 0.0013 236 | 0/10
14 h-m-p 0.0009 0.0043 30.3984 CCCC 838.405697 3 0.0012 255 | 0/10
15 h-m-p 0.0002 0.0008 26.5340 ++ 838.281649 m 0.0008 268 | 1/10
16 h-m-p 0.0013 0.0067 14.5205 YCC 838.251038 2 0.0006 284 | 1/10
17 h-m-p 0.0022 0.0402 3.6964 YC 838.244995 1 0.0010 298 | 1/10
18 h-m-p 0.0013 0.3099 2.9082 ++CYC 838.192430 2 0.0188 316 | 1/10
19 h-m-p 0.0012 0.0260 47.1830 YCCC 838.100001 3 0.0021 334 | 1/10
20 h-m-p 0.0118 0.1420 8.2149 YC 838.058176 1 0.0061 348 | 1/10
21 h-m-p 0.2076 1.6883 0.2408 -YC 838.055796 1 0.0219 363 | 1/10
22 h-m-p 0.3943 8.0000 0.0134 YC 838.051478 1 0.8919 386 | 1/10
23 h-m-p 1.6000 8.0000 0.0015 YC 838.051446 1 0.9510 409 | 1/10
24 h-m-p 1.6000 8.0000 0.0000 Y 838.051446 0 0.9116 431 | 1/10
25 h-m-p 1.6000 8.0000 0.0000 Y 838.051446 0 0.9666 453 | 1/10
26 h-m-p 1.6000 8.0000 0.0000 +Y 838.051446 0 6.4000 476 | 1/10
27 h-m-p 1.1694 8.0000 0.0000 -C 838.051446 0 0.0731 499 | 1/10
28 h-m-p 0.1272 8.0000 0.0000 ------------Y 838.051446 0 0.0000 533
Out..
lnL = -838.051446
534 lfun, 1602 eigenQcodon, 7476 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, (4, 5), (2, 3)); MP score: 60
initial w for M2:NSpselection reset.
0.043057 0.245700 0.084041 0.072892 0.031689 0.043024 0.062696 1.070748 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.708732
np = 12
lnL0 = -847.600596
Iterating by ming2
Initial: fx= 847.600596
x= 0.04306 0.24570 0.08404 0.07289 0.03169 0.04302 0.06270 1.07075 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0020 67.5438 +++YYC 846.450663 2 0.0006 22 | 0/12
2 h-m-p 0.0011 0.0081 33.4122 YCCC 845.656661 3 0.0018 42 | 0/12
3 h-m-p 0.0010 0.0083 62.3273 YCCCC 844.496078 4 0.0021 64 | 0/12
4 h-m-p 0.0006 0.0030 128.1616 +YCCCC 840.434757 4 0.0026 87 | 0/12
5 h-m-p 0.0000 0.0002 181.2487 ++ 839.775470 m 0.0002 102 | 1/12
6 h-m-p 0.0022 0.0289 8.1379 CCC 839.706506 2 0.0027 121 | 1/12
7 h-m-p 0.0009 0.0401 25.1235 +YCC 839.521260 2 0.0026 140 | 1/12
8 h-m-p 0.0036 0.0179 6.2258 CCC 839.501743 2 0.0014 159 | 1/12
9 h-m-p 0.0054 1.2711 1.5806 +++YYYCCCCC 837.912010 7 0.3598 188 | 1/12
10 h-m-p 0.1937 0.9684 2.2621 CCCCC 836.845347 4 0.2355 211 | 1/12
11 h-m-p 0.0580 0.2899 3.3420 YYC 836.570421 2 0.0492 228 | 1/12
12 h-m-p 0.3122 8.0000 0.5267 +CCCC 835.845779 3 1.7474 250 | 0/12
13 h-m-p 0.0217 0.1959 42.3775 CCC 835.748873 2 0.0072 280 | 0/12
14 h-m-p 0.2077 8.0000 1.4661 +CCC 834.858959 2 1.1292 300 | 0/12
15 h-m-p 1.3799 6.8994 0.9944 CYCCC 833.686777 4 2.2872 322 | 0/12
16 h-m-p 1.2978 8.0000 1.7525 CYC 833.033676 2 1.3633 352 | 0/12
17 h-m-p 0.5716 2.8582 1.3658 YCCC 832.421345 3 1.2923 372 | 0/12
18 h-m-p 0.6543 3.9355 2.6972 CCC 832.033118 2 0.9440 391 | 0/12
19 h-m-p 0.2247 1.1237 1.5016 ++ 831.779517 m 1.1237 406 | 1/12
20 h-m-p 1.6000 8.0000 0.7729 YCCC 831.644708 3 1.1547 426 | 0/12
21 h-m-p 0.0188 0.3535 47.4417 CCC 831.616328 2 0.0068 456 | 0/12
22 h-m-p 0.1947 1.8623 1.6484 ++ 830.999913 m 1.8623 471 | 1/12
23 h-m-p 0.3927 8.0000 7.8163 CCCCC 830.610396 4 0.5104 494 | 1/12
24 h-m-p 0.8495 8.0000 4.6961 YC 830.314869 1 1.5122 510 | 1/12
25 h-m-p 0.8687 8.0000 8.1749 YCCC 830.199538 3 0.3810 530 | 1/12
26 h-m-p 0.6271 8.0000 4.9666 YC 830.098366 1 1.2264 546 | 1/12
27 h-m-p 1.5731 8.0000 3.8719 YCC 830.061473 2 0.8936 564 | 1/12
28 h-m-p 1.1922 8.0000 2.9022 CCC 830.041629 2 1.4651 583 | 1/12
29 h-m-p 1.6000 8.0000 0.9149 CC 830.039833 1 1.3158 600 | 1/12
30 h-m-p 1.6000 8.0000 0.1130 C 830.039723 0 1.8519 626 | 1/12
31 h-m-p 1.6000 8.0000 0.0354 YC 830.039663 1 2.8710 653 | 1/12
32 h-m-p 1.6000 8.0000 0.0391 YC 830.039592 1 3.2774 680 | 1/12
33 h-m-p 1.6000 8.0000 0.0519 C 830.039555 0 1.5807 706 | 1/12
34 h-m-p 1.6000 8.0000 0.0218 C 830.039553 0 1.4601 732 | 1/12
35 h-m-p 1.6000 8.0000 0.0048 C 830.039553 0 1.4255 758 | 1/12
36 h-m-p 1.6000 8.0000 0.0002 C 830.039553 0 1.8458 784 | 1/12
37 h-m-p 1.6000 8.0000 0.0001 Y 830.039553 0 1.1378 810 | 1/12
38 h-m-p 1.6000 8.0000 0.0000 C 830.039553 0 1.6000 836 | 1/12
39 h-m-p 0.4964 8.0000 0.0000 ----------C 830.039553 0 0.0000 872
Out..
lnL = -830.039553
873 lfun, 3492 eigenQcodon, 18333 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -838.568449 S = -773.156590 -59.487470
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 74 patterns 0:10
did 20 / 74 patterns 0:10
did 30 / 74 patterns 0:10
did 40 / 74 patterns 0:10
did 50 / 74 patterns 0:10
did 60 / 74 patterns 0:10
did 70 / 74 patterns 0:10
did 74 / 74 patterns 0:10
Time used: 0:10
Model 3: discrete
TREE # 1
(1, (4, 5), (2, 3)); MP score: 60
0.043057 0.245700 0.084041 0.072892 0.031689 0.043024 0.062696 1.056384 0.331355 0.382499 0.182024 0.454407 0.760853
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 7.944372
np = 13
lnL0 = -843.209614
Iterating by ming2
Initial: fx= 843.209614
x= 0.04306 0.24570 0.08404 0.07289 0.03169 0.04302 0.06270 1.05638 0.33136 0.38250 0.18202 0.45441 0.76085
1 h-m-p 0.0000 0.0014 59.3099 +++YCCC 842.453560 3 0.0004 26 | 0/13
2 h-m-p 0.0013 0.0064 19.8963 YYC 842.254138 2 0.0011 44 | 0/13
3 h-m-p 0.0005 0.0059 40.8321 YCCC 841.955509 3 0.0011 65 | 0/13
4 h-m-p 0.0006 0.0030 56.0171 ++ 840.772390 m 0.0030 81 | 1/13
5 h-m-p 0.0042 0.0209 18.2695 YC 840.658839 1 0.0022 98 | 1/13
6 h-m-p 0.0016 0.0148 24.5280 YCCC 840.379624 3 0.0039 119 | 1/13
7 h-m-p 0.0003 0.0013 301.1933 +YCYCC 839.614432 4 0.0008 142 | 1/13
8 h-m-p 0.0039 0.0194 13.0165 CCC 839.567510 2 0.0016 162 | 1/13
9 h-m-p 0.0015 0.0816 13.9009 ++YCCC 838.627851 3 0.0382 185 | 1/13
10 h-m-p 0.4717 2.7366 1.1249 CYC 837.644792 2 0.4533 204 | 1/13
11 h-m-p 0.1744 0.8721 1.9122 YCCCCC 836.970186 5 0.2072 229 | 1/13
12 h-m-p 1.3735 8.0000 0.2884 YC 836.770718 1 0.7964 246 | 0/13
13 h-m-p 0.0190 0.2551 12.0975 CC 836.717941 1 0.0047 276 | 0/13
14 h-m-p 0.1375 8.0000 0.4164 ++YC 836.435279 1 1.4503 295 | 0/13
15 h-m-p 0.4636 8.0000 1.3026 YCCC 836.010974 3 0.9030 329 | 0/13
16 h-m-p 1.6000 8.0000 0.6100 CCCC 835.411776 3 1.9250 351 | 0/13
17 h-m-p 1.3047 8.0000 0.9000 YCCC 834.323461 3 3.3161 385 | 0/13
18 h-m-p 0.7474 3.7369 1.2515 CCCCC 833.848095 4 0.8562 422 | 0/13
19 h-m-p 0.2161 1.0803 3.6754 CCCC 833.462108 3 0.3548 444 | 0/13
20 h-m-p 0.6260 3.1302 0.5460 +YCCC 833.084139 3 1.6816 466 | 0/13
21 h-m-p 0.1353 0.6767 0.6512 ++ 832.796485 m 0.6767 495 | 1/13
22 h-m-p 0.1317 2.0052 3.3397 +YYYYCYCYCC 832.080368 10 0.8146 538 | 1/13
23 h-m-p 0.9947 8.0000 2.7350 CCYC 831.773316 3 1.0088 559 | 1/13
24 h-m-p 0.6734 8.0000 4.0973 YCCC 831.520272 3 0.3920 580 | 1/13
25 h-m-p 1.3599 8.0000 1.1810 CYC 831.259682 2 1.2646 599 | 1/13
26 h-m-p 1.2631 8.0000 1.1824 CCC 831.094300 2 1.8926 619 | 1/13
27 h-m-p 1.6000 8.0000 1.0374 CC 830.995471 1 2.3743 637 | 1/13
28 h-m-p 1.6000 8.0000 0.9945 +CCC 830.746524 2 6.2228 658 | 1/13
29 h-m-p 1.6000 8.0000 2.0897 CYCCCC 830.313498 5 2.4542 695 | 1/13
30 h-m-p 1.1294 8.0000 4.5408 YYCC 830.153758 3 0.9062 715 | 1/13
31 h-m-p 1.0618 8.0000 3.8750 CCCCC 830.062342 4 1.3627 739 | 1/13
32 h-m-p 1.6000 8.0000 2.7375 YC 830.029477 1 1.1079 756 | 1/13
33 h-m-p 1.4880 8.0000 2.0381 CCC 830.011353 2 1.7805 776 | 1/13
34 h-m-p 1.6000 8.0000 0.5168 CC 830.003385 1 1.9615 794 | 1/13
35 h-m-p 1.6000 8.0000 0.0556 CC 830.002710 1 1.4045 824 | 1/13
36 h-m-p 0.5617 8.0000 0.1389 +C 830.002518 0 2.0335 853 | 1/13
37 h-m-p 1.6000 8.0000 0.0273 Y 830.002468 0 1.1587 881 | 1/13
38 h-m-p 1.0320 8.0000 0.0307 YC 830.002425 1 2.0708 910 | 1/13
39 h-m-p 1.6000 8.0000 0.0308 C 830.002417 0 1.5392 938 | 1/13
40 h-m-p 1.6000 8.0000 0.0126 C 830.002417 0 1.7285 966 | 1/13
41 h-m-p 1.6000 8.0000 0.0017 C 830.002417 0 2.0682 994 | 1/13
42 h-m-p 1.6000 8.0000 0.0002 Y 830.002417 0 1.1492 1022 | 1/13
43 h-m-p 1.6000 8.0000 0.0000 C 830.002417 0 1.6000 1050 | 1/13
44 h-m-p 0.2417 8.0000 0.0000 ---------Y 830.002417 0 0.0000 1087
Out..
lnL = -830.002417
1088 lfun, 4352 eigenQcodon, 22848 P(t)
Time used: 0:17
Model 7: beta
TREE # 1
(1, (4, 5), (2, 3)); MP score: 60
0.043057 0.245700 0.084041 0.072892 0.031689 0.043024 0.062696 1.066965 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 9.488253
np = 10
lnL0 = -841.775155
Iterating by ming2
Initial: fx= 841.775155
x= 0.04306 0.24570 0.08404 0.07289 0.03169 0.04302 0.06270 1.06697 0.66567 1.54913
1 h-m-p 0.0000 0.0014 57.8395 +++YCCC 841.062197 3 0.0004 23 | 0/10
2 h-m-p 0.0012 0.0060 15.8021 YCC 840.976797 2 0.0007 39 | 0/10
3 h-m-p 0.0007 0.0190 16.9569 CC 840.922918 1 0.0007 54 | 0/10
4 h-m-p 0.0012 0.0202 9.5267 CCC 840.891566 2 0.0011 71 | 0/10
5 h-m-p 0.0028 0.0489 3.7105 YC 840.885117 1 0.0012 85 | 0/10
6 h-m-p 0.0016 0.4944 2.7933 CC 840.881766 1 0.0014 100 | 0/10
7 h-m-p 0.0004 0.1864 9.3054 ++YCC 840.805327 2 0.0105 118 | 0/10
8 h-m-p 0.0051 0.0253 14.7006 YCC 840.795266 2 0.0009 134 | 0/10
9 h-m-p 0.0073 0.8591 1.8152 +++YYYCYCYCCC 839.785698 9 0.5830 163 | 0/10
10 h-m-p 0.0108 0.0542 9.6544 YCCCCC 839.698035 5 0.0150 185 | 0/10
11 h-m-p 0.0870 0.4352 0.9557 +CCYYYCYC 838.147193 7 0.4187 209 | 0/10
12 h-m-p 0.0042 0.0209 0.8579 ++ 838.137128 m 0.0209 232 | 0/10
13 h-m-p 0.0000 0.0000 0.2417
h-m-p: 7.23024215e-18 3.61512108e-17 2.41713003e-01 838.137128
.. | 0/10
14 h-m-p 0.0001 0.0373 8.1199 +YC 838.118332 1 0.0006 277 | 0/10
15 h-m-p 0.0008 0.0219 6.0509 CC 838.106389 1 0.0009 292 | 0/10
16 h-m-p 0.0014 0.0704 4.0752 CC 838.098492 1 0.0015 307 | 0/10
17 h-m-p 0.0016 0.0196 3.8635 CC 838.096643 1 0.0005 322 | 0/10
18 h-m-p 0.0011 0.0952 1.7581 CC 838.095413 1 0.0012 337 | 0/10
19 h-m-p 0.0024 0.3446 0.9239 +YC 838.093517 1 0.0065 352 | 0/10
20 h-m-p 0.0007 0.1379 8.2054 +CC 838.085277 1 0.0033 378 | 0/10
21 h-m-p 0.0015 0.0482 17.9994 CC 838.078541 1 0.0012 393 | 0/10
22 h-m-p 0.0034 0.0168 0.0245 Y 838.078540 0 0.0079 406 | 0/10
23 h-m-p 0.1851 2.1499 0.0010 +C 838.078527 0 0.9144 430 | 0/10
24 h-m-p 0.3022 1.5108 0.0001 ++ 838.078527 m 1.5108 453 | 1/10
25 h-m-p 1.6000 8.0000 0.0000 Y 838.078527 0 1.0233 476 | 1/10
26 h-m-p 0.3290 8.0000 0.0000 Y 838.078527 0 0.1658 498 | 1/10
27 h-m-p 1.6000 8.0000 0.0000 --Y 838.078527 0 0.0250 522 | 1/10
28 h-m-p 0.0315 8.0000 0.0000 ------------Y 838.078527 0 0.0000 556
Out..
lnL = -838.078527
557 lfun, 6127 eigenQcodon, 38990 P(t)
Time used: 0:29
Model 8: beta&w>1
TREE # 1
(1, (4, 5), (2, 3)); MP score: 60
initial w for M8:NSbetaw>1 reset.
0.043057 0.245700 0.084041 0.072892 0.031689 0.043024 0.062696 1.079689 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.224321
np = 12
lnL0 = -837.995917
Iterating by ming2
Initial: fx= 837.995917
x= 0.04306 0.24570 0.08404 0.07289 0.03169 0.04302 0.06270 1.07969 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0016 58.9942 +++YYC 837.161468 2 0.0005 22 | 0/12
2 h-m-p 0.0013 0.0076 22.7771 CC 836.921784 1 0.0011 39 | 0/12
3 h-m-p 0.0008 0.0140 28.6641 CYC 836.779692 2 0.0007 57 | 0/12
4 h-m-p 0.0012 0.0134 18.0149 CC 836.676690 1 0.0012 74 | 0/12
5 h-m-p 0.0029 0.0303 7.3676 YC 836.650110 1 0.0014 90 | 0/12
6 h-m-p 0.0011 0.0162 9.5500 CYC 836.630986 2 0.0010 108 | 0/12
7 h-m-p 0.0008 0.0421 11.9972 +YCCC 836.514522 3 0.0059 129 | 0/12
8 h-m-p 0.0025 0.0143 28.2646 CYC 836.404679 2 0.0024 147 | 0/12
9 h-m-p 0.0036 0.0181 17.6566 YYCC 836.332661 3 0.0027 166 | 0/12
10 h-m-p 0.0437 1.6607 1.0775 ++YYCYCCCC 835.671488 7 0.9001 194 | 0/12
11 h-m-p 0.2548 1.2738 1.3231 YCCCC 835.521591 4 0.2614 216 | 0/12
12 h-m-p 0.1421 2.0431 2.4333 +YCCCCC 834.658234 5 0.7252 241 | 0/12
13 h-m-p 0.1805 0.9024 2.6640 CYCCC 834.312668 4 0.3437 263 | 0/12
14 h-m-p 0.3262 2.8097 2.8068 CYCC 833.933025 3 0.4288 283 | 0/12
15 h-m-p 0.8811 6.2759 1.3659 +YYYCCC 832.687070 5 3.1359 306 | 0/12
16 h-m-p 0.2050 1.0252 5.0879 CCC 832.453430 2 0.1578 325 | 0/12
17 h-m-p 0.1698 2.2694 4.7295 +YCYYCCC 831.305111 6 1.3216 350 | 0/12
18 h-m-p 0.0199 0.0994 24.6595 CYYYCC 831.071083 5 0.0488 373 | 0/12
19 h-m-p 0.0558 0.2788 5.1026 YYCCCCC 831.037720 6 0.0695 398 | 0/12
20 h-m-p 0.1120 1.6544 3.1643 +CYC 830.702163 2 0.9190 418 | 0/12
21 h-m-p 0.0365 0.1823 8.6320 ++ 830.552585 m 0.1823 433 | 1/12
22 h-m-p 0.1276 0.6380 6.1116 CCYYYC 830.438364 5 0.2275 456 | 1/12
23 h-m-p 0.0002 0.0008 1862.4775 ----------.. | 1/12
24 h-m-p 0.0000 0.0100 80.1775 YYYY 830.432430 3 0.0000 497 | 1/12
25 h-m-p 0.0007 0.0127 2.2549 CC 830.431888 1 0.0002 514 | 1/12
26 h-m-p 0.0000 0.0145 11.8467 ++YC 830.425273 1 0.0005 532 | 1/12
27 h-m-p 0.0018 0.0507 3.5933 CC 830.417067 1 0.0029 549 | 1/12
28 h-m-p 0.0015 0.0269 6.7010 CCC 830.408950 2 0.0017 568 | 1/12
29 h-m-p 0.0019 0.0363 5.9899 YC 830.405495 1 0.0009 584 | 1/12
30 h-m-p 0.0037 0.1710 1.5147 CC 830.404767 1 0.0012 601 | 1/12
31 h-m-p 0.0160 8.0000 0.2469 YC 830.404689 1 0.0028 617 | 1/12
32 h-m-p 0.0078 3.9138 1.0477 CC 830.403584 1 0.0103 645 | 1/12
33 h-m-p 0.0045 0.2618 2.3792 YC 830.402903 1 0.0029 661 | 1/12
34 h-m-p 0.1406 8.0000 0.0491 +++ 830.390130 m 8.0000 677 | 1/12
35 h-m-p 0.4929 8.0000 0.7962 +++ 830.273770 m 8.0000 704 | 1/12
36 h-m-p 1.6000 8.0000 2.2746 CCCCC 830.137728 4 2.0978 738 | 1/12
37 h-m-p 1.3304 8.0000 3.5868 CCC 830.058294 2 1.9753 757 | 1/12
38 h-m-p 1.6000 8.0000 2.3704 YCCC 830.046346 3 1.0138 777 | 1/12
39 h-m-p 1.6000 8.0000 1.2586 YC 830.040973 1 1.1610 793 | 1/12
40 h-m-p 1.6000 8.0000 0.2873 C 830.040233 0 1.7423 808 | 1/12
41 h-m-p 1.6000 8.0000 0.2012 C 830.040103 0 1.6000 834 | 1/12
42 h-m-p 1.6000 8.0000 0.0966 Y 830.040081 0 1.2335 860 | 1/12
43 h-m-p 1.6000 8.0000 0.0041 Y 830.040081 0 0.8919 886 | 0/12
44 h-m-p 0.1488 8.0000 0.0247 -C 830.040080 0 0.0119 913 | 0/12
45 h-m-p 0.2215 8.0000 0.0013 +C 830.040080 0 1.0013 941 | 0/12
46 h-m-p 1.6000 8.0000 0.0006 C 830.040080 0 1.7157 968 | 0/12
47 h-m-p 1.6000 8.0000 0.0003 Y 830.040080 0 2.5762 995 | 0/12
48 h-m-p 1.6000 8.0000 0.0002 C 830.040080 0 1.4124 1022 | 0/12
49 h-m-p 1.6000 8.0000 0.0000 C 830.040080 0 1.2894 1049 | 0/12
50 h-m-p 1.6000 8.0000 0.0000 ---Y 830.040080 0 0.0063 1079
Out..
lnL = -830.040080
1080 lfun, 12960 eigenQcodon, 83160 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -838.154935 S = -773.178741 -60.214866
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 74 patterns 0:56
did 20 / 74 patterns 0:56
did 30 / 74 patterns 0:56
did 40 / 74 patterns 0:56
did 50 / 74 patterns 0:56
did 60 / 74 patterns 0:57
did 70 / 74 patterns 0:57
did 74 / 74 patterns 0:57
Time used: 0:57
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=150
D_melanogaster_CG30334-PA MSSCRQFNPFYIGPYPERACGDCPYGEYSGFTRCGWSGGNGPFGTTFCDS
D_sechellia_CG30334-PA MSSCGQFNPFYIGPYPDRACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
D_simulans_CG30334-PA MSSCGQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
D_yakuba_CG30334-PA MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
D_erecta_CG30334-PA MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
*.** ***********:*********:***********************
D_melanogaster_CG30334-PA RYGGGGG----GGQGGGGGR------GGCGGRGRGGCAPSCGPRGGSWSC
D_sechellia_CG30334-PA RYGGGGG-GGGGGQGCGGGR------GGCGGRGRGACAPSCGPRGGSWSC
D_simulans_CG30334-PA RYGGGGGQGCGGGRSGCGGR------GGCGGRGRGACAPSCGPRGGSWSC
D_yakuba_CG30334-PA RYGGGGRRCGGGCGGCGGGGRGREGCGGCGGGGRGGCGPSCGPRSGGSSW
D_erecta_CG30334-PA RYGGGG---GGGGRRCGGGG------GGCGGRGRGGCGPSCGHR-GGSSW
****** * ** ***** ***.*.**** * *. *
D_melanogaster_CG30334-PA GPRPYSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooooooo-
D_sechellia_CG30334-PA GPRPCSPCYQFPNGADSCMMCSSGFGCCGQSCRASCYSCCoooooo----
D_simulans_CG30334-PA GPRPCSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooo-----
D_yakuba_CG30334-PA CPG-YSPYYQSPCGADSCMMCSSGFGCCGQSCRTSCYSCC----------
D_erecta_CG30334-PA GPR-YSQYYQSPCGVDSCMMCSSGFGCCGQSCRTSCYSCCoooooooooo
* * ** * *.******************:******
>D_melanogaster_CG30334-PA ATGTCCAGCTGCAGACAGTTCAATCCGTTCTACATTGGACCCTATCCGGA GCGTGCGTGCGGCGATTGTCCGTATGGCGAGTACTCGGGCTTCACCAGAT GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC CGCTATGGCGGAGGAGGAGGA------------GGCGGCCAAGGCGGTGG AGGAGGGAGA------------------GGTGGATGTGGAGGCAGAGGCA GAGGTGGTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT GGTCCCCGCCCGTATTCCCCGTGCTATCAATTTCCGTACGGAGCGGACAG CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG CATCCTGCTACTCCTGCTGC------------------------------ >D_sechellia_CG30334-PA ATGTCCAGCTGCGGGCAGTTCAATCCGTTCTACATTGGACCCTATCCGGA TCGTGCGTGCGGCGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC CGCTACGGCGGAGGAGGAGGA---GGAGGAGGAGGAGGCCAAGGCTGTGG AGGAGGGAGA------------------GGTGGTTGTGGAGGCAGAGGCA GAGGTGCTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT GGTCCCCGCCCGTGTTCCCCGTGCTATCAGTTTCCAAACGGAGCGGACAG CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG CATCCTGCTACTCCTGCTGC------------------------------ >D_simulans_CG30334-PA ATGTCCAGCTGCGGGCAGTTCAATCCGTTCTACATTGGACCCTATCCGGA GCGTGCGTGCGGCGATTGTCCGTATGGCCAGTATTCGGGCTTCACCAGAT GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC CGCTACGGCGGAGGAGGAGGCCAAGGCTGTGGAGGAGGGAGAAGTGGTTG TGGAGGGAGA------------------GGTGGTTGTGGAGGCAGAGGCA GAGGTGCTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT GGTCCCCGGCCGTGTTCCCCGTGCTATCAGTTTCCGTACGGAGCGGACAG CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG CATCCTGCTACTCCTGCTGC------------------------------ >D_yakuba_CG30334-PA ATGTGCAGCTGCAGACAGTTCAATCCGTTCTACATCGGACCCTATCCGGA GCGTGCCTGCGGGGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT GCGGATGGAGTGGCGGAAACGGTCCCTTCGGCACCACCTTCTGTGATTCC CGCTACGGTGGAGGAGGAAGGAGATGTGGAGGCGGCTGTGGTGGATGTGG AGGAGGAGGTAGAGGTAGAGAAGGATGTGGTGGATGTGGAGGAGGAGGCA GAGGTGGTTGTGGTCCATCGTGTGGTCCCCGTAGTGGCGGATCGTCCTGG TGTCCCGGC---TATTCCCCGTACTATCAGTCGCCGTGCGGAGCGGACAG CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCA CATCCTGCTACTCCTGCTGC------------------------------ >D_erecta_CG30334-PA ATGTGCAGCTGCAGACAGTTCAATCCGTTCTACATCGGACCCTATCCGGA GCGTGCTTGCGGGGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT GCGGATGGAGCGGCGGAAACGGTCCCTTTGGCACCACCTTCTGTGATTCC CGCTACGGTGGAGGCGGA---------GGAGGAGGAGGAAGGAGATGTGG AGGCGGAGGT------------------GGTGGATGTGGAGGAAGAGGCA GAGGTGGTTGTGGGCCATCGTGTGGTCATCGT---GGCGGATCGTCCTGG GGTCCCCGC---TATTCCCAGTACTATCAGTCGCCGTGCGGAGTGGACAG CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCA CATCCTGCTACTCCTGCTGC------------------------------
>D_melanogaster_CG30334-PA MSSCRQFNPFYIGPYPERACGDCPYGEYSGFTRCGWSGGNGPFGTTFCDS RYGGGGG----GGQGGGGGR------GGCGGRGRGGCAPSCGPRGGSWSC GPRPYSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCC >D_sechellia_CG30334-PA MSSCGQFNPFYIGPYPDRACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS RYGGGGG-GGGGGQGCGGGR------GGCGGRGRGACAPSCGPRGGSWSC GPRPCSPCYQFPNGADSCMMCSSGFGCCGQSCRASCYSCC >D_simulans_CG30334-PA MSSCGQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS RYGGGGGQGCGGGRSGCGGR------GGCGGRGRGACAPSCGPRGGSWSC GPRPCSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCC >D_yakuba_CG30334-PA MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS RYGGGGRRCGGGCGGCGGGGRGREGCGGCGGGGRGGCGPSCGPRSGGSSW CPG-YSPYYQSPCGADSCMMCSSGFGCCGQSCRTSCYSCC >D_erecta_CG30334-PA MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS RYGGGG---GGGGRRCGGGG------GGCGGRGRGGCGPSCGHR-GGSSW GPR-YSQYYQSPCGVDSCMMCSSGFGCCGQSCRTSCYSCC
#NEXUS
[ID: 3884859168]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_CG30334-PA
D_sechellia_CG30334-PA
D_simulans_CG30334-PA
D_yakuba_CG30334-PA
D_erecta_CG30334-PA
;
end;
begin trees;
translate
1 D_melanogaster_CG30334-PA,
2 D_sechellia_CG30334-PA,
3 D_simulans_CG30334-PA,
4 D_yakuba_CG30334-PA,
5 D_erecta_CG30334-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.01445263,(4:0.04887945,5:0.0266824)1.000:0.1604206,(2:0.01408803,3:0.04373599)0.963:0.02011126);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.01445263,(4:0.04887945,5:0.0266824):0.1604206,(2:0.01408803,3:0.04373599):0.02011126);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -991.88 -1000.56
2 -992.01 -1001.59
--------------------------------------
TOTAL -991.94 -1001.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.344790 0.003869 0.236055 0.467924 0.339093 1034.14 1081.85 1.000
r(A<->C){all} 0.235404 0.003950 0.122106 0.358438 0.230435 634.98 740.64 1.000
r(A<->G){all} 0.238452 0.003584 0.117628 0.352196 0.235823 664.98 769.66 1.000
r(A<->T){all} 0.158294 0.003493 0.050633 0.272693 0.152395 555.13 610.92 1.000
r(C<->G){all} 0.058448 0.000715 0.008355 0.108863 0.054925 711.11 934.32 1.000
r(C<->T){all} 0.170204 0.002511 0.071580 0.265215 0.166629 742.52 898.72 1.000
r(G<->T){all} 0.139197 0.001937 0.058864 0.228727 0.133619 637.13 796.06 1.000
pi(A){all} 0.172183 0.000281 0.141353 0.205084 0.171470 1173.97 1200.06 1.000
pi(C){all} 0.245360 0.000383 0.206399 0.283324 0.244968 1204.59 1338.55 1.000
pi(G){all} 0.357782 0.000493 0.315657 0.400682 0.356980 1285.57 1309.22 1.000
pi(T){all} 0.224674 0.000372 0.189596 0.263825 0.224057 1019.36 1092.87 1.000
alpha{1,2} 0.175482 0.024678 0.000112 0.446969 0.143566 1034.34 1055.00 1.000
alpha{3} 1.121037 0.368506 0.235638 2.303499 0.982908 1256.08 1378.54 1.000
pinvar{all} 0.218455 0.018306 0.000079 0.457781 0.207204 1149.03 1262.53 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/106/CG30334-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 127
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 1 2 | Ser TCT 1 1 1 0 0 | Tyr TAT 5 3 4 4 4 | Cys TGT 8 10 10 10 8
TTC 4 4 4 5 4 | TCC 8 8 8 7 7 | TAC 4 4 4 5 5 | TGC 10 10 10 11 11
Leu TTA 0 0 0 0 0 | TCA 0 0 0 0 0 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 0 0 0 0 0 | TCG 2 2 2 4 4 | TAG 0 0 0 0 0 | Trp TGG 2 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 | Pro CCT 1 1 1 0 0 | His CAT 0 0 0 0 1 | Arg CGT 2 2 2 2 2
CTC 0 0 0 0 0 | CCC 3 3 3 4 3 | CAC 0 0 0 0 0 | CGC 3 3 2 2 3
CTA 0 0 0 0 0 | CCA 1 2 1 1 1 | Gln CAA 3 2 1 1 1 | CGA 0 0 0 0 0
CTG 0 0 0 0 0 | CCG 5 4 5 5 4 | CAG 1 3 3 3 4 | CGG 0 0 1 0 0
----------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 0 0 | Thr ACT 0 0 0 0 0 | Asn AAT 1 1 1 1 1 | Ser AGT 2 2 3 2 1
ATC 0 0 0 1 1 | ACC 3 3 3 3 3 | AAC 1 2 1 1 1 | AGC 2 2 2 2 3
ATA 0 0 0 0 0 | ACA 0 0 0 1 1 | Lys AAA 0 0 0 0 0 | Arg AGA 5 4 5 3 5
Met ATG 3 3 3 3 3 | ACG 0 0 0 0 0 | AAG 0 0 0 0 0 | AGG 0 0 0 0 1
----------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 | Ala GCT 0 1 1 0 1 | Asp GAT 1 2 1 2 2 | Gly GGT 7 6 7 9 8
GTC 0 0 0 0 0 | GCC 0 0 0 1 0 | GAC 2 2 2 1 1 | GGC 13 12 10 10 10
GTA 0 0 0 0 0 | GCA 1 1 1 0 0 | Glu GAA 0 0 0 0 0 | GGA 12 12 11 17 15
GTG 0 0 0 0 1 | GCG 3 3 3 1 0 | GAG 2 0 1 1 1 | GGG 2 3 4 1 2
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG30334-PA
position 1: T:0.37008 C:0.14961 A:0.14173 G:0.33858
position 2: T:0.08661 C:0.22047 A:0.15748 G:0.53543
position 3: T:0.25197 C:0.41732 A:0.17323 G:0.15748
Average T:0.23622 C:0.26247 A:0.15748 G:0.34383
#2: D_sechellia_CG30334-PA
position 1: T:0.37008 C:0.15748 A:0.14173 G:0.33071
position 2: T:0.08661 C:0.22835 A:0.14961 G:0.53543
position 3: T:0.25984 C:0.41732 A:0.16535 G:0.15748
Average T:0.23885 C:0.26772 A:0.15223 G:0.34121
#3: D_simulans_CG30334-PA
position 1: T:0.37795 C:0.14961 A:0.14961 G:0.32283
position 2: T:0.08661 C:0.22835 A:0.14173 G:0.54331
position 3: T:0.27559 C:0.38583 A:0.14961 G:0.18898
Average T:0.24672 C:0.25459 A:0.14698 G:0.35171
#4: D_yakuba_CG30334-PA
position 1: T:0.38583 C:0.14173 A:0.13386 G:0.33858
position 2: T:0.07874 C:0.21260 A:0.14961 G:0.55906
position 3: T:0.24409 C:0.41732 A:0.18110 G:0.15748
Average T:0.23622 C:0.25722 A:0.15486 G:0.35171
#5: D_erecta_CG30334-PA
position 1: T:0.37008 C:0.14961 A:0.15748 G:0.32283
position 2: T:0.08661 C:0.18898 A:0.16535 G:0.55906
position 3: T:0.23622 C:0.40945 A:0.18110 G:0.17323
Average T:0.23097 C:0.24934 A:0.16798 G:0.35171
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 3 | Tyr Y TAT 20 | Cys C TGT 46
TTC 21 | TCC 38 | TAC 22 | TGC 52
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 14 | TAG 0 | Trp W TGG 10
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 3 | His H CAT 1 | Arg R CGT 10
CTC 0 | CCC 16 | CAC 0 | CGC 13
CTA 0 | CCA 6 | Gln Q CAA 8 | CGA 0
CTG 0 | CCG 23 | CAG 14 | CGG 1
------------------------------------------------------------------------------
Ile I ATT 3 | Thr T ACT 0 | Asn N AAT 5 | Ser S AGT 10
ATC 2 | ACC 15 | AAC 6 | AGC 11
ATA 0 | ACA 2 | Lys K AAA 0 | Arg R AGA 22
Met M ATG 15 | ACG 0 | AAG 0 | AGG 1
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 3 | Asp D GAT 8 | Gly G GGT 37
GTC 0 | GCC 1 | GAC 8 | GGC 55
GTA 0 | GCA 3 | Glu E GAA 0 | GGA 67
GTG 1 | GCG 10 | GAG 5 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.37480 C:0.14961 A:0.14488 G:0.33071
position 2: T:0.08504 C:0.21575 A:0.15276 G:0.54646
position 3: T:0.25354 C:0.40945 A:0.17008 G:0.16693
Average T:0.23780 C:0.25827 A:0.15591 G:0.34803
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG30334-PA
D_sechellia_CG30334-PA 0.3622 (0.0246 0.0680)
D_simulans_CG30334-PA 0.2144 (0.0264 0.1233) 0.3077 (0.0228 0.0742)
D_yakuba_CG30334-PA 0.2861 (0.0748 0.2613) 0.2935 (0.0862 0.2938) 0.2912 (0.0902 0.3096)
D_erecta_CG30334-PA 0.2535 (0.0727 0.2867) 0.2920 (0.0841 0.2881) 0.2516 (0.0764 0.3038) 0.3055 (0.0337 0.1103)
Model 0: one-ratio
TREE # 1: (1, (4, 5), (2, 3)); MP score: 60
lnL(ntime: 7 np: 9): -844.073680 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.030671 0.264429 0.079402 0.078019 0.042256 0.030526 0.072418 1.126814 0.364047
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.59772
(1: 0.030671, (4: 0.079402, 5: 0.078019): 0.264429, (2: 0.030526, 3: 0.072418): 0.042256);
(D_melanogaster_CG30334-PA: 0.030671, (D_yakuba_CG30334-PA: 0.079402, D_erecta_CG30334-PA: 0.078019): 0.264429, (D_sechellia_CG30334-PA: 0.030526, D_simulans_CG30334-PA: 0.072418): 0.042256);
Detailed output identifying parameters
kappa (ts/tv) = 1.12681
omega (dN/dS) = 0.36405
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.031 273.5 107.5 0.3640 0.0068 0.0188 1.9 2.0
6..7 0.264 273.5 107.5 0.3640 0.0590 0.1622 16.2 17.4
7..4 0.079 273.5 107.5 0.3640 0.0177 0.0487 4.8 5.2
7..5 0.078 273.5 107.5 0.3640 0.0174 0.0479 4.8 5.1
6..8 0.042 273.5 107.5 0.3640 0.0094 0.0259 2.6 2.8
8..2 0.031 273.5 107.5 0.3640 0.0068 0.0187 1.9 2.0
8..3 0.072 273.5 107.5 0.3640 0.0162 0.0444 4.4 4.8
tree length for dN: 0.1335
tree length for dS: 0.3666
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 60
lnL(ntime: 7 np: 10): -838.051446 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.033027 0.300570 0.081086 0.087956 0.044524 0.032468 0.077877 1.070748 0.617673 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.65751
(1: 0.033027, (4: 0.081086, 5: 0.087956): 0.300570, (2: 0.032468, 3: 0.077877): 0.044524);
(D_melanogaster_CG30334-PA: 0.033027, (D_yakuba_CG30334-PA: 0.081086, D_erecta_CG30334-PA: 0.087956): 0.300570, (D_sechellia_CG30334-PA: 0.032468, D_simulans_CG30334-PA: 0.077877): 0.044524);
Detailed output identifying parameters
kappa (ts/tv) = 1.07075
dN/dS (w) for site classes (K=2)
p: 0.61767 0.38233
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.033 274.5 106.5 0.3823 0.0076 0.0198 2.1 2.1
6..7 0.301 274.5 106.5 0.3823 0.0690 0.1805 18.9 19.2
7..4 0.081 274.5 106.5 0.3823 0.0186 0.0487 5.1 5.2
7..5 0.088 274.5 106.5 0.3823 0.0202 0.0528 5.5 5.6
6..8 0.045 274.5 106.5 0.3823 0.0102 0.0267 2.8 2.8
8..2 0.032 274.5 106.5 0.3823 0.0075 0.0195 2.0 2.1
8..3 0.078 274.5 106.5 0.3823 0.0179 0.0468 4.9 5.0
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 60
lnL(ntime: 7 np: 12): -830.039553 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.046816 0.448319 0.120106 0.119914 0.063684 0.046639 0.110860 1.056384 0.590881 0.398389 0.000001 48.524872
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.95634
(1: 0.046816, (4: 0.120106, 5: 0.119914): 0.448319, (2: 0.046639, 3: 0.110860): 0.063684);
(D_melanogaster_CG30334-PA: 0.046816, (D_yakuba_CG30334-PA: 0.120106, D_erecta_CG30334-PA: 0.119914): 0.448319, (D_sechellia_CG30334-PA: 0.046639, D_simulans_CG30334-PA: 0.110860): 0.063684);
Detailed output identifying parameters
kappa (ts/tv) = 1.05638
dN/dS (w) for site classes (K=3)
p: 0.59088 0.39839 0.01073
w: 0.00000 1.00000 48.52487
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.047 274.7 106.3 0.9191 0.0152 0.0166 4.2 1.8
6..7 0.448 274.7 106.3 0.9191 0.1459 0.1587 40.1 16.9
7..4 0.120 274.7 106.3 0.9191 0.0391 0.0425 10.7 4.5
7..5 0.120 274.7 106.3 0.9191 0.0390 0.0424 10.7 4.5
6..8 0.064 274.7 106.3 0.9191 0.0207 0.0225 5.7 2.4
8..2 0.047 274.7 106.3 0.9191 0.0152 0.0165 4.2 1.8
8..3 0.111 274.7 106.3 0.9191 0.0361 0.0392 9.9 4.2
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)
Pr(w>1) post mean +- SE for w
59 Q 1.000** 48.522
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)
Pr(w>1) post mean +- SE for w
59 Q 0.998** 8.151 +- 2.103
60 G 0.607 5.272 +- 3.902
85 S 0.639 5.496 +- 3.848
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.389 0.352 0.204 0.050 0.005 0.000 0.000 0.000 0.000 0.000
w2: 0.004 0.014 0.028 0.048 0.074 0.103 0.134 0.166 0.199 0.231
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.056
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.032 0.187
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.006 0.084 0.205
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.003 0.011 0.085 0.142
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.002 0.005 0.012 0.067 0.089
sum of density on p0-p1 = 1.000000
Time used: 0:10
Model 3: discrete (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 60
lnL(ntime: 7 np: 13): -830.002417 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.047105 0.452321 0.120512 0.121281 0.063629 0.046737 0.111514 1.066965 0.617275 0.372160 0.000001 1.142171 50.087343
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.96310
(1: 0.047105, (4: 0.120512, 5: 0.121281): 0.452321, (2: 0.046737, 3: 0.111514): 0.063629);
(D_melanogaster_CG30334-PA: 0.047105, (D_yakuba_CG30334-PA: 0.120512, D_erecta_CG30334-PA: 0.121281): 0.452321, (D_sechellia_CG30334-PA: 0.046737, D_simulans_CG30334-PA: 0.111514): 0.063629);
Detailed output identifying parameters
kappa (ts/tv) = 1.06697
dN/dS (w) for site classes (K=3)
p: 0.61728 0.37216 0.01056
w: 0.00000 1.14217 50.08734
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.047 274.5 106.5 0.9542 0.0155 0.0162 4.3 1.7
6..7 0.452 274.5 106.5 0.9542 0.1488 0.1559 40.8 16.6
7..4 0.121 274.5 106.5 0.9542 0.0396 0.0415 10.9 4.4
7..5 0.121 274.5 106.5 0.9542 0.0399 0.0418 11.0 4.5
6..8 0.064 274.5 106.5 0.9542 0.0209 0.0219 5.7 2.3
8..2 0.047 274.5 106.5 0.9542 0.0154 0.0161 4.2 1.7
8..3 0.112 274.5 106.5 0.9542 0.0367 0.0384 10.1 4.1
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)
Pr(w>1) post mean +- SE for w
2 S 1.000** 1.144
5 R 1.000** 1.163
17 E 1.000** 1.142
27 E 1.000** 1.145
58 G 1.000** 4.028
59 Q 1.000** 50.082
60 G 1.000** 12.537
61 G 1.000** 1.492
62 G 1.000** 1.688
65 R 1.000** 1.151
71 R 1.000** 1.144
75 G 1.000** 1.172
77 A 1.000** 1.188
82 P 1.000** 1.157
85 S 1.000** 2.317
86 W 1.000** 1.143
88 C 1.000** 1.144
89 G 1.000** 1.167
91 R 1.000** 1.180
92 Y 1.000** 1.145
94 P 1.000** 1.152
95 C 1.000** 1.144
98 F 1.000** 1.145
100 Y 1.000** 1.238
102 A 1.000** 1.151
121 A 1.000** 1.150
Note: more than one w>1. Check rst for details
Time used: 0:17
Model 7: beta (10 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 60
lnL(ntime: 7 np: 10): -838.078527 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.033272 0.301865 0.081734 0.088508 0.044846 0.032706 0.078442 1.079689 0.005000 0.007530
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.66137
(1: 0.033272, (4: 0.081734, 5: 0.088508): 0.301865, (2: 0.032706, 3: 0.078442): 0.044846);
(D_melanogaster_CG30334-PA: 0.033272, (D_yakuba_CG30334-PA: 0.081734, D_erecta_CG30334-PA: 0.088508): 0.301865, (D_sechellia_CG30334-PA: 0.032706, D_simulans_CG30334-PA: 0.078442): 0.044846);
Detailed output identifying parameters
kappa (ts/tv) = 1.07969
Parameters in M7 (beta):
p = 0.00500 q = 0.00753
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.033 274.3 106.7 0.4000 0.0078 0.0195 2.1 2.1
6..7 0.302 274.3 106.7 0.4000 0.0709 0.1772 19.4 18.9
7..4 0.082 274.3 106.7 0.4000 0.0192 0.0480 5.3 5.1
7..5 0.089 274.3 106.7 0.4000 0.0208 0.0519 5.7 5.5
6..8 0.045 274.3 106.7 0.4000 0.0105 0.0263 2.9 2.8
8..2 0.033 274.3 106.7 0.4000 0.0077 0.0192 2.1 2.0
8..3 0.078 274.3 106.7 0.4000 0.0184 0.0460 5.1 4.9
Time used: 0:29
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 60
lnL(ntime: 7 np: 12): -830.040080 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.046789 0.448237 0.120029 0.119847 0.063648 0.046611 0.110795 1.055007 0.989266 0.005284 0.007996 48.375166
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.95596
(1: 0.046789, (4: 0.120029, 5: 0.119847): 0.448237, (2: 0.046611, 3: 0.110795): 0.063648);
(D_melanogaster_CG30334-PA: 0.046789, (D_yakuba_CG30334-PA: 0.120029, D_erecta_CG30334-PA: 0.119847): 0.448237, (D_sechellia_CG30334-PA: 0.046611, D_simulans_CG30334-PA: 0.110795): 0.063648);
Detailed output identifying parameters
kappa (ts/tv) = 1.05501
Parameters in M8 (beta&w>1):
p0 = 0.98927 p = 0.00528 q = 0.00800
(p1 = 0.01073) w = 48.37517
dN/dS (w) for site classes (K=11)
p: 0.09893 0.09893 0.09893 0.09893 0.09893 0.09893 0.09893 0.09893 0.09893 0.09893 0.01073
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000 1.00000 48.37517
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.047 274.8 106.2 0.9150 0.0152 0.0166 4.2 1.8
6..7 0.448 274.8 106.2 0.9150 0.1456 0.1592 40.0 16.9
7..4 0.120 274.8 106.2 0.9150 0.0390 0.0426 10.7 4.5
7..5 0.120 274.8 106.2 0.9150 0.0389 0.0426 10.7 4.5
6..8 0.064 274.8 106.2 0.9150 0.0207 0.0226 5.7 2.4
8..2 0.047 274.8 106.2 0.9150 0.0151 0.0166 4.2 1.8
8..3 0.111 274.8 106.2 0.9150 0.0360 0.0393 9.9 4.2
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)
Pr(w>1) post mean +- SE for w
59 Q 1.000** 48.372
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)
Pr(w>1) post mean +- SE for w
59 Q 0.999** 7.907 +- 2.175
60 G 0.707 5.786 +- 3.778
85 S 0.745 6.048 +- 3.667
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.006 0.052 0.940
p : 0.090 0.222 0.263 0.209 0.120 0.056 0.024 0.010 0.004 0.002
q : 0.006 0.053 0.052 0.080 0.099 0.114 0.129 0.143 0.156 0.169
ws: 0.005 0.019 0.035 0.056 0.084 0.113 0.141 0.164 0.183 0.199
Time used: 0:57
Model 1: NearlyNeutral -838.051446
Model 2: PositiveSelection -830.039553
Model 0: one-ratio -844.07368
Model 3: discrete -830.002417
Model 7: beta -838.078527
Model 8: beta&w>1 -830.04008
Model 0 vs 1 12.044467999999824
Model 2 vs 1 16.0237860000002
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)
Pr(w>1) post mean +- SE for w
59 Q 1.000** 48.522
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)
Pr(w>1) post mean +- SE for w
59 Q 0.998** 8.151 +- 2.103
60 G 0.607 5.272 +- 3.902
85 S 0.639 5.496 +- 3.848
Model 8 vs 7 16.07689400000004
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)
Pr(w>1) post mean +- SE for w
59 Q 1.000** 48.372
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)
Pr(w>1) post mean +- SE for w
59 Q 0.999** 7.907 +- 2.175
60 G 0.707 5.786 +- 3.778
85 S 0.745 6.048 +- 3.667
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
