--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Nov 17 15:43:57 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/106/CG30334-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -991.88         -1000.56
2       -992.01         -1001.59
--------------------------------------
TOTAL     -991.94         -1001.20
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.344790    0.003869    0.236055    0.467924    0.339093   1034.14   1081.85    1.000
r(A<->C){all}   0.235404    0.003950    0.122106    0.358438    0.230435    634.98    740.64    1.000
r(A<->G){all}   0.238452    0.003584    0.117628    0.352196    0.235823    664.98    769.66    1.000
r(A<->T){all}   0.158294    0.003493    0.050633    0.272693    0.152395    555.13    610.92    1.000
r(C<->G){all}   0.058448    0.000715    0.008355    0.108863    0.054925    711.11    934.32    1.000
r(C<->T){all}   0.170204    0.002511    0.071580    0.265215    0.166629    742.52    898.72    1.000
r(G<->T){all}   0.139197    0.001937    0.058864    0.228727    0.133619    637.13    796.06    1.000
pi(A){all}      0.172183    0.000281    0.141353    0.205084    0.171470   1173.97   1200.06    1.000
pi(C){all}      0.245360    0.000383    0.206399    0.283324    0.244968   1204.59   1338.55    1.000
pi(G){all}      0.357782    0.000493    0.315657    0.400682    0.356980   1285.57   1309.22    1.000
pi(T){all}      0.224674    0.000372    0.189596    0.263825    0.224057   1019.36   1092.87    1.000
alpha{1,2}      0.175482    0.024678    0.000112    0.446969    0.143566   1034.34   1055.00    1.000
alpha{3}        1.121037    0.368506    0.235638    2.303499    0.982908   1256.08   1378.54    1.000
pinvar{all}     0.218455    0.018306    0.000079    0.457781    0.207204   1149.03   1262.53    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-838.051446
Model 2: PositiveSelection	-830.039553
Model 0: one-ratio	-844.07368
Model 3: discrete	-830.002417
Model 7: beta	-838.078527
Model 8: beta&w>1	-830.04008


Model 0 vs 1	12.044467999999824

Model 2 vs 1	16.0237860000002

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)

            Pr(w>1)     post mean +- SE for w

    59 Q      1.000**       48.522

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)

            Pr(w>1)     post mean +- SE for w

    59 Q      0.998**       8.151 +- 2.103
    60 G      0.607         5.272 +- 3.902
    85 S      0.639         5.496 +- 3.848


Model 8 vs 7	16.07689400000004

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)

            Pr(w>1)     post mean +- SE for w

    59 Q      1.000**       48.372

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30334-PA)

            Pr(w>1)     post mean +- SE for w

    59 Q      0.999**       7.907 +- 2.175
    60 G      0.707         5.786 +- 3.778
    85 S      0.745         6.048 +- 3.667

>C1
MSSCRQFNPFYIGPYPERACGDCPYGEYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGGGQGGGGGRGGCGGRGRGGCAPSCGPRGGSWSCGPRPYSPCYQ
FPYGADSCMMCSSGFGCCGQSCRASCYSCCooooooooo
>C2
MSSCGQFNPFYIGPYPDRACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGGGGGGQGCGGGRGGCGGRGRGACAPSCGPRGGSWSCGPRPCSP
CYQFPNGADSCMMCSSGFGCCGQSCRASCYSCCoooooo
>C3
MSSCGQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGQGCGGGRSGCGGRGGCGGRGRGACAPSCGPRGGSWSCGPRPCS
PCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooo
>C4
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGRRCGGGCGGCGGGGRGREGCGGCGGGGRGGCGPSCGPRSGGSSW
CPGYSPYYQSPCGADSCMMCSSGFGCCGQSCRTSCYSCC
>C5
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGGGGRRCGGGGGGCGGRGRGGCGPSCGHRGGSSWGPRYSQYYQS
PCGVDSCMMCSSGFGCCGQSCRTSCYSCCoooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=150 

C1              MSSCRQFNPFYIGPYPERACGDCPYGEYSGFTRCGWSGGNGPFGTTFCDS
C2              MSSCGQFNPFYIGPYPDRACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
C3              MSSCGQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
C4              MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
C5              MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
                *.** ***********:*********:***********************

C1              RYGGGGG----GGQGGGGGR------GGCGGRGRGGCAPSCGPRGGSWSC
C2              RYGGGGG-GGGGGQGCGGGR------GGCGGRGRGACAPSCGPRGGSWSC
C3              RYGGGGGQGCGGGRSGCGGR------GGCGGRGRGACAPSCGPRGGSWSC
C4              RYGGGGRRCGGGCGGCGGGGRGREGCGGCGGGGRGGCGPSCGPRSGGSSW
C5              RYGGGG---GGGGRRCGGGG------GGCGGRGRGGCGPSCGHR-GGSSW
                ******     *     **       ***** ***.*.**** * *. * 

C1              GPRPYSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooooooo-
C2              GPRPCSPCYQFPNGADSCMMCSSGFGCCGQSCRASCYSCCoooooo----
C3              GPRPCSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooo-----
C4              CPG-YSPYYQSPCGADSCMMCSSGFGCCGQSCRTSCYSCC----------
C5              GPR-YSQYYQSPCGVDSCMMCSSGFGCCGQSCRTSCYSCCoooooooooo
                 *   *  ** * *.******************:******          




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  139 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  139 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4694]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [4694]--->[4251]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/106/CG30334-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.260 Mb, Max= 30.495 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSSCRQFNPFYIGPYPERACGDCPYGEYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGG----GGQGGGGGR------GGCGGRGRGGCAPSCGPRGGSWSC
GPRPYSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooooooo-
>C2
MSSCGQFNPFYIGPYPDRACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGG-GGGGGQGCGGGR------GGCGGRGRGACAPSCGPRGGSWSC
GPRPCSPCYQFPNGADSCMMCSSGFGCCGQSCRASCYSCCoooooo----
>C3
MSSCGQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGQGCGGGRSGCGGR------GGCGGRGRGACAPSCGPRGGSWSC
GPRPCSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooo-----
>C4
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGRRCGGGCGGCGGGGRGREGCGGCGGGGRGGCGPSCGPRSGGSSW
CPG-YSPYYQSPCGADSCMMCSSGFGCCGQSCRTSCYSCC----------
>C5
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGG---GGGGRRCGGGG------GGCGGRGRGGCGPSCGHR-GGSSW
GPR-YSQYYQSPCGVDSCMMCSSGFGCCGQSCRTSCYSCCoooooooooo

FORMAT of file /tmp/tmp1756401708883576796aln Not Supported[FATAL:T-COFFEE]
>C1
MSSCRQFNPFYIGPYPERACGDCPYGEYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGG----GGQGGGGGR------GGCGGRGRGGCAPSCGPRGGSWSC
GPRPYSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooooooo-
>C2
MSSCGQFNPFYIGPYPDRACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGG-GGGGGQGCGGGR------GGCGGRGRGACAPSCGPRGGSWSC
GPRPCSPCYQFPNGADSCMMCSSGFGCCGQSCRASCYSCCoooooo----
>C3
MSSCGQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGQGCGGGRSGCGGR------GGCGGRGRGACAPSCGPRGGSWSC
GPRPCSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCCooooo-----
>C4
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGRRCGGGCGGCGGGGRGREGCGGCGGGGRGGCGPSCGPRSGGSSW
CPG-YSPYYQSPCGADSCMMCSSGFGCCGQSCRTSCYSCC----------
>C5
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGG---GGGGRRCGGGG------GGCGGRGRGGCGPSCGHR-GGSSW
GPR-YSQYYQSPCGVDSCMMCSSGFGCCGQSCRTSCYSCCoooooooooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:150 S:87 BS:150
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 94.85 C1	 C2	 94.85
TOP	    1    0	 94.85 C2	 C1	 94.85
BOT	    0    2	 94.81 C1	 C3	 94.81
TOP	    2    0	 94.81 C3	 C1	 94.81
BOT	    0    3	 85.27 C1	 C4	 85.27
TOP	    3    0	 85.27 C4	 C1	 85.27
BOT	    0    4	 87.50 C1	 C5	 87.50
TOP	    4    0	 87.50 C5	 C1	 87.50
BOT	    1    2	 94.93 C2	 C3	 94.93
TOP	    2    1	 94.93 C3	 C2	 94.93
BOT	    1    3	 83.33 C2	 C4	 83.33
TOP	    3    1	 83.33 C4	 C2	 83.33
BOT	    1    4	 85.93 C2	 C5	 85.93
TOP	    4    1	 85.93 C5	 C2	 85.93
BOT	    2    3	 80.45 C3	 C4	 80.45
TOP	    3    2	 80.45 C4	 C3	 80.45
BOT	    2    4	 85.07 C3	 C5	 85.07
TOP	    4    2	 85.07 C5	 C3	 85.07
BOT	    3    4	 93.02 C4	 C5	 93.02
TOP	    4    3	 93.02 C5	 C4	 93.02
AVG	 0	 C1	  *	 90.61
AVG	 1	 C2	  *	 89.76
AVG	 2	 C3	  *	 88.82
AVG	 3	 C4	  *	 85.52
AVG	 4	 C5	  *	 87.88
TOT	 TOT	  *	 88.52
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTCCAGCTGCAGACAGTTCAATCCGTTCTACATTGGACCCTATCCGGA
C2              ATGTCCAGCTGCGGGCAGTTCAATCCGTTCTACATTGGACCCTATCCGGA
C3              ATGTCCAGCTGCGGGCAGTTCAATCCGTTCTACATTGGACCCTATCCGGA
C4              ATGTGCAGCTGCAGACAGTTCAATCCGTTCTACATCGGACCCTATCCGGA
C5              ATGTGCAGCTGCAGACAGTTCAATCCGTTCTACATCGGACCCTATCCGGA
                **** *******.*.******************** **************

C1              GCGTGCGTGCGGCGATTGTCCGTATGGCGAGTACTCGGGCTTCACCAGAT
C2              TCGTGCGTGCGGCGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT
C3              GCGTGCGTGCGGCGATTGTCCGTATGGCCAGTATTCGGGCTTCACCAGAT
C4              GCGTGCCTGCGGGGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT
C5              GCGTGCTTGCGGGGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT
                 ***** ***** *************** **** ****************

C1              GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC
C2              GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC
C3              GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC
C4              GCGGATGGAGTGGCGGAAACGGTCCCTTCGGCACCACCTTCTGTGATTCC
C5              GCGGATGGAGCGGCGGAAACGGTCCCTTTGGCACCACCTTCTGTGATTCC
                ********** *****:***** ***** ***************** ***

C1              CGCTATGGCGGAGGAGGAGGA------------GGCGGCCAAGGCGGTGG
C2              CGCTACGGCGGAGGAGGAGGA---GGAGGAGGAGGAGGCCAAGGCTGTGG
C3              CGCTACGGCGGAGGAGGAGGCCAAGGCTGTGGAGGAGGGAGAAGTGGTTG
C4              CGCTACGGTGGAGGAGGAAGGAGATGTGGAGGCGGCTGTGGTGGATGTGG
C5              CGCTACGGTGGAGGCGGA---------GGAGGAGGAGGAAGGAGATGTGG
                ***** ** *****.***               **. *  . .*  ** *

C1              AGGAGGGAGA------------------GGTGGATGTGGAGGCAGAGGCA
C2              AGGAGGGAGA------------------GGTGGTTGTGGAGGCAGAGGCA
C3              TGGAGGGAGA------------------GGTGGTTGTGGAGGCAGAGGCA
C4              AGGAGGAGGTAGAGGTAGAGAAGGATGTGGTGGATGTGGAGGAGGAGGCA
C5              AGGCGGAGGT------------------GGTGGATGTGGAGGAAGAGGCA
                :**.**..*:                  *****:********..******

C1              GAGGTGGTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT
C2              GAGGTGCTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT
C3              GAGGTGCTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT
C4              GAGGTGGTTGTGGTCCATCGTGTGGTCCCCGTAGTGGCGGATCGTCCTGG
C5              GAGGTGGTTGTGGGCCATCGTGTGGTCATCGT---GGCGGATCGTCCTGG
                ****** *****  ***** *******. ***   **.  .* ****** 

C1              GGTCCCCGCCCGTATTCCCCGTGCTATCAATTTCCGTACGGAGCGGACAG
C2              GGTCCCCGCCCGTGTTCCCCGTGCTATCAGTTTCCAAACGGAGCGGACAG
C3              GGTCCCCGGCCGTGTTCCCCGTGCTATCAGTTTCCGTACGGAGCGGACAG
C4              TGTCCCGGC---TATTCCCCGTACTATCAGTCGCCGTGCGGAGCGGACAG
C5              GGTCCCCGC---TATTCCCAGTACTATCAGTCGCCGTGCGGAGTGGACAG
                 ***** *    *.*****.**.******.*  **.:.***** ******

C1              CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG
C2              CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG
C3              CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG
C4              CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCA
C5              CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCA
                *************************************************.

C1              CATCCTGCTACTCCTGCTGC------------------------------
C2              CATCCTGCTACTCCTGCTGC------------------------------
C3              CATCCTGCTACTCCTGCTGC------------------------------
C4              CATCCTGCTACTCCTGCTGC------------------------------
C5              CATCCTGCTACTCCTGCTGC------------------------------
                ********************                              



>C1
ATGTCCAGCTGCAGACAGTTCAATCCGTTCTACATTGGACCCTATCCGGA
GCGTGCGTGCGGCGATTGTCCGTATGGCGAGTACTCGGGCTTCACCAGAT
GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC
CGCTATGGCGGAGGAGGAGGA------------GGCGGCCAAGGCGGTGG
AGGAGGGAGA------------------GGTGGATGTGGAGGCAGAGGCA
GAGGTGGTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT
GGTCCCCGCCCGTATTCCCCGTGCTATCAATTTCCGTACGGAGCGGACAG
CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG
CATCCTGCTACTCCTGCTGC------------------------------
>C2
ATGTCCAGCTGCGGGCAGTTCAATCCGTTCTACATTGGACCCTATCCGGA
TCGTGCGTGCGGCGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT
GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC
CGCTACGGCGGAGGAGGAGGA---GGAGGAGGAGGAGGCCAAGGCTGTGG
AGGAGGGAGA------------------GGTGGTTGTGGAGGCAGAGGCA
GAGGTGCTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT
GGTCCCCGCCCGTGTTCCCCGTGCTATCAGTTTCCAAACGGAGCGGACAG
CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG
CATCCTGCTACTCCTGCTGC------------------------------
>C3
ATGTCCAGCTGCGGGCAGTTCAATCCGTTCTACATTGGACCCTATCCGGA
GCGTGCGTGCGGCGATTGTCCGTATGGCCAGTATTCGGGCTTCACCAGAT
GCGGATGGAGTGGCGGTAACGGGCCCTTTGGCACCACCTTCTGTGACTCC
CGCTACGGCGGAGGAGGAGGCCAAGGCTGTGGAGGAGGGAGAAGTGGTTG
TGGAGGGAGA------------------GGTGGTTGTGGAGGCAGAGGCA
GAGGTGCTTGTGCGCCATCTTGTGGTCCTCGTGGCGGATCGTGGTCCTGT
GGTCCCCGGCCGTGTTCCCCGTGCTATCAGTTTCCGTACGGAGCGGACAG
CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCG
CATCCTGCTACTCCTGCTGC------------------------------
>C4
ATGTGCAGCTGCAGACAGTTCAATCCGTTCTACATCGGACCCTATCCGGA
GCGTGCCTGCGGGGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT
GCGGATGGAGTGGCGGAAACGGTCCCTTCGGCACCACCTTCTGTGATTCC
CGCTACGGTGGAGGAGGAAGGAGATGTGGAGGCGGCTGTGGTGGATGTGG
AGGAGGAGGTAGAGGTAGAGAAGGATGTGGTGGATGTGGAGGAGGAGGCA
GAGGTGGTTGTGGTCCATCGTGTGGTCCCCGTAGTGGCGGATCGTCCTGG
TGTCCCGGC---TATTCCCCGTACTATCAGTCGCCGTGCGGAGCGGACAG
CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCA
CATCCTGCTACTCCTGCTGC------------------------------
>C5
ATGTGCAGCTGCAGACAGTTCAATCCGTTCTACATCGGACCCTATCCGGA
GCGTGCTTGCGGGGATTGTCCGTATGGCCAGTACTCGGGCTTCACCAGAT
GCGGATGGAGCGGCGGAAACGGTCCCTTTGGCACCACCTTCTGTGATTCC
CGCTACGGTGGAGGCGGA---------GGAGGAGGAGGAAGGAGATGTGG
AGGCGGAGGT------------------GGTGGATGTGGAGGAAGAGGCA
GAGGTGGTTGTGGGCCATCGTGTGGTCATCGT---GGCGGATCGTCCTGG
GGTCCCCGC---TATTCCCAGTACTATCAGTCGCCGTGCGGAGTGGACAG
CTGCATGATGTGCTCCAGTGGATTTGGCTGCTGTGGCCAATCCTGTCGCA
CATCCTGCTACTCCTGCTGC------------------------------
>C1
MSSCRQFNPFYIGPYPERACGDCPYGEYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGooooGGQGGGGGRooooooGGCGGRGRGGCAPSCGPRGGSWSC
GPRPYSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCC
>C2
MSSCGQFNPFYIGPYPDRACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGoGGGGGQGCGGGRooooooGGCGGRGRGACAPSCGPRGGSWSC
GPRPCSPCYQFPNGADSCMMCSSGFGCCGQSCRASCYSCC
>C3
MSSCGQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGGQGCGGGRSGCGGRooooooGGCGGRGRGACAPSCGPRGGSWSC
GPRPCSPCYQFPYGADSCMMCSSGFGCCGQSCRASCYSCC
>C4
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGRRCGGGCGGCGGGGRGREGCGGCGGGGRGGCGPSCGPRSGGSSW
CPGoYSPYYQSPCGADSCMMCSSGFGCCGQSCRTSCYSCC
>C5
MCSCRQFNPFYIGPYPERACGDCPYGQYSGFTRCGWSGGNGPFGTTFCDS
RYGGGGoooGGGGRRCGGGGooooooGGCGGRGRGGCGPSCGHRoGGSSW
GPRoYSQYYQSPCGVDSCMMCSSGFGCCGQSCRTSCYSCC


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 450 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1479397188
      Setting output file names to "/opt/ADOPS/106/CG30334-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1080390092
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 3884859168
      Seed = 74374420
      Swapseed = 1479397188
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 27 unique site patterns
      Division 2 has 22 unique site patterns
      Division 3 has 42 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1207.615297 -- -25.624409
         Chain 2 -- -1219.221317 -- -25.624409
         Chain 3 -- -1123.211300 -- -25.624409
         Chain 4 -- -1202.460183 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1220.103946 -- -25.624409
         Chain 2 -- -1190.319594 -- -25.624409
         Chain 3 -- -1184.989929 -- -25.624409
         Chain 4 -- -1202.460183 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1207.615] (-1219.221) (-1123.211) (-1202.460) * [-1220.104] (-1190.320) (-1184.990) (-1202.460) 
        500 -- (-1011.814) (-1008.027) [-999.687] (-1002.034) * [-1009.251] (-1004.731) (-1014.217) (-1009.928) -- 0:00:00
       1000 -- (-1003.713) (-1002.837) (-996.864) [-996.037] * (-996.983) (-1003.859) [-997.257] (-1009.463) -- 0:16:39
       1500 -- (-994.394) (-997.849) [-1003.701] (-994.887) * (-1004.054) (-998.586) [-998.680] (-1004.795) -- 0:11:05
       2000 -- (-997.168) (-999.073) [-992.435] (-996.530) * (-998.753) (-991.375) [-1000.931] (-998.019) -- 0:08:19
       2500 -- [-995.165] (-997.121) (-998.997) (-991.858) * (-998.586) (-990.569) [-993.515] (-999.938) -- 0:06:39
       3000 -- (-994.724) (-994.120) (-997.214) [-991.811] * [-991.986] (-994.769) (-1000.806) (-1001.050) -- 0:05:32
       3500 -- (-995.333) [-992.951] (-996.661) (-998.688) * (-996.506) [-1001.993] (-999.627) (-996.952) -- 0:04:44
       4000 -- (-995.953) [-991.410] (-998.908) (-995.135) * (-995.865) [-994.448] (-996.590) (-1000.433) -- 0:04:09
       4500 -- (-997.255) [-993.542] (-1001.300) (-997.164) * [-990.282] (-992.351) (-994.646) (-993.646) -- 0:03:41
       5000 -- (-994.914) (-998.086) [-995.101] (-995.306) * (-993.013) [-995.672] (-999.065) (-996.819) -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-996.057) (-994.889) [-996.662] (-997.031) * [-989.316] (-992.044) (-997.326) (-997.457) -- 0:03:00
       6000 -- [-995.833] (-995.938) (-1000.468) (-990.904) * (-997.541) [-994.554] (-994.017) (-995.398) -- 0:05:31
       6500 -- [-993.696] (-996.735) (-996.512) (-992.734) * [-997.819] (-990.858) (-995.643) (-993.110) -- 0:05:05
       7000 -- (-994.487) [-993.700] (-992.182) (-997.976) * (-993.998) [-995.040] (-989.909) (-996.642) -- 0:04:43
       7500 -- (-991.930) (-993.016) [-994.942] (-995.148) * (-996.413) [-991.470] (-997.395) (-995.519) -- 0:04:24
       8000 -- (-993.422) [-992.882] (-997.090) (-998.451) * (-994.454) [-994.095] (-994.338) (-991.937) -- 0:04:08
       8500 -- (-992.612) (-1004.760) [-997.956] (-997.885) * (-990.791) (-992.134) [-993.932] (-997.850) -- 0:03:53
       9000 -- [-991.643] (-992.555) (-1000.748) (-998.358) * (-997.141) (-995.592) [-995.032] (-994.310) -- 0:03:40
       9500 -- (-994.425) (-997.239) (-997.603) [-992.226] * [-993.512] (-995.700) (-996.366) (-995.381) -- 0:03:28
      10000 -- (-994.524) [-992.229] (-996.473) (-994.802) * [-991.323] (-996.042) (-999.005) (-994.761) -- 0:03:18

      Average standard deviation of split frequencies: 0.044194

      10500 -- (-1001.476) (-993.748) (-995.916) [-993.919] * [-991.048] (-990.077) (-996.915) (-994.690) -- 0:03:08
      11000 -- (-1000.225) [-997.621] (-1001.036) (-993.832) * (-992.344) [-993.078] (-999.819) (-996.781) -- 0:02:59
      11500 -- (-1001.237) (-999.832) (-994.988) [-997.802] * (-993.016) [-992.359] (-998.460) (-993.958) -- 0:04:17
      12000 -- [-994.260] (-996.394) (-993.213) (-996.450) * (-993.654) (-993.729) [-1000.359] (-993.411) -- 0:04:07
      12500 -- [-995.257] (-998.143) (-995.886) (-998.663) * [-994.730] (-993.906) (-991.241) (-992.792) -- 0:03:57
      13000 -- (-999.959) [-993.948] (-992.541) (-996.301) * (-995.787) [-993.964] (-1002.187) (-997.758) -- 0:03:47
      13500 -- (-993.560) [-992.636] (-991.470) (-995.855) * (-990.401) (-997.774) (-999.238) [-997.241] -- 0:03:39
      14000 -- (-995.218) [-992.444] (-995.229) (-996.090) * (-993.970) (-997.480) (-1000.728) [-994.604] -- 0:03:31
      14500 -- (-995.860) (-998.961) [-992.156] (-995.944) * (-996.614) (-995.752) [-998.757] (-1001.258) -- 0:03:23
      15000 -- (-995.327) [-990.659] (-991.787) (-995.766) * [-992.981] (-1000.374) (-992.998) (-1001.552) -- 0:03:17

      Average standard deviation of split frequencies: 0.044194

      15500 -- [-989.935] (-992.785) (-994.175) (-998.129) * (-998.792) [-990.645] (-999.971) (-998.051) -- 0:03:10
      16000 -- (-990.767) [-991.673] (-995.684) (-996.009) * (-997.807) (-995.952) (-996.982) [-992.667] -- 0:03:04
      16500 -- (-995.670) (-990.440) [-993.887] (-999.626) * (-999.311) (-992.026) [-993.938] (-990.912) -- 0:02:58
      17000 -- (-996.515) [-996.749] (-992.862) (-1000.100) * (-1006.947) (-993.414) (-996.914) [-993.135] -- 0:03:51
      17500 -- [-994.978] (-997.031) (-991.333) (-1006.080) * (-1003.207) (-995.808) (-1005.313) [-993.958] -- 0:03:44
      18000 -- [-994.645] (-992.930) (-993.000) (-999.032) * [-994.288] (-990.155) (-999.108) (-999.841) -- 0:03:38
      18500 -- (-993.604) [-994.278] (-992.922) (-998.413) * [-992.672] (-1003.344) (-989.352) (-1000.476) -- 0:03:32
      19000 -- (-997.182) (-991.415) [-993.081] (-998.282) * (-991.640) (-993.498) [-992.305] (-996.336) -- 0:03:26
      19500 -- (-998.933) (-993.537) (-996.570) [-992.607] * (-993.866) (-997.999) (-993.499) [-994.116] -- 0:03:21
      20000 -- (-998.168) [-995.058] (-993.383) (-991.261) * [-993.181] (-999.325) (-998.284) (-995.523) -- 0:03:16

      Average standard deviation of split frequencies: 0.022810

      20500 -- (-993.270) (-990.356) (-997.562) [-993.491] * (-991.489) (-993.913) (-1002.323) [-997.538] -- 0:03:11
      21000 -- (-995.350) [-992.460] (-996.958) (-992.781) * (-994.740) [-992.672] (-1000.109) (-999.794) -- 0:03:06
      21500 -- (-996.279) [-992.246] (-998.507) (-995.864) * [-993.850] (-993.152) (-998.571) (-999.995) -- 0:03:02
      22000 -- (-995.707) (-990.153) [-996.450] (-996.630) * (-995.083) [-990.583] (-1003.363) (-989.909) -- 0:03:42
      22500 -- (-1000.704) [-991.361] (-996.360) (-991.797) * (-993.588) [-993.427] (-1000.016) (-989.203) -- 0:03:37
      23000 -- (-995.316) [-992.854] (-994.308) (-997.550) * (-998.011) [-991.149] (-1001.809) (-994.242) -- 0:03:32
      23500 -- (-1000.745) (-992.978) [-991.011] (-992.783) * (-1001.126) [-995.274] (-993.197) (-994.596) -- 0:03:27
      24000 -- (-995.478) [-997.312] (-994.532) (-996.661) * (-997.830) [-994.220] (-993.490) (-997.989) -- 0:03:23
      24500 -- (-996.512) [-996.204] (-992.350) (-994.811) * (-1000.086) [-992.127] (-996.704) (-996.300) -- 0:03:19
      25000 -- (-992.113) [-997.971] (-991.600) (-997.846) * [-991.846] (-993.798) (-991.174) (-998.916) -- 0:03:15

      Average standard deviation of split frequencies: 0.027196

      25500 -- [-989.447] (-999.548) (-995.219) (-995.897) * (-994.975) [-995.366] (-997.609) (-995.299) -- 0:03:11
      26000 -- (-1001.699) (-999.287) (-994.163) [-993.797] * [-997.137] (-998.086) (-990.533) (-994.969) -- 0:03:07
      26500 -- (-994.231) [-993.151] (-994.398) (-993.528) * (-997.235) (-1002.407) (-994.293) [-995.336] -- 0:03:03
      27000 -- (-997.451) (-992.530) [-988.461] (-995.509) * [-991.880] (-998.160) (-1001.208) (-995.709) -- 0:03:00
      27500 -- [-997.758] (-995.151) (-989.857) (-1001.347) * [-997.693] (-1000.361) (-1004.578) (-997.471) -- 0:03:32
      28000 -- (-998.237) (-997.987) [-992.344] (-1000.816) * [-994.239] (-998.206) (-1003.860) (-994.222) -- 0:03:28
      28500 -- (-996.412) (-995.006) [-992.494] (-996.946) * (-989.972) (-1003.648) [-998.896] (-992.809) -- 0:03:24
      29000 -- [-993.455] (-993.510) (-994.438) (-990.676) * (-999.949) (-996.428) [-998.407] (-991.804) -- 0:03:20
      29500 -- (-992.951) (-994.765) (-994.943) [-994.835] * (-995.927) (-1000.868) (-996.161) [-994.727] -- 0:03:17
      30000 -- (-1001.331) (-993.537) [-988.462] (-995.391) * (-997.067) (-995.652) [-995.219] (-993.339) -- 0:03:14

      Average standard deviation of split frequencies: 0.015372

      30500 -- [-999.090] (-1001.507) (-995.680) (-997.657) * (-993.836) (-994.020) [-991.958] (-993.255) -- 0:03:10
      31000 -- (-995.284) [-997.352] (-993.927) (-996.225) * [-996.799] (-993.989) (-993.262) (-995.847) -- 0:03:07
      31500 -- (-995.531) [-993.789] (-996.587) (-999.627) * (-994.384) (-994.153) [-995.667] (-989.972) -- 0:03:04
      32000 -- [-993.797] (-992.325) (-1002.126) (-993.465) * (-995.617) (-1000.644) (-997.818) [-991.042] -- 0:03:01
      32500 -- [-990.569] (-997.374) (-1006.114) (-992.469) * (-995.020) (-994.253) (-997.079) [-994.153] -- 0:02:58
      33000 -- (-991.257) [-996.035] (-1000.838) (-994.758) * (-990.378) (-997.767) (-995.200) [-992.683] -- 0:03:25
      33500 -- (-994.522) (-995.614) (-1000.943) [-992.062] * [-992.892] (-996.454) (-994.613) (-995.660) -- 0:03:21
      34000 -- [-997.006] (-999.323) (-992.440) (-999.603) * (-996.935) (-994.189) [-991.863] (-993.521) -- 0:03:18
      34500 -- (-994.602) (-997.938) (-997.390) [-994.602] * (-999.111) (-993.822) (-994.629) [-995.012] -- 0:03:15
      35000 -- (-991.654) (-995.895) (-996.950) [-996.776] * [-992.218] (-1001.005) (-995.145) (-991.803) -- 0:03:13

      Average standard deviation of split frequencies: 0.019642

      35500 -- (-990.589) (-998.941) (-999.008) [-995.290] * (-997.957) (-996.520) (-995.811) [-989.305] -- 0:03:10
      36000 -- (-992.441) [-998.640] (-998.432) (-993.947) * [-995.817] (-995.852) (-994.108) (-996.781) -- 0:03:07
      36500 -- (-996.891) [-994.989] (-999.135) (-1005.413) * (-996.779) (-997.582) (-992.677) [-996.986] -- 0:03:04
      37000 -- (-993.445) (-997.687) [-997.739] (-1002.620) * (-993.061) (-997.424) [-992.670] (-996.129) -- 0:03:02
      37500 -- (-995.537) (-998.508) [-999.011] (-1003.712) * (-997.177) (-1000.048) [-994.242] (-992.447) -- 0:02:59
      38000 -- [-993.014] (-997.814) (-1003.927) (-1002.185) * [-993.798] (-996.662) (-996.591) (-992.633) -- 0:03:22
      38500 -- (-995.564) (-1002.744) (-999.200) [-994.542] * [-996.920] (-1001.118) (-997.933) (-994.751) -- 0:03:19
      39000 -- (-991.181) (-1001.376) (-1004.416) [-993.637] * [-1000.294] (-996.376) (-997.339) (-999.137) -- 0:03:17
      39500 -- (-996.342) (-997.652) (-996.962) [-994.297] * (-1001.530) (-995.195) [-992.227] (-997.715) -- 0:03:14
      40000 -- (-994.201) (-998.731) [-996.799] (-990.802) * (-998.625) (-998.265) [-989.798] (-996.248) -- 0:03:12

      Average standard deviation of split frequencies: 0.017388

      40500 -- (-995.145) (-996.431) (-995.095) [-997.034] * (-993.514) [-999.495] (-994.324) (-990.039) -- 0:03:09
      41000 -- (-993.377) (-994.244) (-1000.083) [-995.670] * [-998.527] (-998.880) (-998.324) (-994.856) -- 0:03:07
      41500 -- (-992.513) [-995.018] (-999.725) (-995.810) * (-1000.323) (-998.972) [-991.278] (-994.004) -- 0:03:04
      42000 -- (-996.317) (-994.874) [-993.033] (-997.981) * (-999.903) (-995.112) [-992.105] (-994.028) -- 0:03:02
      42500 -- (-990.256) [-993.248] (-997.075) (-997.089) * (-993.740) [-992.333] (-995.199) (-992.918) -- 0:03:00
      43000 -- (-1001.823) [-989.414] (-994.493) (-994.915) * [-994.102] (-994.379) (-992.307) (-997.924) -- 0:02:58
      43500 -- [-992.232] (-997.227) (-1004.209) (-994.669) * (-992.354) (-994.123) [-992.781] (-994.815) -- 0:03:17
      44000 -- (-999.802) [-995.848] (-1000.725) (-994.054) * (-997.872) (-993.443) [-995.448] (-995.315) -- 0:03:15
      44500 -- (-993.076) (-994.167) [-995.980] (-997.889) * (-991.863) (-994.250) [-996.765] (-999.647) -- 0:03:13
      45000 -- [-994.097] (-998.649) (-994.829) (-994.735) * [-991.430] (-994.673) (-1000.545) (-993.029) -- 0:03:11

      Average standard deviation of split frequencies: 0.015372

      45500 -- (-1004.704) (-995.043) [-993.977] (-993.353) * [-990.856] (-992.663) (-996.358) (-994.031) -- 0:03:08
      46000 -- [-988.958] (-993.053) (-995.051) (-990.489) * [-989.796] (-997.710) (-998.563) (-991.580) -- 0:03:06
      46500 -- [-994.903] (-997.315) (-994.671) (-1000.659) * [-998.277] (-993.290) (-993.757) (-991.973) -- 0:03:04
      47000 -- (-996.809) (-993.366) (-993.931) [-992.237] * [-995.267] (-996.653) (-997.288) (-994.349) -- 0:03:02
      47500 -- (-996.746) [-992.843] (-999.158) (-995.616) * [-990.786] (-998.584) (-997.635) (-999.277) -- 0:03:00
      48000 -- [-993.821] (-994.611) (-997.193) (-997.065) * (-995.073) (-1002.266) (-999.066) [-991.724] -- 0:02:58
      48500 -- (-995.353) (-992.525) (-992.844) [-991.273] * [-991.806] (-1001.181) (-996.985) (-988.323) -- 0:03:16
      49000 -- (-1000.328) [-991.129] (-991.846) (-997.372) * (-999.005) (-997.180) (-996.670) [-993.136] -- 0:03:14
      49500 -- (-998.891) (-992.544) (-994.412) [-990.731] * [-993.115] (-995.704) (-994.037) (-997.310) -- 0:03:12
      50000 -- (-996.506) [-993.523] (-993.418) (-995.284) * [-989.908] (-992.808) (-999.674) (-997.809) -- 0:03:10

      Average standard deviation of split frequencies: 0.013956

      50500 -- (-999.054) (-994.434) (-995.428) [-993.441] * (-993.457) [-994.330] (-993.802) (-992.461) -- 0:03:08
      51000 -- (-999.697) (-996.115) (-991.933) [-990.810] * [-990.588] (-990.144) (-997.350) (-996.875) -- 0:03:06
      51500 -- (-997.373) [-992.571] (-994.728) (-996.325) * (-992.606) (-994.479) (-994.846) [-995.195] -- 0:03:04
      52000 -- (-995.947) [-996.277] (-997.810) (-995.235) * (-997.185) [-994.483] (-997.990) (-996.032) -- 0:03:02
      52500 -- (-993.167) [-994.524] (-993.633) (-993.438) * [-993.109] (-993.567) (-993.348) (-1001.335) -- 0:03:00
      53000 -- [-991.450] (-994.281) (-994.796) (-994.454) * (-996.272) [-996.245] (-996.954) (-998.279) -- 0:02:58
      53500 -- (-991.888) (-994.427) [-990.151] (-995.024) * (-994.882) (-998.701) [-994.894] (-995.458) -- 0:03:14
      54000 -- [-993.970] (-994.674) (-992.288) (-991.005) * (-996.502) (-993.580) (-1001.071) [-999.724] -- 0:03:12
      54500 -- [-997.418] (-994.692) (-1002.453) (-994.623) * (-998.888) (-989.926) [-1000.095] (-1001.371) -- 0:03:10
      55000 -- (-995.215) (-995.776) (-994.583) [-994.754] * (-995.770) (-998.586) [-996.056] (-998.248) -- 0:03:09

      Average standard deviation of split frequencies: 0.016836

      55500 -- (-994.974) [-994.354] (-991.520) (-990.624) * [-994.925] (-991.496) (-1004.494) (-996.996) -- 0:03:07
      56000 -- (-996.535) [-995.974] (-1001.229) (-996.452) * (-989.470) [-993.910] (-995.365) (-994.402) -- 0:03:05
      56500 -- (-999.194) [-994.892] (-996.744) (-993.745) * (-991.303) [-993.953] (-999.561) (-996.520) -- 0:03:03
      57000 -- (-995.957) [-994.760] (-997.728) (-993.955) * (-995.510) (-994.731) [-994.415] (-993.597) -- 0:03:01
      57500 -- (-995.699) [-996.787] (-998.425) (-992.887) * (-996.848) [-990.582] (-993.148) (-992.836) -- 0:03:00
      58000 -- (-1002.086) [-992.542] (-995.285) (-993.882) * (-991.611) [-992.816] (-994.722) (-994.453) -- 0:02:58
      58500 -- (-995.430) (-1000.112) (-1004.802) [-995.392] * (-992.977) [-992.046] (-995.232) (-999.975) -- 0:02:57
      59000 -- (-995.232) (-994.281) (-996.142) [-990.793] * [-991.491] (-993.677) (-991.088) (-993.555) -- 0:03:11
      59500 -- (-997.329) (-997.338) (-997.331) [-996.048] * (-996.609) (-995.479) (-997.633) [-992.799] -- 0:03:09
      60000 -- (-996.157) [-994.950] (-993.168) (-998.266) * [-991.310] (-1007.632) (-991.192) (-992.361) -- 0:03:08

      Average standard deviation of split frequencies: 0.011656

      60500 -- (-996.477) (-996.489) (-998.638) [-999.401] * (-996.681) [-992.937] (-996.624) (-999.196) -- 0:03:06
      61000 -- (-992.778) [-995.482] (-1000.477) (-996.599) * (-995.184) (-993.604) [-992.459] (-995.693) -- 0:03:04
      61500 -- (-994.570) (-1002.381) (-1000.204) [-993.329] * (-991.500) [-995.255] (-996.108) (-1006.438) -- 0:03:03
      62000 -- (-993.342) (-999.393) [-992.879] (-995.167) * (-1000.535) (-993.872) [-992.882] (-993.570) -- 0:03:01
      62500 -- (-992.122) (-995.241) [-994.316] (-994.086) * (-995.548) [-989.990] (-997.400) (-996.742) -- 0:03:00
      63000 -- (-997.922) (-993.790) (-995.661) [-993.061] * [-997.474] (-991.778) (-993.326) (-994.562) -- 0:02:58
      63500 -- (-992.573) (-993.772) [-995.002] (-991.649) * (-997.735) (-992.580) (-993.982) [-998.892] -- 0:02:56
      64000 -- (-993.238) [-997.570] (-993.575) (-998.145) * (-997.417) [-990.516] (-997.245) (-998.234) -- 0:02:55
      64500 -- (-996.192) [-1001.553] (-995.851) (-996.008) * (-995.140) (-993.999) [-993.651] (-995.436) -- 0:03:08
      65000 -- (-997.219) (-996.550) [-1001.962] (-994.133) * (-996.493) (-994.085) (-996.359) [-990.294] -- 0:03:07

      Average standard deviation of split frequencies: 0.003571

      65500 -- (-993.891) (-1004.999) (-993.324) [-993.808] * (-998.072) (-991.639) (-1002.821) [-993.904] -- 0:03:05
      66000 -- (-996.087) [-994.755] (-997.833) (-996.646) * [-996.078] (-992.611) (-996.722) (-993.761) -- 0:03:03
      66500 -- [-994.993] (-996.017) (-993.506) (-999.465) * (-993.696) (-995.236) [-997.792] (-999.407) -- 0:03:02
      67000 -- [-996.957] (-997.734) (-995.075) (-995.469) * (-989.253) [-995.027] (-996.198) (-993.145) -- 0:03:01
      67500 -- (-999.384) [-994.680] (-996.078) (-998.204) * (-995.044) (-1004.763) [-991.851] (-1001.228) -- 0:02:59
      68000 -- (-999.082) [-993.716] (-997.593) (-1000.302) * [-994.339] (-1008.463) (-993.664) (-1005.800) -- 0:02:58
      68500 -- (-997.697) (-994.262) [-992.451] (-996.540) * (-990.040) (-997.704) [-994.107] (-1004.504) -- 0:02:56
      69000 -- [-991.080] (-995.837) (-989.037) (-998.798) * [-992.416] (-1001.102) (-990.902) (-994.786) -- 0:02:55
      69500 -- (-992.994) [-992.430] (-992.225) (-997.187) * [-993.117] (-992.310) (-998.197) (-998.002) -- 0:03:07
      70000 -- (-991.444) [-994.571] (-991.111) (-995.819) * [-991.729] (-998.501) (-1000.613) (-1000.288) -- 0:03:06

      Average standard deviation of split frequencies: 0.006671

      70500 -- [-992.852] (-994.596) (-994.198) (-996.910) * [-990.568] (-996.018) (-998.308) (-1001.597) -- 0:03:04
      71000 -- [-998.551] (-995.091) (-996.887) (-992.583) * (-995.845) [-996.495] (-996.990) (-995.566) -- 0:03:03
      71500 -- (-1001.808) [-991.002] (-992.438) (-993.908) * [-995.891] (-991.835) (-1000.644) (-996.875) -- 0:03:01
      72000 -- [-992.383] (-999.577) (-995.990) (-995.236) * (-993.436) [-1000.422] (-997.405) (-999.605) -- 0:03:00
      72500 -- [-996.564] (-998.723) (-995.614) (-994.241) * [-990.239] (-1001.374) (-999.006) (-997.075) -- 0:02:59
      73000 -- (-997.988) (-991.538) [-997.105] (-996.747) * [-995.537] (-1000.104) (-997.276) (-993.291) -- 0:02:57
      73500 -- (-992.225) [-995.922] (-993.156) (-998.022) * [-999.002] (-998.502) (-997.188) (-990.396) -- 0:02:56
      74000 -- (-1002.290) [-992.480] (-991.785) (-993.315) * [-992.572] (-996.748) (-998.865) (-994.136) -- 0:02:55
      74500 -- [-996.526] (-991.822) (-991.204) (-995.563) * [-992.478] (-995.482) (-999.367) (-994.303) -- 0:02:53
      75000 -- (-997.565) [-989.968] (-994.122) (-994.539) * (-993.151) [-998.312] (-994.526) (-992.967) -- 0:03:05

      Average standard deviation of split frequencies: 0.009304

      75500 -- (-996.329) (-992.776) [-994.144] (-1002.608) * (-990.706) [-1000.013] (-994.510) (-996.195) -- 0:03:03
      76000 -- (-997.368) (-996.498) [-990.924] (-994.701) * [-990.891] (-994.682) (-999.210) (-999.903) -- 0:03:02
      76500 -- (-990.442) (-994.222) [-991.685] (-997.761) * [-990.168] (-996.834) (-994.696) (-996.681) -- 0:03:01
      77000 -- (-998.351) (-992.601) [-991.452] (-994.892) * (-992.924) (-992.361) [-999.208] (-991.234) -- 0:02:59
      77500 -- (-994.854) (-994.503) [-994.062] (-994.539) * [-992.642] (-993.410) (-999.191) (-998.044) -- 0:02:58
      78000 -- (-998.800) (-996.888) [-993.645] (-989.068) * [-996.924] (-997.373) (-994.372) (-995.749) -- 0:02:57
      78500 -- (-997.966) (-992.707) (-990.162) [-992.272] * (-992.294) (-1004.043) (-992.170) [-995.891] -- 0:02:56
      79000 -- (-992.594) (-999.177) (-991.594) [-994.760] * [-990.695] (-995.995) (-994.232) (-993.567) -- 0:02:54
      79500 -- (-1000.616) (-998.994) (-993.032) [-992.125] * [-991.653] (-995.433) (-993.749) (-998.196) -- 0:02:53
      80000 -- (-993.378) [-992.416] (-994.122) (-995.659) * (-999.045) (-996.311) [-996.922] (-1004.265) -- 0:02:52

      Average standard deviation of split frequencies: 0.008766

      80500 -- [-996.916] (-1000.220) (-995.508) (-1000.712) * (-994.660) (-998.671) (-994.917) [-994.178] -- 0:03:02
      81000 -- (-997.903) (-995.187) (-989.757) [-995.528] * (-993.283) (-1000.694) (-991.708) [-994.751] -- 0:03:01
      81500 -- (-1001.057) [-993.918] (-997.969) (-990.879) * (-994.961) (-998.027) (-997.284) [-995.305] -- 0:03:00
      82000 -- (-1003.819) (-999.834) (-1004.882) [-993.296] * (-1000.295) (-998.185) (-1002.242) [-994.530] -- 0:02:59
      82500 -- (-1000.810) (-1000.946) (-1000.393) [-992.430] * (-1005.767) (-1000.801) [-994.639] (-997.905) -- 0:02:57
      83000 -- [-996.819] (-998.970) (-997.545) (-994.395) * (-1000.761) (-1001.978) [-996.712] (-1003.250) -- 0:02:56
      83500 -- (-995.229) (-998.604) (-1002.452) [-993.759] * [-996.007] (-1006.124) (-998.996) (-1002.573) -- 0:02:55
      84000 -- (-995.519) (-1002.281) [-994.062] (-1004.070) * (-994.809) (-1002.175) [-999.776] (-1003.005) -- 0:02:54
      84500 -- (-996.633) (-998.676) (-997.818) [-991.576] * [-995.545] (-999.168) (-1000.925) (-995.409) -- 0:02:53
      85000 -- (-997.408) [-995.952] (-993.671) (-994.129) * (-1001.904) (-1000.597) [-1000.346] (-1004.231) -- 0:02:52

      Average standard deviation of split frequencies: 0.010963

      85500 -- (-991.433) (-993.009) (-991.258) [-991.822] * [-996.543] (-998.892) (-999.191) (-998.850) -- 0:03:01
      86000 -- [-1000.880] (-994.574) (-992.543) (-992.060) * (-993.542) (-1001.283) (-996.295) [-997.486] -- 0:03:00
      86500 -- [-993.906] (-991.362) (-994.917) (-1005.177) * (-990.243) [-994.946] (-991.769) (-999.787) -- 0:02:59
      87000 -- (-991.717) [-995.253] (-993.905) (-999.534) * (-993.657) [-995.732] (-989.776) (-998.734) -- 0:02:58
      87500 -- [-991.824] (-994.170) (-993.003) (-994.977) * (-993.101) [-994.968] (-995.822) (-999.153) -- 0:02:57
      88000 -- (-996.065) (-994.201) [-995.584] (-995.893) * (-998.903) (-988.275) (-991.664) [-992.911] -- 0:02:56
      88500 -- (-989.704) [-994.223] (-997.867) (-996.410) * (-993.346) [-995.227] (-994.754) (-995.891) -- 0:02:55
      89000 -- (-989.794) [-994.644] (-996.230) (-993.555) * (-998.120) [-992.233] (-993.876) (-994.912) -- 0:02:54
      89500 -- (-992.755) (-990.065) [-999.924] (-991.538) * [-994.092] (-995.322) (-995.938) (-997.655) -- 0:02:52
      90000 -- (-993.393) (-997.130) [-992.349] (-999.397) * [-990.089] (-1000.432) (-998.492) (-997.144) -- 0:02:51

      Average standard deviation of split frequencies: 0.010399

      90500 -- [-996.314] (-991.585) (-992.859) (-990.818) * [-991.854] (-993.141) (-1003.738) (-997.707) -- 0:02:50
      91000 -- (-1000.205) (-997.502) [-991.839] (-994.912) * (-993.369) (-995.047) (-1000.581) [-993.262] -- 0:02:59
      91500 -- [-997.589] (-994.843) (-995.437) (-996.965) * [-995.638] (-993.443) (-996.794) (-992.166) -- 0:02:58
      92000 -- [-993.633] (-998.015) (-994.259) (-995.295) * (-997.381) (-998.027) (-992.553) [-995.062] -- 0:02:57
      92500 -- (-996.897) (-996.932) (-1002.335) [-998.428] * (-996.066) (-999.701) (-996.167) [-994.438] -- 0:02:56
      93000 -- [-999.242] (-993.065) (-996.731) (-998.300) * (-997.345) (-999.521) (-993.499) [-989.518] -- 0:02:55
      93500 -- (-998.646) (-1000.120) (-1000.081) [-1002.367] * (-999.412) (-996.639) [-994.909] (-993.006) -- 0:02:54
      94000 -- [-1000.164] (-997.472) (-994.507) (-1003.113) * [-992.438] (-998.055) (-992.247) (-1000.181) -- 0:02:53
      94500 -- [-997.161] (-1001.286) (-998.678) (-996.292) * (-1001.157) (-997.439) [-998.134] (-999.066) -- 0:02:52
      95000 -- (-996.960) (-995.682) [-1003.409] (-996.964) * (-995.043) (-993.580) [-999.516] (-993.115) -- 0:02:51

      Average standard deviation of split frequencies: 0.002455

      95500 -- (-996.223) [-995.569] (-995.474) (-996.711) * (-998.365) [-993.483] (-1002.021) (-1000.549) -- 0:02:50
      96000 -- (-996.277) [-991.164] (-1002.828) (-995.009) * [-995.339] (-996.446) (-1002.620) (-997.008) -- 0:02:49
      96500 -- [-991.078] (-996.515) (-997.953) (-991.730) * (-994.208) (-998.083) (-999.833) [-998.716] -- 0:02:57
      97000 -- [-991.674] (-990.630) (-999.775) (-993.735) * [-993.095] (-997.898) (-995.958) (-995.038) -- 0:02:56
      97500 -- (-992.678) (-994.051) (-995.724) [-994.924] * (-992.166) (-991.417) (-997.740) [-992.145] -- 0:02:55
      98000 -- (-993.694) [-996.588] (-993.417) (-995.010) * (-994.617) (-1001.840) (-997.784) [-993.393] -- 0:02:54
      98500 -- (-999.289) [-992.699] (-991.609) (-992.545) * [-992.553] (-995.241) (-1003.036) (-994.489) -- 0:02:53
      99000 -- (-994.089) (-994.893) [-995.430] (-998.822) * (-995.572) (-998.439) (-999.013) [-991.389] -- 0:02:52
      99500 -- (-996.466) (-995.399) (-999.789) [-991.724] * (-995.096) (-999.901) [-996.329] (-988.978) -- 0:02:51
      100000 -- [-996.487] (-992.755) (-991.361) (-992.080) * (-998.479) [-997.422] (-991.818) (-990.497) -- 0:02:51

      Average standard deviation of split frequencies: 0.000000

      100500 -- [-991.272] (-997.219) (-992.248) (-993.583) * (-996.142) (-998.039) (-991.281) [-991.125] -- 0:02:50
      101000 -- (-997.115) [-993.153] (-995.674) (-996.894) * (-995.732) (-997.529) (-1004.745) [-989.468] -- 0:02:49
      101500 -- [-990.517] (-995.452) (-997.133) (-994.508) * (-993.419) (-993.632) [-997.901] (-991.100) -- 0:02:57
      102000 -- (-994.998) (-993.466) [-994.163] (-995.639) * (-998.421) (-996.809) [-996.991] (-994.155) -- 0:02:56
      102500 -- (-992.189) [-996.814] (-991.759) (-992.726) * (-993.322) [-994.101] (-992.264) (-996.639) -- 0:02:55
      103000 -- [-993.760] (-993.239) (-992.073) (-994.256) * (-994.330) (-997.414) [-998.108] (-992.601) -- 0:02:54
      103500 -- [-998.241] (-994.827) (-996.962) (-996.570) * (-998.839) [-1002.236] (-994.968) (-999.991) -- 0:02:53
      104000 -- (-998.231) (-998.472) (-995.216) [-993.202] * (-996.387) (-1001.588) (-1005.235) [-995.699] -- 0:02:52
      104500 -- (-1004.215) [-994.209] (-995.205) (-993.503) * [-992.479] (-1003.758) (-999.704) (-998.110) -- 0:02:51
      105000 -- (-998.442) [-994.366] (-994.032) (-996.577) * (-1000.354) (-1002.975) (-995.404) [-993.888] -- 0:02:50

      Average standard deviation of split frequencies: 0.002224

      105500 -- (-1000.469) (-992.312) (-1000.533) [-991.926] * (-994.142) (-1000.263) [-993.427] (-997.074) -- 0:02:49
      106000 -- [-999.298] (-993.216) (-994.684) (-992.216) * (-993.970) (-999.126) [-994.819] (-990.230) -- 0:02:48
      106500 -- (-1000.954) (-998.023) (-1002.420) [-997.089] * (-997.290) (-994.941) (-992.221) [-991.750] -- 0:02:47
      107000 -- [-993.821] (-1001.182) (-995.616) (-998.694) * (-996.382) (-999.897) [-993.770] (-996.372) -- 0:02:55
      107500 -- [-990.373] (-991.236) (-993.428) (-995.600) * (-995.118) [-993.947] (-993.975) (-995.517) -- 0:02:54
      108000 -- (-997.225) (-989.750) (-1000.597) [-993.320] * (-998.683) (-991.429) (-994.395) [-995.680] -- 0:02:53
      108500 -- [-995.495] (-994.174) (-992.965) (-994.552) * (-1006.708) (-991.982) [-994.176] (-996.937) -- 0:02:52
      109000 -- [-989.093] (-992.638) (-997.092) (-996.642) * (-997.816) (-993.846) (-992.510) [-999.598] -- 0:02:51
      109500 -- [-988.422] (-996.490) (-1001.288) (-997.112) * (-995.231) (-993.807) [-998.564] (-993.328) -- 0:02:50
      110000 -- [-989.130] (-998.879) (-1000.349) (-988.805) * [-992.687] (-993.050) (-995.190) (-993.681) -- 0:02:49

      Average standard deviation of split frequencies: 0.000000

      110500 -- (-996.761) (-995.563) [-995.226] (-995.129) * [-993.635] (-994.463) (-994.385) (-997.182) -- 0:02:49
      111000 -- [-994.710] (-994.583) (-1006.674) (-990.743) * (-991.606) (-992.136) [-997.455] (-999.974) -- 0:02:48
      111500 -- (-992.359) (-995.145) [-996.194] (-993.405) * (-994.421) (-994.085) [-994.802] (-997.972) -- 0:02:47
      112000 -- [-994.525] (-993.406) (-994.231) (-993.954) * (-998.030) (-996.407) (-996.476) [-991.030] -- 0:02:54
      112500 -- (-992.598) [-990.469] (-995.460) (-994.393) * (-996.021) (-994.421) [-996.704] (-999.573) -- 0:02:53
      113000 -- (-996.047) [-994.162] (-990.770) (-1004.152) * (-1004.695) [-995.682] (-994.040) (-999.783) -- 0:02:52
      113500 -- (-991.050) (-994.427) (-993.262) [-999.885] * (-999.305) [-995.199] (-995.097) (-996.337) -- 0:02:51
      114000 -- (-996.012) (-1005.827) [-992.820] (-998.617) * [-996.667] (-992.862) (-992.446) (-995.304) -- 0:02:50
      114500 -- (-994.184) (-992.150) (-992.527) [-991.999] * (-990.990) (-1001.680) [-992.393] (-999.178) -- 0:02:50
      115000 -- (-995.951) [-1000.063] (-991.433) (-992.996) * [-992.461] (-996.955) (-996.348) (-995.827) -- 0:02:49

      Average standard deviation of split frequencies: 0.002032

      115500 -- [-1000.958] (-1003.317) (-995.240) (-993.453) * (-999.377) (-1004.207) (-996.661) [-989.868] -- 0:02:48
      116000 -- (-992.557) (-999.158) [-994.401] (-997.450) * (-998.894) (-993.524) [-997.841] (-996.700) -- 0:02:47
      116500 -- (-993.878) (-999.036) (-994.876) [-994.470] * (-994.178) (-994.130) (-996.012) [-993.768] -- 0:02:46
      117000 -- (-993.691) [-998.347] (-1000.299) (-994.317) * (-994.979) (-997.689) (-1001.548) [-994.981] -- 0:02:46
      117500 -- [-994.319] (-997.728) (-996.911) (-997.363) * [-994.099] (-997.646) (-993.800) (-994.564) -- 0:02:52
      118000 -- (-993.094) (-1001.071) [-994.785] (-1000.680) * [-997.356] (-991.854) (-998.058) (-993.593) -- 0:02:51
      118500 -- [-991.935] (-994.609) (-990.391) (-991.873) * (-995.747) (-997.812) (-1001.038) [-996.217] -- 0:02:51
      119000 -- (-996.293) (-990.175) [-996.735] (-994.879) * (-996.761) (-994.479) (-991.818) [-995.488] -- 0:02:50
      119500 -- (-999.060) (-992.290) [-995.316] (-990.439) * (-1004.732) (-1000.604) [-992.688] (-993.274) -- 0:02:49
      120000 -- (-989.783) (-1000.546) (-994.877) [-1000.054] * [-998.248] (-997.731) (-996.294) (-997.316) -- 0:02:48

      Average standard deviation of split frequencies: 0.003907

      120500 -- (-995.726) [-999.978] (-994.523) (-1006.857) * [-996.699] (-994.339) (-999.479) (-1000.820) -- 0:02:47
      121000 -- [-992.097] (-995.222) (-992.008) (-991.647) * (-1000.259) [-997.144] (-990.935) (-1001.863) -- 0:02:47
      121500 -- (-991.153) (-997.915) [-994.006] (-995.580) * [-995.815] (-996.903) (-993.569) (-997.119) -- 0:02:46
      122000 -- (-993.255) (-997.671) [-993.259] (-997.094) * (-995.570) [-993.311] (-996.745) (-999.875) -- 0:02:45
      122500 -- (-989.425) (-998.047) (-995.937) [-995.487] * (-995.845) [-993.762] (-990.597) (-997.735) -- 0:02:44
      123000 -- (-993.770) (-1002.185) [-990.170] (-997.935) * (-995.049) (-995.035) [-998.705] (-1001.339) -- 0:02:51
      123500 -- [-992.746] (-994.279) (-1002.277) (-994.622) * (-997.640) (-996.229) [-991.895] (-994.602) -- 0:02:50
      124000 -- (-1002.237) [-994.367] (-997.307) (-995.765) * [-998.032] (-989.912) (-990.706) (-999.615) -- 0:02:49
      124500 -- (-992.864) [-994.131] (-998.473) (-999.470) * [-994.203] (-994.704) (-992.675) (-991.320) -- 0:02:48
      125000 -- (-998.443) (-997.005) [-990.564] (-1001.340) * (-999.643) (-999.500) (-994.357) [-1000.109] -- 0:02:48

      Average standard deviation of split frequencies: 0.001871

      125500 -- (-995.595) (-998.995) (-1000.423) [-991.293] * (-994.523) [-994.493] (-995.252) (-1002.270) -- 0:02:47
      126000 -- (-1000.436) [-1003.112] (-993.610) (-999.062) * (-997.072) (-991.415) (-1000.553) [-997.525] -- 0:02:46
      126500 -- (-1010.002) (-999.334) [-997.051] (-993.980) * (-995.159) [-995.189] (-998.877) (-996.643) -- 0:02:45
      127000 -- [-990.451] (-998.243) (-997.810) (-1001.608) * (-997.654) [-993.829] (-996.897) (-996.932) -- 0:02:44
      127500 -- (-994.408) [-991.619] (-1003.437) (-1001.147) * (-1007.234) (-997.226) [-994.481] (-997.951) -- 0:02:44
      128000 -- (-997.725) (-998.528) [-995.674] (-995.306) * (-997.318) (-995.407) [-997.248] (-995.568) -- 0:02:50
      128500 -- (-992.652) (-1001.696) [-1000.523] (-998.465) * (-994.009) (-996.312) [-999.978] (-991.483) -- 0:02:49
      129000 -- [-993.391] (-992.420) (-998.563) (-997.806) * (-991.873) (-995.574) (-997.535) [-996.296] -- 0:02:48
      129500 -- [-993.354] (-991.936) (-998.735) (-997.290) * (-992.964) (-1005.194) [-996.874] (-995.427) -- 0:02:48
      130000 -- [-990.911] (-1000.153) (-1000.353) (-1001.424) * (-990.819) (-996.111) (-994.806) [-994.818] -- 0:02:47

      Average standard deviation of split frequencies: 0.001804

      130500 -- (-997.380) [-995.137] (-1001.355) (-993.500) * (-991.339) [-998.735] (-998.559) (-995.398) -- 0:02:46
      131000 -- (-993.230) [-996.631] (-1005.653) (-994.527) * (-992.018) (-995.530) [-996.435] (-1001.447) -- 0:02:45
      131500 -- (-997.069) (-994.917) (-1002.712) [-993.920] * (-990.899) [-995.980] (-1000.817) (-993.059) -- 0:02:45
      132000 -- (-993.437) (-998.924) (-999.149) [-995.262] * (-992.318) (-993.507) (-1002.245) [-997.347] -- 0:02:44
      132500 -- (-995.377) [-994.834] (-999.798) (-997.966) * (-994.906) [-994.474] (-1004.212) (-993.470) -- 0:02:43
      133000 -- (-995.186) (-996.267) [-1002.938] (-998.344) * (-994.432) [-996.945] (-1000.794) (-994.910) -- 0:02:42
      133500 -- (-991.267) (-993.891) [-996.364] (-999.946) * (-1000.214) (-991.934) [-999.583] (-998.719) -- 0:02:48
      134000 -- (-989.940) (-994.494) [-993.766] (-998.103) * (-998.528) (-992.349) (-998.685) [-991.536] -- 0:02:48
      134500 -- (-990.033) (-989.630) (-998.532) [-994.236] * (-998.359) (-991.296) (-997.472) [-993.410] -- 0:02:47
      135000 -- (-993.183) [-991.813] (-993.772) (-998.992) * (-992.326) (-991.049) (-1001.725) [-992.529] -- 0:02:46

      Average standard deviation of split frequencies: 0.001733

      135500 -- (-999.161) (-993.287) (-997.253) [-1007.221] * [-992.962] (-993.996) (-997.561) (-999.530) -- 0:02:45
      136000 -- [-994.989] (-997.727) (-999.574) (-997.827) * (-997.485) [-994.478] (-1006.727) (-997.295) -- 0:02:45
      136500 -- [-993.948] (-1001.909) (-994.270) (-996.250) * (-991.352) [-994.167] (-996.838) (-998.561) -- 0:02:44
      137000 -- (-1001.787) [-994.741] (-996.470) (-999.469) * (-992.152) (-996.219) (-992.028) [-998.161] -- 0:02:43
      137500 -- [-991.617] (-996.280) (-994.511) (-995.090) * [-991.837] (-996.713) (-994.728) (-997.215) -- 0:02:43
      138000 -- (-1001.137) [-992.042] (-995.382) (-997.383) * (-992.702) (-989.812) (-993.742) [-1002.575] -- 0:02:42
      138500 -- (-991.659) [-992.502] (-991.055) (-995.176) * (-994.954) [-995.476] (-994.402) (-996.244) -- 0:02:41
      139000 -- [-991.986] (-992.932) (-997.135) (-995.977) * (-1002.487) (-992.524) (-1008.386) [-992.602] -- 0:02:47
      139500 -- (-993.044) (-995.511) (-997.935) [-996.126] * [-1000.968] (-993.020) (-997.572) (-992.067) -- 0:02:46
      140000 -- [-993.432] (-993.712) (-993.514) (-993.345) * (-999.759) [-992.371] (-1001.644) (-1002.958) -- 0:02:45

      Average standard deviation of split frequencies: 0.003351

      140500 -- [-995.678] (-995.706) (-992.169) (-997.083) * (-996.109) [-996.247] (-1004.152) (-999.141) -- 0:02:45
      141000 -- (-992.493) (-998.779) [-992.523] (-995.518) * (-996.330) [-998.527] (-994.435) (-1004.823) -- 0:02:44
      141500 -- [-992.654] (-995.921) (-995.351) (-994.928) * (-997.784) (-994.803) [-999.330] (-995.557) -- 0:02:43
      142000 -- (-995.472) (-992.312) [-994.553] (-1000.062) * (-996.239) (-992.647) [-992.488] (-994.640) -- 0:02:43
      142500 -- (-996.689) (-993.018) (-996.545) [-993.402] * [-993.459] (-995.609) (-997.392) (-991.812) -- 0:02:42
      143000 -- (-994.181) (-993.081) [-997.545] (-993.792) * (-988.665) (-993.569) [-993.578] (-1003.053) -- 0:02:41
      143500 -- (-997.985) (-999.304) [-991.751] (-989.689) * [-1000.561] (-1001.814) (-996.542) (-991.901) -- 0:02:41
      144000 -- [-994.152] (-991.598) (-992.797) (-997.256) * (-992.542) (-995.023) [-995.693] (-994.580) -- 0:02:40
      144500 -- [-994.583] (-1002.599) (-996.555) (-994.620) * (-990.067) (-1003.396) (-992.130) [-992.035] -- 0:02:45
      145000 -- (-1001.906) (-999.144) [-994.188] (-993.459) * (-990.620) [-992.547] (-995.419) (-996.970) -- 0:02:45

      Average standard deviation of split frequencies: 0.001614

      145500 -- (-992.986) (-994.103) [-992.460] (-1000.305) * [-993.210] (-999.660) (-992.759) (-990.885) -- 0:02:44
      146000 -- (-993.791) (-994.227) [-988.627] (-998.537) * (-995.194) [-991.061] (-993.107) (-995.673) -- 0:02:43
      146500 -- (-992.393) (-992.157) (-996.566) [-994.882] * [-996.278] (-995.944) (-1001.692) (-990.001) -- 0:02:43
      147000 -- (-990.814) [-991.173] (-995.680) (-994.597) * (-999.300) (-993.750) [-994.974] (-994.982) -- 0:02:42
      147500 -- (-995.594) (-994.210) [-1001.774] (-995.852) * [-997.893] (-996.584) (-995.404) (-991.332) -- 0:02:41
      148000 -- (-994.359) (-1003.559) [-996.180] (-992.090) * (-1009.273) (-996.425) (-998.347) [-997.269] -- 0:02:41
      148500 -- (-999.147) [-991.729] (-995.922) (-990.893) * (-993.541) [-998.858] (-1000.930) (-993.122) -- 0:02:40
      149000 -- (-996.202) (-992.696) (-998.312) [-992.022] * (-996.621) [-996.564] (-1005.518) (-994.557) -- 0:02:39
      149500 -- [-1000.172] (-990.941) (-996.179) (-1001.456) * (-997.418) (-995.310) (-992.104) [-993.209] -- 0:02:44
      150000 -- (-1000.567) [-992.279] (-991.884) (-1001.042) * (-995.424) [-995.014] (-997.964) (-993.125) -- 0:02:44

      Average standard deviation of split frequencies: 0.003129

      150500 -- (-990.894) (-996.271) (-989.998) [-991.080] * (-996.641) (-1001.344) (-995.916) [-992.400] -- 0:02:43
      151000 -- (-990.973) [-995.493] (-991.731) (-993.710) * (-992.930) (-993.979) [-993.541] (-995.384) -- 0:02:43
      151500 -- (-995.069) [-993.972] (-994.743) (-995.105) * (-991.772) (-997.536) (-997.106) [-995.090] -- 0:02:42
      152000 -- (-994.959) (-998.536) [-999.637] (-994.093) * (-993.420) (-993.911) (-992.794) [-998.667] -- 0:02:41
      152500 -- (-1001.240) (-998.533) (-1001.019) [-991.603] * (-989.840) [-996.637] (-1002.081) (-996.196) -- 0:02:41
      153000 -- (-995.959) [-993.172] (-994.219) (-995.371) * (-997.911) [-993.948] (-993.347) (-999.803) -- 0:02:40
      153500 -- (-996.396) (-999.608) (-998.087) [-993.434] * (-992.845) (-995.414) [-998.633] (-997.664) -- 0:02:39
      154000 -- (-998.046) (-993.600) (-999.387) [-998.517] * (-1000.633) (-988.054) (-994.039) [-991.760] -- 0:02:39
      154500 -- (-994.074) (-991.816) (-998.145) [-994.961] * (-1002.252) (-991.392) [-996.007] (-993.341) -- 0:02:38
      155000 -- (-997.675) (-998.675) [-1003.227] (-991.918) * (-996.565) [-996.298] (-993.974) (-1000.733) -- 0:02:43

      Average standard deviation of split frequencies: 0.003022

      155500 -- (-1002.115) [-996.433] (-995.469) (-997.749) * (-997.866) (-994.214) [-992.076] (-999.308) -- 0:02:42
      156000 -- (-998.514) (-993.084) [-992.818] (-998.135) * (-997.578) (-994.526) (-995.392) [-990.728] -- 0:02:42
      156500 -- (-1006.664) [-995.108] (-992.531) (-991.791) * [-992.918] (-1004.570) (-995.824) (-993.632) -- 0:02:41
      157000 -- [-992.567] (-993.210) (-991.079) (-994.282) * [-995.349] (-1008.746) (-999.140) (-995.189) -- 0:02:41
      157500 -- [-991.751] (-996.437) (-995.927) (-999.877) * (-997.652) [-994.022] (-991.913) (-998.501) -- 0:02:40
      158000 -- (-989.185) (-997.502) (-991.454) [-989.789] * (-998.255) (-996.542) [-997.886] (-996.805) -- 0:02:39
      158500 -- [-995.392] (-996.851) (-997.579) (-994.732) * (-995.399) (-1000.148) (-994.684) [-991.014] -- 0:02:39
      159000 -- (-994.995) (-997.502) (-993.734) [-993.007] * (-991.360) (-991.044) [-993.861] (-992.938) -- 0:02:38
      159500 -- (-992.428) (-993.120) (-994.008) [-995.753] * (-992.967) (-998.006) (-1003.647) [-995.311] -- 0:02:38
      160000 -- (-999.525) (-998.082) [-991.501] (-993.820) * (-994.740) (-1000.557) [-997.321] (-993.057) -- 0:02:37

      Average standard deviation of split frequencies: 0.004401

      160500 -- (-996.233) (-997.833) [-991.764] (-995.367) * [-993.766] (-995.486) (-1003.631) (-995.744) -- 0:02:42
      161000 -- [-997.251] (-993.973) (-995.159) (-996.861) * (-997.895) [-995.838] (-1006.201) (-994.403) -- 0:02:41
      161500 -- (-995.314) (-993.850) [-992.120] (-993.776) * [-991.640] (-997.860) (-995.541) (-993.454) -- 0:02:40
      162000 -- (-995.493) [-994.695] (-996.237) (-992.082) * (-997.282) (-1000.697) (-998.182) [-991.713] -- 0:02:40
      162500 -- (-995.096) [-992.488] (-991.119) (-1001.964) * (-995.544) (-997.614) (-997.417) [-994.209] -- 0:02:39
      163000 -- (-995.600) (-991.718) (-994.240) [-1000.979] * (-1001.415) [-1000.028] (-994.233) (-994.489) -- 0:02:39
      163500 -- (-997.743) (-992.552) (-994.815) [-994.492] * [-989.049] (-1000.112) (-996.043) (-997.724) -- 0:02:38
      164000 -- (-995.485) (-996.280) [-996.274] (-992.913) * [-995.399] (-996.394) (-996.718) (-998.097) -- 0:02:38
      164500 -- (-994.929) (-1001.508) (-991.659) [-993.326] * [-991.029] (-995.764) (-1002.281) (-1002.548) -- 0:02:37
      165000 -- (-998.356) (-994.880) [-996.252] (-995.893) * (-998.705) (-992.096) [-996.618] (-1003.411) -- 0:02:36

      Average standard deviation of split frequencies: 0.004260

      165500 -- (-993.082) (-994.708) (-993.801) [-993.871] * [-993.437] (-993.322) (-995.142) (-1003.389) -- 0:02:41
      166000 -- [-990.662] (-1000.536) (-1000.029) (-995.384) * [-993.275] (-998.794) (-993.124) (-1002.800) -- 0:02:40
      166500 -- (-993.774) (-1002.960) [-989.724] (-998.034) * (-996.794) (-994.977) [-990.881] (-995.499) -- 0:02:40
      167000 -- (-992.077) (-994.490) [-991.966] (-1009.942) * (-1001.269) [-990.868] (-997.179) (-995.391) -- 0:02:39
      167500 -- (-993.926) [-994.011] (-993.559) (-993.837) * (-992.923) (-989.974) [-996.281] (-994.775) -- 0:02:39
      168000 -- [-991.127] (-995.312) (-1005.125) (-992.350) * (-991.522) [-993.747] (-993.975) (-997.241) -- 0:02:38
      168500 -- (-992.097) (-1001.681) [-996.639] (-1002.830) * (-999.907) [-996.618] (-993.335) (-998.444) -- 0:02:37
      169000 -- (-994.091) (-996.822) [-997.902] (-999.611) * (-993.538) [-995.210] (-997.330) (-992.035) -- 0:02:37
      169500 -- (-997.647) (-997.175) [-993.474] (-1006.947) * [-991.026] (-999.695) (-993.061) (-991.184) -- 0:02:36
      170000 -- [-994.315] (-996.923) (-990.644) (-995.461) * (-998.884) (-998.287) (-999.117) [-995.424] -- 0:02:36

      Average standard deviation of split frequencies: 0.005524

      170500 -- (-995.425) (-1005.572) [-995.901] (-998.857) * (-990.749) (-994.770) [-999.005] (-993.337) -- 0:02:35
      171000 -- (-994.616) (-998.005) (-994.747) [-999.931] * (-1001.735) (-995.047) [-990.700] (-989.686) -- 0:02:39
      171500 -- [-991.619] (-996.872) (-995.338) (-1000.649) * (-991.990) (-994.237) (-997.959) [-990.774] -- 0:02:39
      172000 -- (-994.709) [-994.980] (-992.739) (-997.778) * (-989.316) (-995.240) (-993.884) [-996.477] -- 0:02:38
      172500 -- [-990.367] (-993.422) (-990.160) (-1003.579) * (-991.681) [-993.623] (-996.658) (-995.956) -- 0:02:38
      173000 -- (-992.812) [-992.209] (-995.765) (-999.089) * (-994.791) (-995.198) [-991.175] (-997.717) -- 0:02:37
      173500 -- (-993.957) (-993.230) [-994.094] (-1012.754) * (-997.072) (-994.315) (-996.443) [-994.697] -- 0:02:37
      174000 -- [-995.025] (-992.273) (-994.330) (-1002.739) * (-999.271) (-994.749) (-997.416) [-991.459] -- 0:02:36
      174500 -- [-990.753] (-996.063) (-996.226) (-999.274) * (-1001.227) (-999.130) (-994.842) [-998.098] -- 0:02:36
      175000 -- (-997.456) [-994.208] (-994.557) (-1003.699) * (-998.526) (-996.310) (-992.983) [-994.595] -- 0:02:35

      Average standard deviation of split frequencies: 0.006696

      175500 -- (-992.571) (-994.764) (-1002.249) [-994.229] * (-1001.228) (-997.319) [-992.871] (-996.897) -- 0:02:35
      176000 -- (-992.134) [-992.999] (-997.061) (-995.821) * (-1001.012) [-991.520] (-999.604) (-992.546) -- 0:02:39
      176500 -- [-993.668] (-994.991) (-996.782) (-997.597) * (-996.915) [-991.792] (-994.598) (-994.892) -- 0:02:38
      177000 -- (-993.721) (-990.734) [-997.016] (-994.065) * [-995.128] (-993.657) (-991.888) (-998.813) -- 0:02:38
      177500 -- (-994.728) [-988.745] (-993.275) (-998.287) * (-997.232) (-995.923) [-996.745] (-997.790) -- 0:02:37
      178000 -- [-990.045] (-997.089) (-995.250) (-997.616) * (-991.129) (-994.972) (-993.371) [-998.302] -- 0:02:37
      178500 -- [-995.241] (-997.320) (-994.644) (-995.125) * (-998.747) (-1000.018) (-993.864) [-996.579] -- 0:02:36
      179000 -- (-993.338) [-990.119] (-993.209) (-993.824) * (-991.673) [-1002.609] (-995.646) (-996.657) -- 0:02:35
      179500 -- (-1000.007) (-996.779) [-992.617] (-994.504) * (-992.970) (-1006.218) [-994.263] (-995.447) -- 0:02:35
      180000 -- (-997.887) (-998.200) (-993.377) [-991.528] * (-993.875) (-995.414) (-991.991) [-998.561] -- 0:02:34

      Average standard deviation of split frequencies: 0.006523

      180500 -- (-1004.434) (-995.819) (-1000.573) [-989.225] * (-996.893) [-996.690] (-996.895) (-995.189) -- 0:02:38
      181000 -- (-1000.106) (-995.234) [-995.336] (-994.366) * (-998.493) (-996.197) [-990.446] (-995.296) -- 0:02:38
      181500 -- (-995.625) (-993.102) [-997.607] (-993.063) * [-995.653] (-997.500) (-993.217) (-995.128) -- 0:02:37
      182000 -- [-995.329] (-991.269) (-991.951) (-996.488) * (-992.979) [-991.949] (-991.863) (-990.062) -- 0:02:37
      182500 -- (-995.785) (-992.930) [-991.146] (-996.688) * (-995.589) (-995.002) (-999.740) [-993.621] -- 0:02:36
      183000 -- (-993.279) [-1000.713] (-993.109) (-996.749) * (-997.463) (-1002.052) (-998.152) [-992.323] -- 0:02:36
      183500 -- (-998.438) (-992.577) [-991.427] (-992.002) * (-993.490) (-994.413) [-1000.252] (-999.949) -- 0:02:35
      184000 -- (-995.796) (-995.048) (-996.844) [-998.790] * (-997.736) [-994.198] (-998.334) (-994.889) -- 0:02:35
      184500 -- (-993.009) (-994.007) [-995.722] (-995.614) * (-997.072) [-992.569] (-996.674) (-997.175) -- 0:02:34
      185000 -- (-995.807) (-996.793) [-993.718] (-998.054) * (-995.994) (-1002.090) (-997.429) [-992.227] -- 0:02:38

      Average standard deviation of split frequencies: 0.007603

      185500 -- (-994.674) (-1001.213) (-995.192) [-997.490] * (-996.214) (-998.635) [-998.037] (-991.756) -- 0:02:38
      186000 -- (-994.127) (-999.890) [-998.532] (-993.675) * [-996.526] (-1004.080) (-996.332) (-997.398) -- 0:02:37
      186500 -- (-990.445) [-995.012] (-996.077) (-994.844) * (-996.168) (-998.204) [-995.746] (-996.493) -- 0:02:37
      187000 -- [-993.879] (-997.419) (-999.597) (-997.634) * (-997.089) [-996.936] (-997.970) (-992.765) -- 0:02:36
      187500 -- (-995.737) [-996.754] (-1001.704) (-996.952) * (-993.844) (-993.677) [-998.819] (-990.390) -- 0:02:36
      188000 -- (-997.574) (-997.903) [-992.101] (-992.186) * (-994.471) [-989.675] (-1003.658) (-993.606) -- 0:02:35
      188500 -- (-993.923) (-1000.443) (-990.597) [-993.467] * [-992.667] (-992.411) (-1001.595) (-991.409) -- 0:02:34
      189000 -- (-994.002) (-995.771) (-997.704) [-989.417] * [-993.258] (-995.777) (-997.972) (-995.330) -- 0:02:34
      189500 -- (-995.587) (-997.156) [-996.195] (-991.852) * [-990.214] (-1000.928) (-995.042) (-995.116) -- 0:02:33
      190000 -- [-1002.862] (-997.894) (-996.363) (-997.385) * (-992.695) (-995.472) (-992.662) [-996.042] -- 0:02:33

      Average standard deviation of split frequencies: 0.008653

      190500 -- (-996.276) [-990.773] (-999.479) (-995.945) * (-995.184) (-993.468) (-1000.978) [-997.453] -- 0:02:37
      191000 -- (-994.021) (-991.059) [-998.910] (-997.068) * (-998.705) [-990.041] (-1006.432) (-998.803) -- 0:02:36
      191500 -- [-997.826] (-992.153) (-996.623) (-999.535) * (-1000.733) [-993.670] (-994.651) (-994.828) -- 0:02:36
      192000 -- (-997.045) (-989.378) [-1000.239] (-997.308) * (-998.430) [-994.043] (-992.623) (-991.568) -- 0:02:35
      192500 -- (-993.858) (-991.831) (-999.685) [-996.467] * (-1002.672) [-993.381] (-995.563) (-994.240) -- 0:02:35
      193000 -- (-1007.451) [-994.407] (-992.544) (-993.179) * (-993.174) [-994.409] (-999.560) (-996.926) -- 0:02:34
      193500 -- [-997.041] (-993.779) (-993.839) (-994.582) * (-993.276) [-997.142] (-1002.807) (-998.396) -- 0:02:34
      194000 -- (-1000.602) (-995.452) [-989.493] (-995.717) * (-995.455) [-991.399] (-998.962) (-994.721) -- 0:02:33
      194500 -- (-997.240) [-991.791] (-998.567) (-996.492) * (-993.636) [-995.349] (-996.548) (-995.490) -- 0:02:33
      195000 -- (-1000.116) (-993.864) [-995.002] (-996.592) * (-994.946) [-994.259] (-998.308) (-993.468) -- 0:02:32

      Average standard deviation of split frequencies: 0.008418

      195500 -- [-995.412] (-992.958) (-998.246) (-993.311) * [-992.120] (-994.717) (-994.214) (-994.816) -- 0:02:36
      196000 -- (-995.934) [-993.646] (-994.863) (-995.667) * (-993.145) (-999.905) [-994.156] (-995.323) -- 0:02:35
      196500 -- [-1000.530] (-991.204) (-996.568) (-999.197) * (-992.977) (-996.773) [-992.843] (-994.707) -- 0:02:35
      197000 -- (-997.264) [-992.625] (-999.468) (-995.040) * [-996.177] (-997.472) (-996.673) (-996.907) -- 0:02:34
      197500 -- (-995.077) [-991.344] (-989.579) (-993.491) * (-996.554) [-999.782] (-994.806) (-997.929) -- 0:02:34
      198000 -- (-1001.837) (-993.420) [-998.987] (-999.094) * (-995.424) (-996.867) [-992.651] (-996.631) -- 0:02:33
      198500 -- [-997.707] (-998.766) (-992.198) (-995.765) * (-1002.465) (-996.798) (-1002.790) [-993.990] -- 0:02:33
      199000 -- (-999.476) (-998.564) (-992.839) [-992.077] * (-998.498) (-996.485) [-994.735] (-1001.389) -- 0:02:32
      199500 -- [-999.152] (-1004.656) (-993.615) (-992.713) * (-1000.019) (-996.215) (-996.147) [-995.705] -- 0:02:32
      200000 -- (-1000.785) (-998.678) (-991.396) [-991.810] * (-995.741) (-994.929) [-998.330] (-994.503) -- 0:02:32

      Average standard deviation of split frequencies: 0.009397

      200500 -- (-991.995) (-996.995) [-992.372] (-992.075) * (-995.938) (-994.218) [-989.893] (-991.036) -- 0:02:31
      201000 -- (-993.294) [-995.378] (-997.030) (-997.230) * [-996.783] (-990.052) (-995.035) (-997.632) -- 0:02:35
      201500 -- [-992.430] (-1001.881) (-999.913) (-999.897) * (-996.532) (-990.699) [-991.194] (-997.017) -- 0:02:34
      202000 -- (-1003.136) (-996.302) (-994.759) [-990.776] * (-993.028) [-991.943] (-991.370) (-995.574) -- 0:02:34
      202500 -- [-991.770] (-999.175) (-999.262) (-994.626) * [-991.307] (-992.130) (-994.626) (-998.078) -- 0:02:33
      203000 -- [-994.015] (-995.542) (-999.464) (-999.235) * [-995.442] (-994.154) (-993.069) (-996.879) -- 0:02:33
      203500 -- (-1000.643) (-993.452) [-994.240] (-991.909) * (-996.404) (-996.080) (-996.260) [-993.979] -- 0:02:32
      204000 -- (-996.496) [-994.855] (-994.873) (-991.883) * (-992.701) (-995.952) (-994.596) [-997.019] -- 0:02:32
      204500 -- (-999.871) [-993.831] (-994.750) (-998.327) * [-999.149] (-997.848) (-992.154) (-999.625) -- 0:02:31
      205000 -- (-999.209) (-993.184) [-993.453] (-997.540) * (-995.040) [-993.208] (-993.385) (-994.322) -- 0:02:31

      Average standard deviation of split frequencies: 0.009153

      205500 -- [-994.803] (-996.677) (-998.293) (-1001.356) * (-997.050) [-991.683] (-997.664) (-1000.567) -- 0:02:30
      206000 -- (-997.192) (-997.670) (-992.169) [-992.550] * (-990.791) [-993.216] (-989.595) (-996.490) -- 0:02:30
      206500 -- (-994.536) (-994.768) (-1000.096) [-995.970] * (-991.987) [-990.397] (-993.520) (-1005.519) -- 0:02:33
      207000 -- (-999.548) (-991.313) (-993.464) [-995.854] * (-994.355) [-995.410] (-993.934) (-1002.541) -- 0:02:33
      207500 -- [-991.652] (-994.602) (-996.144) (-994.308) * [-996.815] (-991.614) (-1004.846) (-993.016) -- 0:02:32
      208000 -- [-991.953] (-998.705) (-996.351) (-992.793) * (-993.085) (-990.840) (-999.643) [-993.569] -- 0:02:32
      208500 -- (-993.586) (-1003.871) [-993.948] (-998.633) * (-996.894) (-992.428) (-995.707) [-993.988] -- 0:02:31
      209000 -- (-992.279) (-997.055) [-998.684] (-994.147) * (-997.015) (-995.330) (-998.022) [-996.643] -- 0:02:31
      209500 -- (-997.316) [-999.031] (-991.017) (-991.850) * [-998.296] (-994.625) (-996.636) (-999.513) -- 0:02:30
      210000 -- (-997.741) [-990.884] (-993.075) (-990.590) * (-991.493) (-992.435) (-994.100) [-994.102] -- 0:02:30

      Average standard deviation of split frequencies: 0.008951

      210500 -- (-993.557) [-990.114] (-994.450) (-990.574) * [-993.106] (-994.819) (-993.738) (-1001.709) -- 0:02:30
      211000 -- (-991.526) (-1000.389) [-993.335] (-991.872) * (-993.558) (-999.704) (-993.247) [-992.572] -- 0:02:29
      211500 -- (-995.775) (-991.300) [-996.588] (-989.230) * (-995.530) [-992.885] (-1002.058) (-992.272) -- 0:02:32
      212000 -- (-996.365) (-995.024) [-994.885] (-994.298) * (-995.954) (-991.376) (-997.492) [-998.391] -- 0:02:32
      212500 -- [-993.700] (-993.375) (-1000.796) (-993.359) * (-996.048) [-991.297] (-996.226) (-1004.573) -- 0:02:31
      213000 -- (-993.837) (-992.232) [-997.936] (-995.583) * (-990.493) (-991.655) [-995.392] (-1002.263) -- 0:02:31
      213500 -- [-990.628] (-994.367) (-1000.789) (-994.694) * (-992.653) (-999.790) [-994.803] (-997.534) -- 0:02:31
      214000 -- (-990.996) [-994.369] (-1004.613) (-997.688) * (-992.008) (-992.465) (-997.702) [-991.693] -- 0:02:30
      214500 -- (-1000.198) (-998.706) (-1005.826) [-997.414] * (-996.947) [-998.096] (-994.330) (-992.941) -- 0:02:30
      215000 -- (-996.056) (-991.204) (-1001.495) [-996.566] * (-998.699) [-990.527] (-991.571) (-993.402) -- 0:02:29

      Average standard deviation of split frequencies: 0.009821

      215500 -- [-995.742] (-992.978) (-993.236) (-997.529) * (-997.474) (-996.997) (-995.218) [-992.098] -- 0:02:29
      216000 -- [-992.556] (-995.611) (-997.169) (-996.466) * (-993.197) (-1000.096) [-995.171] (-997.594) -- 0:02:28
      216500 -- [-996.307] (-997.705) (-998.332) (-995.482) * (-990.756) (-995.582) [-999.860] (-1001.277) -- 0:02:28
      217000 -- (-1000.558) [-996.040] (-995.178) (-995.963) * [-993.529] (-994.808) (-997.942) (-997.488) -- 0:02:31
      217500 -- (-996.836) [-991.948] (-1001.730) (-995.812) * [-991.899] (-999.949) (-1004.038) (-1003.835) -- 0:02:31
      218000 -- (-996.775) (-996.765) (-996.264) [-992.412] * [-992.900] (-999.398) (-995.614) (-992.697) -- 0:02:30
      218500 -- (-994.374) [-996.312] (-994.688) (-990.416) * [-993.483] (-997.108) (-994.342) (-993.946) -- 0:02:30
      219000 -- [-993.534] (-991.556) (-995.807) (-998.858) * (-999.516) (-994.538) [-995.692] (-994.020) -- 0:02:29
      219500 -- (-994.253) (-997.274) (-996.636) [-994.156] * (-997.818) (-1000.826) [-992.779] (-995.180) -- 0:02:29
      220000 -- [-990.937] (-995.588) (-998.550) (-994.977) * (-991.825) (-991.107) (-994.902) [-991.186] -- 0:02:28

      Average standard deviation of split frequencies: 0.010681

      220500 -- (-992.813) [-992.518] (-1001.620) (-1003.157) * (-996.743) (-993.221) (-995.433) [-993.533] -- 0:02:28
      221000 -- [-994.769] (-992.867) (-993.359) (-993.101) * [-1002.610] (-997.297) (-993.394) (-997.846) -- 0:02:28
      221500 -- [-994.064] (-1001.010) (-995.009) (-994.874) * (-993.083) (-994.939) [-989.752] (-992.064) -- 0:02:27
      222000 -- [-993.048] (-1003.830) (-996.666) (-1004.291) * [-993.073] (-997.232) (-993.748) (-996.870) -- 0:02:30
      222500 -- (-998.139) [-999.830] (-1002.080) (-992.089) * (-992.494) (-995.524) (-997.754) [-991.622] -- 0:02:30
      223000 -- (-1000.485) [-999.092] (-994.924) (-989.810) * (-991.584) (-993.740) [-992.276] (-990.740) -- 0:02:29
      223500 -- (-999.647) (-995.772) (-995.768) [-990.232] * (-994.677) (-1005.366) (-993.063) [-993.480] -- 0:02:29
      224000 -- (-997.480) [-992.221] (-996.750) (-996.708) * [-992.565] (-996.320) (-997.565) (-1001.013) -- 0:02:28
      224500 -- (-995.890) (-993.368) (-994.926) [-995.479] * [-991.166] (-993.905) (-993.005) (-1000.359) -- 0:02:28
      225000 -- (-998.742) (-994.751) [-990.438] (-995.028) * (-1000.061) [-990.710] (-996.438) (-998.626) -- 0:02:28

      Average standard deviation of split frequencies: 0.010429

      225500 -- (-999.308) (-1002.624) [-995.056] (-998.169) * (-994.894) (-995.788) [-991.192] (-993.576) -- 0:02:27
      226000 -- (-999.849) (-995.307) (-992.087) [-995.101] * [-994.957] (-998.534) (-991.912) (-995.577) -- 0:02:27
      226500 -- (-998.165) [-991.769] (-990.543) (-1002.445) * (-1000.131) [-995.309] (-995.444) (-991.141) -- 0:02:26
      227000 -- (-996.418) (-998.714) [-999.678] (-1006.364) * (-993.708) (-995.210) [-996.215] (-995.834) -- 0:02:26
      227500 -- (-991.449) (-994.323) [-991.048] (-994.261) * (-1001.823) [-997.279] (-1002.013) (-997.411) -- 0:02:29
      228000 -- (-998.511) (-998.878) (-997.212) [-992.929] * (-999.306) (-999.515) (-993.755) [-994.023] -- 0:02:28
      228500 -- (-991.524) (-992.226) (-995.073) [-991.779] * (-995.999) [-994.224] (-993.504) (-996.068) -- 0:02:28
      229000 -- (-991.850) (-991.505) [-1006.510] (-993.251) * (-996.805) (-996.821) [-991.630] (-994.483) -- 0:02:28
      229500 -- (-997.598) (-997.262) (-992.580) [-992.498] * (-993.727) (-999.821) (-994.502) [-998.251] -- 0:02:27
      230000 -- (-1003.770) (-994.491) (-994.678) [-996.786] * (-992.444) [-999.242] (-995.347) (-998.497) -- 0:02:27

      Average standard deviation of split frequencies: 0.010218

      230500 -- [-990.779] (-995.013) (-996.396) (-996.325) * (-997.138) (-994.532) [-1001.851] (-991.809) -- 0:02:26
      231000 -- (-997.267) (-996.831) [-992.932] (-991.591) * (-993.508) (-998.114) [-991.849] (-992.877) -- 0:02:26
      231500 -- [-992.829] (-999.264) (-990.612) (-996.856) * (-1001.414) (-999.584) [-998.718] (-998.555) -- 0:02:26
      232000 -- (-995.507) (-1003.127) (-1003.110) [-999.201] * (-999.481) [-995.614] (-997.858) (-1003.692) -- 0:02:25
      232500 -- (-999.213) [-996.242] (-994.551) (-1000.170) * (-997.717) [-999.629] (-997.645) (-997.943) -- 0:02:28
      233000 -- (-993.451) (-992.568) (-994.062) [-999.724] * (-997.199) [-994.210] (-996.323) (-998.134) -- 0:02:28
      233500 -- (-995.779) (-1005.213) [-998.133] (-1001.063) * (-998.197) (-993.075) [-995.738] (-1004.612) -- 0:02:27
      234000 -- (-997.880) (-993.238) (-991.692) [-996.609] * (-995.904) (-992.409) [-998.848] (-995.791) -- 0:02:27
      234500 -- (-993.089) [-1000.218] (-1002.649) (-992.459) * (-994.209) (-992.970) [-994.394] (-995.143) -- 0:02:26
      235000 -- [-995.871] (-994.431) (-994.308) (-996.115) * (-1000.757) (-992.728) (-992.607) [-996.422] -- 0:02:26

      Average standard deviation of split frequencies: 0.010986

      235500 -- (-991.591) [-994.849] (-999.945) (-992.457) * (-996.118) [-993.661] (-999.698) (-999.907) -- 0:02:26
      236000 -- [-991.565] (-995.926) (-999.187) (-994.356) * (-998.810) [-992.633] (-999.312) (-1004.477) -- 0:02:25
      236500 -- [-994.238] (-993.379) (-994.481) (-993.087) * (-1001.188) [-994.655] (-993.024) (-999.750) -- 0:02:25
      237000 -- (-995.233) (-1003.809) [-990.415] (-996.714) * (-994.677) (-994.905) (-992.780) [-997.685] -- 0:02:24
      237500 -- (-1000.207) [-993.987] (-997.402) (-993.387) * (-997.459) [-989.948] (-992.858) (-1008.987) -- 0:02:24
      238000 -- (-992.013) (-991.199) (-1001.447) [-991.285] * [-993.506] (-994.230) (-990.651) (-999.584) -- 0:02:27
      238500 -- (-997.947) [-989.981] (-996.784) (-991.355) * (-997.133) [-994.723] (-994.062) (-1001.273) -- 0:02:26
      239000 -- (-993.268) (-993.562) [-991.350] (-994.663) * (-998.636) [-997.388] (-992.336) (-998.315) -- 0:02:26
      239500 -- (-991.198) (-994.103) (-994.805) [-996.803] * [-994.646] (-993.876) (-1002.680) (-998.781) -- 0:02:26
      240000 -- (-993.100) (-991.695) [-990.563] (-993.345) * [-992.294] (-994.244) (-1003.080) (-996.955) -- 0:02:25

      Average standard deviation of split frequencies: 0.008814

      240500 -- (-988.406) [-994.685] (-999.675) (-994.205) * (-996.956) (-1006.853) [-998.141] (-997.007) -- 0:02:25
      241000 -- (-993.337) [-991.380] (-998.197) (-998.863) * [-991.668] (-1002.647) (-1000.261) (-993.456) -- 0:02:24
      241500 -- (-992.295) [-995.309] (-993.234) (-994.032) * (-993.149) (-993.257) (-999.884) [-989.449] -- 0:02:24
      242000 -- (-998.817) [-993.443] (-997.519) (-997.107) * (-995.776) (-996.875) [-994.648] (-996.756) -- 0:02:24
      242500 -- (-992.904) (-994.736) [-990.949] (-996.243) * (-991.115) [-996.046] (-993.433) (-999.923) -- 0:02:23
      243000 -- (-992.864) (-994.815) (-991.417) [-996.484] * (-993.558) (-998.823) [-991.424] (-1010.304) -- 0:02:23
      243500 -- (-1004.570) (-997.744) (-998.327) [-993.846] * (-1000.754) (-1001.026) [-993.454] (-1004.092) -- 0:02:26
      244000 -- (-996.946) [-998.561] (-1001.207) (-993.561) * (-995.713) [-990.748] (-991.574) (-1005.508) -- 0:02:25
      244500 -- (-994.391) [-989.853] (-997.587) (-997.230) * (-999.150) (-995.910) [-994.173] (-993.239) -- 0:02:25
      245000 -- (-996.278) [-991.716] (-996.370) (-996.392) * (-995.472) [-994.091] (-994.762) (-997.710) -- 0:02:24

      Average standard deviation of split frequencies: 0.009581

      245500 -- [-995.654] (-996.853) (-992.923) (-1005.602) * (-995.316) (-995.479) (-997.152) [-997.348] -- 0:02:24
      246000 -- (-993.024) (-996.510) [-992.303] (-1000.625) * [-996.201] (-992.993) (-1000.182) (-996.389) -- 0:02:24
      246500 -- (-1000.478) (-1002.654) (-992.693) [-990.277] * (-992.459) (-996.073) (-996.739) [-992.600] -- 0:02:23
      247000 -- (-994.911) (-995.167) [-991.295] (-996.390) * (-1000.246) [-998.479] (-995.089) (-994.795) -- 0:02:23
      247500 -- (-993.687) [-993.286] (-991.715) (-993.655) * (-999.451) (-994.061) (-997.144) [-1001.744] -- 0:02:22
      248000 -- [-994.171] (-995.392) (-994.958) (-996.388) * (-995.407) [-993.106] (-996.269) (-997.732) -- 0:02:22
      248500 -- (-997.260) (-994.811) (-996.160) [-996.242] * (-993.631) (-997.752) (-997.357) [-999.575] -- 0:02:25
      249000 -- (-991.287) (-993.672) [-995.576] (-994.522) * (-993.388) [-994.214] (-1002.953) (-997.064) -- 0:02:24
      249500 -- (-996.560) (-993.471) [-995.093] (-992.177) * (-992.209) (-996.849) (-999.664) [-997.668] -- 0:02:24
      250000 -- (-1001.826) (-996.501) (-994.905) [-994.324] * (-992.021) (-995.790) [-995.369] (-998.122) -- 0:02:24

      Average standard deviation of split frequencies: 0.008463

      250500 -- (-997.992) (-998.411) [-992.233] (-993.874) * (-995.465) [-999.324] (-995.427) (-996.941) -- 0:02:23
      251000 -- (-999.078) (-997.708) (-994.844) [-990.360] * (-997.657) [-991.914] (-997.697) (-992.492) -- 0:02:23
      251500 -- (-997.850) (-996.851) [-992.308] (-998.225) * (-995.704) [-991.579] (-999.416) (-993.699) -- 0:02:22
      252000 -- (-998.001) (-1001.710) (-996.167) [-993.233] * (-990.869) [-992.533] (-993.967) (-995.007) -- 0:02:22
      252500 -- (-1003.421) (-1001.443) (-992.685) [-993.503] * (-997.220) [-989.707] (-994.279) (-993.713) -- 0:02:22
      253000 -- (-1000.022) [-993.521] (-997.534) (-994.438) * [-994.601] (-998.067) (-990.903) (-991.486) -- 0:02:21
      253500 -- (-994.284) (-997.992) [-991.322] (-990.005) * (-990.502) [-994.531] (-992.158) (-990.934) -- 0:02:21
      254000 -- (-1002.284) (-999.609) [-995.688] (-991.746) * (-1001.806) (-992.603) (-994.236) [-989.802] -- 0:02:23
      254500 -- (-1000.009) [-999.860] (-992.941) (-992.558) * [-997.489] (-993.896) (-1004.101) (-995.967) -- 0:02:23
      255000 -- (-1002.762) (-995.397) (-991.651) [-992.993] * (-996.897) [-992.341] (-997.325) (-998.334) -- 0:02:23

      Average standard deviation of split frequencies: 0.007366

      255500 -- (-993.713) (-1007.880) [-992.825] (-993.031) * (-997.336) [-991.463] (-998.176) (-994.893) -- 0:02:22
      256000 -- (-995.982) (-992.896) [-992.723] (-993.369) * (-992.471) (-993.579) (-993.751) [-996.814] -- 0:02:22
      256500 -- [-995.769] (-993.153) (-1000.143) (-996.361) * [-992.580] (-1001.286) (-1002.374) (-995.079) -- 0:02:22
      257000 -- (-998.776) (-994.716) (-992.670) [-1000.173] * (-994.217) (-1000.208) [-992.229] (-992.070) -- 0:02:21
      257500 -- (-995.602) (-991.177) [-992.808] (-1000.658) * (-995.381) (-1006.371) [-992.757] (-996.844) -- 0:02:21
      258000 -- [-993.977] (-992.724) (-997.286) (-1000.869) * (-997.383) (-998.451) [-997.672] (-995.069) -- 0:02:20
      258500 -- [-1000.653] (-992.767) (-995.032) (-999.893) * (-995.598) (-992.884) [-995.087] (-997.268) -- 0:02:20
      259000 -- (-994.035) [-996.056] (-993.452) (-994.906) * (-1008.782) (-994.216) [-989.782] (-992.365) -- 0:02:23
      259500 -- [-992.880] (-992.321) (-991.961) (-991.460) * (-999.224) (-989.952) [-993.089] (-991.856) -- 0:02:22
      260000 -- (-994.222) (-998.496) [-995.170] (-1001.698) * (-996.460) [-992.066] (-992.656) (-994.634) -- 0:02:22

      Average standard deviation of split frequencies: 0.005425

      260500 -- (-999.735) (-991.874) [-989.936] (-992.765) * [-989.379] (-991.066) (-992.412) (-995.221) -- 0:02:21
      261000 -- [-995.693] (-997.849) (-991.886) (-991.488) * (-998.748) [-992.891] (-993.352) (-994.186) -- 0:02:21
      261500 -- (-996.527) (-996.910) (-992.668) [-998.140] * [-992.066] (-1000.261) (-991.952) (-990.998) -- 0:02:21
      262000 -- (-995.977) (-997.495) [-992.521] (-998.867) * (-996.074) (-995.163) (-990.572) [-992.604] -- 0:02:20
      262500 -- (-997.022) (-1007.406) [-994.909] (-994.659) * (-993.029) (-993.866) (-994.110) [-996.580] -- 0:02:20
      263000 -- (-991.878) (-994.528) (-996.764) [-994.382] * [-999.092] (-999.398) (-994.193) (-992.190) -- 0:02:20
      263500 -- [-996.750] (-993.675) (-998.720) (-996.286) * [-996.740] (-1003.154) (-998.687) (-998.730) -- 0:02:19
      264000 -- (-995.073) (-1002.184) [-994.095] (-992.463) * (-993.648) (-999.803) [-992.081] (-995.379) -- 0:02:19
      264500 -- (-994.984) (-993.055) [-995.967] (-993.665) * (-993.419) (-997.254) [-995.352] (-998.542) -- 0:02:21
      265000 -- (-997.464) (-997.218) (-998.978) [-999.913] * [-993.969] (-999.042) (-995.447) (-992.074) -- 0:02:21

      Average standard deviation of split frequencies: 0.004430

      265500 -- (-995.940) [-998.289] (-992.975) (-995.769) * (-991.801) (-1007.589) [-991.959] (-992.136) -- 0:02:21
      266000 -- (-996.622) [-997.844] (-995.999) (-995.815) * (-994.779) (-1002.709) (-995.122) [-995.661] -- 0:02:20
      266500 -- (-998.343) (-993.562) [-991.501] (-991.322) * [-994.495] (-1001.096) (-999.999) (-1000.547) -- 0:02:20
      267000 -- (-1001.546) [-989.264] (-992.158) (-998.636) * (-1005.043) (-997.528) (-997.226) [-1000.785] -- 0:02:20
      267500 -- (-1005.692) (-1000.091) [-993.921] (-1000.150) * (-992.738) (-999.401) (-995.520) [-995.773] -- 0:02:19
      268000 -- (-994.793) (-999.066) (-996.909) [-993.598] * [-989.942] (-996.292) (-998.421) (-991.376) -- 0:02:19
      268500 -- (-999.083) [-999.382] (-992.053) (-995.667) * (-997.549) (-994.289) (-997.824) [-993.396] -- 0:02:18
      269000 -- [-1000.681] (-998.164) (-1001.558) (-994.718) * [-995.259] (-997.265) (-996.019) (-989.310) -- 0:02:18
      269500 -- (-1000.114) (-999.488) [-995.346] (-1004.744) * (-997.093) [-996.085] (-999.363) (-994.242) -- 0:02:20
      270000 -- (-996.623) [-998.587] (-1002.086) (-993.102) * (-999.421) (-995.873) [-991.911] (-992.306) -- 0:02:20

      Average standard deviation of split frequencies: 0.003483

      270500 -- (-1001.450) (-1003.143) [-1002.396] (-998.016) * (-993.603) [-994.433] (-996.226) (-1002.807) -- 0:02:20
      271000 -- [-1004.466] (-998.480) (-1001.243) (-996.105) * (-998.899) [-990.551] (-999.021) (-990.878) -- 0:02:19
      271500 -- (-1004.919) [-993.872] (-995.372) (-993.034) * (-992.973) [-991.742] (-999.510) (-994.585) -- 0:02:19
      272000 -- (-1000.331) [-991.790] (-999.656) (-991.932) * (-993.420) [-995.778] (-995.251) (-994.034) -- 0:02:19
      272500 -- [-994.953] (-994.454) (-999.159) (-990.603) * (-997.269) (-993.819) [-994.241] (-992.541) -- 0:02:18
      273000 -- (-993.353) (-997.728) (-1005.693) [-997.430] * (-995.350) (-995.137) (-998.489) [-997.719] -- 0:02:18
      273500 -- [-991.079] (-993.545) (-1005.434) (-994.232) * [-997.042] (-993.521) (-992.637) (-997.150) -- 0:02:18
      274000 -- (-993.585) (-995.397) (-999.149) [-994.274] * (-994.127) (-999.737) [-997.263] (-999.585) -- 0:02:17
      274500 -- [-991.852] (-996.258) (-999.788) (-998.926) * (-996.575) (-998.422) (-1003.080) [-998.873] -- 0:02:17
      275000 -- (-991.053) [-999.876] (-1002.631) (-998.857) * [-995.349] (-998.602) (-994.457) (-995.201) -- 0:02:19

      Average standard deviation of split frequencies: 0.004270

      275500 -- (-995.814) (-996.211) (-997.081) [-993.718] * (-997.762) (-999.388) [-995.325] (-994.184) -- 0:02:19
      276000 -- [-997.254] (-998.851) (-994.854) (-995.832) * (-1001.254) [-996.146] (-989.811) (-992.249) -- 0:02:19
      276500 -- (-991.699) (-994.390) (-999.642) [-997.924] * (-1001.115) [-1001.574] (-992.921) (-995.307) -- 0:02:18
      277000 -- (-998.671) (-995.133) [-993.859] (-1003.181) * (-1006.292) (-992.803) (-997.598) [-999.440] -- 0:02:18
      277500 -- [-995.020] (-995.695) (-995.615) (-996.996) * (-998.394) (-1000.122) [-990.353] (-993.272) -- 0:02:17
      278000 -- (-997.546) [-997.166] (-998.185) (-994.985) * (-1000.065) (-993.403) (-989.551) [-993.767] -- 0:02:17
      278500 -- (-997.453) (-1004.979) (-998.830) [-989.049] * (-998.262) [-990.524] (-994.497) (-992.883) -- 0:02:17
      279000 -- (-992.298) (-997.509) (-995.626) [-994.795] * (-992.704) (-1003.417) (-993.976) [-997.186] -- 0:02:16
      279500 -- (-990.488) (-1002.502) [-994.196] (-995.303) * (-994.557) [-994.475] (-998.010) (-1002.571) -- 0:02:16
      280000 -- (-998.069) (-1000.385) (-991.229) [-989.496] * (-992.989) (-996.397) [-998.326] (-995.015) -- 0:02:16

      Average standard deviation of split frequencies: 0.005039

      280500 -- (-994.933) (-1000.000) [-990.341] (-991.862) * (-996.849) (-995.938) (-997.711) [-997.157] -- 0:02:18
      281000 -- (-1000.322) [-995.587] (-992.889) (-994.180) * (-996.724) (-991.482) [-995.058] (-996.690) -- 0:02:18
      281500 -- (-995.041) (-998.522) (-994.935) [-996.921] * (-993.729) (-992.965) [-999.487] (-999.197) -- 0:02:17
      282000 -- [-996.827] (-996.414) (-996.170) (-1001.324) * [-997.247] (-996.228) (-998.055) (-993.790) -- 0:02:17
      282500 -- (-994.687) [-995.700] (-1006.102) (-992.669) * (-1001.520) (-999.047) (-1001.219) [-989.921] -- 0:02:17
      283000 -- (-995.192) [-992.431] (-994.359) (-994.792) * [-999.001] (-992.395) (-997.033) (-996.152) -- 0:02:16
      283500 -- (-1000.636) [-994.631] (-996.500) (-997.415) * (-997.296) (-990.577) [-995.649] (-994.200) -- 0:02:16
      284000 -- [-989.702] (-995.803) (-1007.624) (-989.574) * (-1008.996) [-993.382] (-993.663) (-1003.654) -- 0:02:16
      284500 -- [-994.049] (-995.809) (-1000.975) (-1004.398) * [-991.574] (-992.607) (-996.537) (-993.901) -- 0:02:15
      285000 -- (-1001.362) (-997.160) (-997.661) [-993.310] * (-996.708) [-992.058] (-1015.276) (-994.728) -- 0:02:15

      Average standard deviation of split frequencies: 0.004945

      285500 -- [-995.523] (-993.311) (-993.405) (-995.569) * [-990.440] (-991.074) (-997.341) (-995.383) -- 0:02:17
      286000 -- [-993.300] (-992.155) (-993.788) (-992.290) * (-995.513) (-997.003) (-997.071) [-1000.354] -- 0:02:17
      286500 -- [-995.664] (-998.322) (-998.234) (-995.894) * (-993.897) (-1003.840) [-991.951] (-993.965) -- 0:02:16
      287000 -- [-996.834] (-993.357) (-996.550) (-996.174) * (-994.848) (-1002.252) [-993.156] (-993.989) -- 0:02:16
      287500 -- [-994.855] (-991.253) (-998.743) (-996.913) * (-999.968) [-995.036] (-991.283) (-993.117) -- 0:02:16
      288000 -- [-1004.212] (-994.889) (-990.992) (-998.459) * [-992.230] (-996.607) (-1001.095) (-993.214) -- 0:02:15
      288500 -- (-995.899) [-990.648] (-996.493) (-994.112) * (-991.065) [-997.934] (-998.824) (-992.630) -- 0:02:15
      289000 -- [-993.537] (-993.572) (-997.467) (-993.819) * (-993.786) (-992.585) (-995.418) [-991.588] -- 0:02:15
      289500 -- (-1001.898) [-992.155] (-993.522) (-991.383) * (-995.267) (-994.793) [-991.708] (-994.136) -- 0:02:14
      290000 -- (-994.645) (-996.800) (-996.452) [-1002.664] * [-994.851] (-995.470) (-995.632) (-996.654) -- 0:02:14

      Average standard deviation of split frequencies: 0.005676

      290500 -- [-992.584] (-996.164) (-996.756) (-991.799) * [-995.798] (-996.973) (-993.850) (-996.761) -- 0:02:14
      291000 -- [-999.643] (-994.114) (-993.599) (-993.302) * [-990.401] (-996.538) (-993.479) (-1000.715) -- 0:02:16
      291500 -- (-995.684) (-998.965) (-995.992) [-991.453] * [-996.349] (-997.794) (-993.257) (-996.219) -- 0:02:16
      292000 -- (-993.415) (-995.988) [-997.554] (-996.819) * (-994.707) (-994.297) [-996.541] (-994.228) -- 0:02:15
      292500 -- (-993.621) (-996.031) [-993.033] (-995.269) * (-997.654) (-999.811) (-1003.533) [-991.673] -- 0:02:15
      293000 -- (-996.457) [-991.570] (-996.798) (-995.878) * (-991.290) (-995.338) (-1005.271) [-992.471] -- 0:02:15
      293500 -- (-993.969) (-995.854) (-993.356) [-998.633] * (-991.481) (-995.723) [-1006.988] (-1000.292) -- 0:02:14
      294000 -- (-994.394) (-999.374) (-991.189) [-991.448] * [-991.657] (-1004.569) (-1002.352) (-996.629) -- 0:02:14
      294500 -- (-993.696) (-1003.506) [-989.509] (-994.337) * (-991.530) (-1003.897) (-1000.484) [-996.993] -- 0:02:14
      295000 -- [-993.568] (-993.693) (-994.982) (-999.631) * (-993.051) (-1002.890) (-997.589) [-997.036] -- 0:02:13

      Average standard deviation of split frequencies: 0.003981

      295500 -- (-991.998) [-993.070] (-995.042) (-997.132) * (-998.110) (-990.010) (-1001.520) [-994.157] -- 0:02:13
      296000 -- (-998.650) (-996.275) [-992.627] (-990.127) * (-996.898) (-994.604) (-999.804) [-992.911] -- 0:02:15
      296500 -- (-1006.737) [-1000.759] (-992.210) (-992.091) * (-995.010) [-998.480] (-999.647) (-991.310) -- 0:02:15
      297000 -- (-993.898) (-996.720) (-996.087) [-990.615] * (-991.813) [-1000.514] (-995.830) (-994.039) -- 0:02:14
      297500 -- (-1002.369) (-997.339) [-990.618] (-991.757) * [-993.657] (-994.269) (-993.508) (-992.812) -- 0:02:14
      298000 -- [-998.225] (-1005.193) (-994.781) (-992.082) * [-995.585] (-997.647) (-991.329) (-994.838) -- 0:02:14
      298500 -- [-993.218] (-994.968) (-995.451) (-992.123) * (-993.285) [-996.344] (-1002.995) (-1006.545) -- 0:02:13
      299000 -- (-1000.082) [-1001.332] (-987.991) (-996.864) * [-993.855] (-997.402) (-999.400) (-997.074) -- 0:02:13
      299500 -- (-998.339) [-996.276] (-997.140) (-998.073) * (-997.238) (-995.849) [-991.503] (-992.697) -- 0:02:13
      300000 -- (-996.577) [-996.903] (-998.082) (-997.032) * (-993.619) (-996.035) [-994.655] (-996.621) -- 0:02:13

      Average standard deviation of split frequencies: 0.004704

      300500 -- [-993.372] (-995.873) (-994.456) (-994.990) * [-988.218] (-996.036) (-997.481) (-993.466) -- 0:02:12
      301000 -- (-994.605) [-995.747] (-993.605) (-999.881) * (-993.211) [-1004.182] (-992.630) (-991.262) -- 0:02:12
      301500 -- (-993.991) (-991.929) [-996.339] (-999.503) * (-989.305) (-999.708) [-997.865] (-993.166) -- 0:02:14
      302000 -- (-994.663) (-991.842) [-995.919] (-997.908) * [-997.890] (-1000.089) (-1003.630) (-994.830) -- 0:02:14
      302500 -- (-1000.335) (-997.053) [-994.756] (-996.826) * (-1000.422) (-1002.757) (-993.909) [-993.144] -- 0:02:13
      303000 -- (-995.916) [-998.000] (-993.798) (-1001.439) * (-998.642) (-996.783) [-996.301] (-990.167) -- 0:02:13
      303500 -- (-996.776) (-998.726) [-991.344] (-998.020) * [-992.427] (-994.908) (-1002.050) (-988.961) -- 0:02:13
      304000 -- [-990.891] (-1000.886) (-994.347) (-997.054) * (-995.441) (-996.693) (-995.952) [-991.864] -- 0:02:12
      304500 -- [-994.231] (-998.051) (-1005.509) (-995.582) * (-995.880) [-997.652] (-997.930) (-994.354) -- 0:02:12
      305000 -- [-995.953] (-998.537) (-1001.137) (-995.858) * [-998.000] (-992.395) (-995.345) (-995.718) -- 0:02:12

      Average standard deviation of split frequencies: 0.003081

      305500 -- (-995.425) (-997.072) [-995.082] (-992.437) * (-994.472) (-993.966) [-998.129] (-997.771) -- 0:02:11
      306000 -- (-997.031) (-995.430) (-996.942) [-993.922] * [-992.842] (-992.700) (-997.911) (-992.702) -- 0:02:11
      306500 -- (-996.836) [-996.182] (-994.436) (-995.545) * (-990.646) (-1000.260) [-994.638] (-996.808) -- 0:02:11
      307000 -- (-998.859) (-991.817) [-998.381] (-993.899) * (-996.732) (-998.466) [-993.722] (-993.966) -- 0:02:13
      307500 -- (-998.176) [-993.694] (-991.994) (-996.350) * (-998.053) (-998.777) (-997.184) [-994.323] -- 0:02:12
      308000 -- (-1000.819) (-996.438) [-993.665] (-997.780) * [-1000.631] (-997.018) (-992.127) (-994.400) -- 0:02:12
      308500 -- (-994.157) (-992.657) (-992.557) [-997.208] * (-995.828) (-1000.262) [-995.977] (-996.663) -- 0:02:12
      309000 -- (-996.323) [-993.359] (-1003.555) (-996.926) * (-994.816) (-995.596) [-995.842] (-997.364) -- 0:02:11
      309500 -- (-996.852) (-993.854) [-991.486] (-999.501) * (-995.422) [-992.215] (-995.713) (-997.377) -- 0:02:11
      310000 -- [-995.879] (-990.923) (-1003.700) (-993.021) * (-991.885) [-994.313] (-997.182) (-995.597) -- 0:02:11

      Average standard deviation of split frequencies: 0.003035

      310500 -- (-993.871) (-993.793) [-999.250] (-995.014) * (-998.680) (-998.346) (-995.433) [-993.783] -- 0:02:11
      311000 -- (-1000.840) (-997.457) (-1003.216) [-991.565] * [-995.153] (-996.549) (-994.397) (-993.542) -- 0:02:10
      311500 -- (-1002.073) (-996.373) (-998.384) [-991.808] * (-994.700) [-995.167] (-993.529) (-991.832) -- 0:02:10
      312000 -- [-993.646] (-998.942) (-997.923) (-993.866) * [-997.652] (-991.014) (-993.665) (-991.804) -- 0:02:12
      312500 -- (-995.159) (-997.138) (-994.366) [-991.378] * (-998.168) [-996.559] (-993.177) (-990.193) -- 0:02:12
      313000 -- (-994.501) (-993.969) [-995.687] (-996.421) * (-996.772) [-994.772] (-995.916) (-993.526) -- 0:02:11
      313500 -- (-990.642) [-992.618] (-998.353) (-992.846) * (-993.254) [-995.033] (-997.289) (-1001.207) -- 0:02:11
      314000 -- [-992.957] (-990.998) (-996.267) (-992.847) * [-991.804] (-996.390) (-992.094) (-998.523) -- 0:02:11
      314500 -- (-997.132) [-992.698] (-990.631) (-990.662) * (-998.439) (-992.990) [-996.941] (-991.570) -- 0:02:10
      315000 -- [-995.859] (-996.001) (-998.723) (-991.159) * (-1005.272) [-992.542] (-994.378) (-994.792) -- 0:02:10

      Average standard deviation of split frequencies: 0.002238

      315500 -- (-991.490) [-993.970] (-997.947) (-994.502) * (-1002.554) (-996.181) (-993.385) [-995.378] -- 0:02:10
      316000 -- [-996.652] (-999.416) (-1009.509) (-996.152) * (-996.344) (-998.930) (-999.662) [-992.614] -- 0:02:09
      316500 -- (-993.294) [-998.083] (-1002.184) (-1003.320) * (-995.115) (-995.533) (-995.433) [-993.657] -- 0:02:09
      317000 -- (-996.394) (-989.795) [-999.865] (-999.746) * (-991.690) [-994.908] (-997.486) (-994.886) -- 0:02:09
      317500 -- (-995.324) [-995.545] (-998.323) (-992.426) * (-994.594) (-999.295) (-996.286) [-998.453] -- 0:02:11
      318000 -- (-1000.443) (-998.502) (-993.076) [-993.434] * [-992.765] (-1002.549) (-995.772) (-996.951) -- 0:02:10
      318500 -- (-995.002) (-996.674) (-996.264) [-998.456] * (-992.341) (-994.033) (-999.065) [-994.310] -- 0:02:10
      319000 -- (-1005.365) [-989.841] (-993.745) (-997.178) * (-996.400) (-998.038) [-991.231] (-997.502) -- 0:02:10
      319500 -- (-998.145) (-998.240) [-996.196] (-996.940) * (-993.529) [-998.979] (-997.862) (-997.888) -- 0:02:09
      320000 -- (-996.088) (-990.052) [-997.122] (-994.016) * (-996.052) [-994.559] (-993.261) (-992.675) -- 0:02:09

      Average standard deviation of split frequencies: 0.002940

      320500 -- (-997.201) [-992.508] (-1003.817) (-993.987) * (-994.584) [-994.717] (-996.964) (-996.026) -- 0:02:09
      321000 -- [-989.936] (-990.677) (-997.005) (-997.035) * (-993.992) (-993.401) [-997.649] (-995.063) -- 0:02:09
      321500 -- [-990.199] (-998.403) (-994.370) (-998.093) * (-994.116) (-995.052) (-993.838) [-998.280] -- 0:02:08
      322000 -- [-993.096] (-992.594) (-993.147) (-1006.309) * (-992.487) (-993.147) (-993.162) [-999.996] -- 0:02:08
      322500 -- (-991.374) [-989.787] (-996.253) (-995.323) * (-1002.993) [-994.695] (-996.993) (-999.633) -- 0:02:10
      323000 -- (-999.814) (-994.025) (-995.191) [-994.511] * (-993.037) [-993.785] (-996.452) (-994.973) -- 0:02:09
      323500 -- (-992.608) (-994.393) (-999.019) [-993.807] * (-993.634) (-999.685) (-996.878) [-991.042] -- 0:02:09
      324000 -- (-994.255) (-995.871) (-998.955) [-992.721] * (-994.392) [-993.095] (-993.850) (-991.842) -- 0:02:09
      324500 -- (-997.077) (-993.528) (-996.529) [-993.256] * [-992.266] (-1000.767) (-993.553) (-992.333) -- 0:02:09
      325000 -- [-993.572] (-992.137) (-1000.206) (-993.850) * (-1006.276) (-993.745) [-993.000] (-998.364) -- 0:02:08

      Average standard deviation of split frequencies: 0.002892

      325500 -- [-992.220] (-993.811) (-999.373) (-998.517) * (-994.688) (-991.174) [-998.458] (-994.394) -- 0:02:08
      326000 -- (-992.472) (-995.321) [-999.759] (-996.295) * (-994.607) (-997.433) (-998.938) [-992.205] -- 0:02:08
      326500 -- (-996.944) (-995.740) (-996.454) [-992.473] * (-994.941) [-991.487] (-1003.006) (-994.884) -- 0:02:07
      327000 -- (-994.440) (-996.132) [-992.071] (-997.483) * (-995.105) (-992.509) (-999.099) [-993.015] -- 0:02:07
      327500 -- (-992.210) (-998.764) (-992.930) [-993.418] * (-991.295) [-995.574] (-1000.980) (-999.828) -- 0:02:07
      328000 -- (-998.626) (-995.539) [-994.199] (-992.495) * (-1003.941) (-994.989) (-1001.306) [-1000.619] -- 0:02:09
      328500 -- (-992.130) (-996.901) [-998.160] (-993.942) * (-996.601) (-996.757) [-992.848] (-995.521) -- 0:02:08
      329000 -- [-992.085] (-994.183) (-989.951) (-993.914) * [-996.344] (-1000.864) (-1003.300) (-992.298) -- 0:02:08
      329500 -- [-993.248] (-996.629) (-1000.942) (-994.442) * [-997.420] (-998.042) (-1004.072) (-993.410) -- 0:02:08
      330000 -- [-995.025] (-993.628) (-997.617) (-992.090) * (-994.646) [-997.289] (-995.541) (-993.760) -- 0:02:07

      Average standard deviation of split frequencies: 0.002851

      330500 -- (-995.253) [-994.785] (-1004.194) (-993.861) * (-991.702) (-995.986) [-999.335] (-994.160) -- 0:02:07
      331000 -- (-993.108) (-1001.831) [-995.647] (-996.626) * (-994.570) [-993.680] (-998.886) (-992.735) -- 0:02:07
      331500 -- [-994.846] (-994.230) (-988.004) (-999.431) * [-996.675] (-995.641) (-995.859) (-992.808) -- 0:02:07
      332000 -- (-995.456) (-995.839) [-991.542] (-994.801) * (-990.034) (-993.251) [-993.843] (-993.648) -- 0:02:06
      332500 -- (-997.821) (-1009.201) (-992.676) [-993.583] * [-994.771] (-996.671) (-993.887) (-994.168) -- 0:02:06
      333000 -- [-992.841] (-1003.961) (-990.991) (-992.680) * (-1001.142) (-999.752) (-998.978) [-994.604] -- 0:02:08
      333500 -- (-996.799) (-1000.816) [-995.172] (-993.278) * [-998.164] (-997.632) (-1001.070) (-992.667) -- 0:02:07
      334000 -- (-1000.803) (-1002.261) [-997.270] (-996.367) * (-997.770) [-995.582] (-997.066) (-994.924) -- 0:02:07
      334500 -- (-1007.371) (-1003.396) [-993.100] (-995.750) * (-994.184) [-990.158] (-997.342) (-997.062) -- 0:02:07
      335000 -- (-999.043) [-994.359] (-996.575) (-996.145) * (-994.354) [-993.955] (-994.751) (-996.884) -- 0:02:07

      Average standard deviation of split frequencies: 0.003507

      335500 -- (-1006.621) [-992.286] (-1002.999) (-996.147) * (-999.591) [-992.541] (-992.352) (-995.927) -- 0:02:06
      336000 -- [-1002.023] (-1002.075) (-1002.458) (-992.748) * (-994.819) (-994.989) (-993.638) [-992.584] -- 0:02:06
      336500 -- (-1001.617) (-998.470) (-1016.385) [-995.185] * (-1001.623) (-994.558) (-996.208) [-994.832] -- 0:02:06
      337000 -- [-997.227] (-1015.769) (-1005.554) (-997.874) * (-1000.095) (-994.943) [-998.655] (-1002.476) -- 0:02:05
      337500 -- (-999.758) (-993.112) (-998.468) [-992.695] * [-992.144] (-998.192) (-996.211) (-992.952) -- 0:02:05
      338000 -- (-1004.562) [-994.241] (-993.428) (-1000.955) * (-995.956) [-990.124] (-1005.302) (-996.454) -- 0:02:05
      338500 -- (-1000.837) (-998.461) [-992.638] (-994.780) * (-996.045) (-996.898) [-997.855] (-997.770) -- 0:02:07
      339000 -- (-1001.037) (-1003.147) [-992.007] (-993.217) * (-995.224) [-994.828] (-997.977) (-995.085) -- 0:02:06
      339500 -- (-995.861) (-999.110) (-995.066) [-995.732] * (-996.464) (-993.537) [-998.869] (-994.553) -- 0:02:06
      340000 -- (-1002.794) (-1001.688) [-993.584] (-999.358) * (-997.421) (-996.501) (-998.554) [-998.322] -- 0:02:06

      Average standard deviation of split frequencies: 0.002768

      340500 -- (-993.620) (-998.578) [-992.696] (-997.521) * (-997.033) [-993.838] (-990.189) (-1001.449) -- 0:02:05
      341000 -- (-989.048) [-999.126] (-1000.732) (-998.796) * (-996.917) (-996.443) (-996.600) [-997.116] -- 0:02:05
      341500 -- (-1001.343) (-1006.027) (-996.454) [-995.158] * [-1000.972] (-993.939) (-994.600) (-1003.832) -- 0:02:05
      342000 -- [-993.969] (-999.696) (-997.383) (-992.673) * (-995.470) [-992.170] (-998.042) (-1005.755) -- 0:02:05
      342500 -- (-994.554) (-998.184) (-994.838) [-991.632] * (-997.986) (-992.612) (-999.537) [-996.291] -- 0:02:04
      343000 -- (-996.048) (-1000.055) (-998.958) [-993.636] * (-1004.089) [-996.343] (-999.677) (-996.059) -- 0:02:04
      343500 -- (-993.381) (-1002.984) [-994.387] (-993.773) * (-998.580) (-993.444) [-1000.729] (-999.581) -- 0:02:04
      344000 -- (-995.059) (-995.852) [-992.847] (-994.013) * (-1004.394) (-995.347) (-1006.240) [-1001.193] -- 0:02:05
      344500 -- (-1000.482) (-992.256) (-999.700) [-997.875] * (-996.935) [-992.820] (-1001.925) (-995.362) -- 0:02:05
      345000 -- (-998.957) (-995.972) (-997.514) [-994.646] * (-999.862) (-994.272) (-996.577) [-998.324] -- 0:02:05

      Average standard deviation of split frequencies: 0.002725

      345500 -- (-995.387) (-993.926) (-1001.014) [-992.192] * (-999.181) [-991.310] (-994.147) (-995.177) -- 0:02:05
      346000 -- (-999.304) (-996.074) (-995.801) [-994.542] * (-999.917) (-999.653) (-996.493) [-997.348] -- 0:02:04
      346500 -- (-1002.005) (-991.986) (-996.943) [-999.118] * (-1004.562) [-990.415] (-997.434) (-999.425) -- 0:02:04
      347000 -- [-993.745] (-995.686) (-1008.028) (-1003.945) * (-1004.142) (-994.379) (-997.911) [-1001.809] -- 0:02:04
      347500 -- (-998.268) (-994.914) (-996.778) [-995.728] * [-996.618] (-990.872) (-998.248) (-998.914) -- 0:02:03
      348000 -- (-997.804) (-991.613) [-995.786] (-994.658) * (-994.329) (-991.229) (-1004.180) [-997.582] -- 0:02:05
      348500 -- (-996.960) (-993.341) [-1003.444] (-996.618) * (-992.292) [-994.599] (-991.321) (-998.998) -- 0:02:05
      349000 -- (-997.863) [-993.097] (-995.903) (-1002.313) * [-990.124] (-998.715) (-997.450) (-996.473) -- 0:02:04
      349500 -- [-995.129] (-988.841) (-991.953) (-1006.277) * [-990.581] (-993.149) (-994.734) (-992.715) -- 0:02:04
      350000 -- (-1003.614) [-995.640] (-994.406) (-999.353) * (-996.471) (-997.288) [-995.805] (-993.214) -- 0:02:04

      Average standard deviation of split frequencies: 0.002016

      350500 -- (-991.145) (-992.206) (-990.853) [-998.538] * (-990.936) (-998.994) [-996.421] (-989.967) -- 0:02:04
      351000 -- [-991.252] (-991.609) (-998.659) (-998.896) * (-991.242) [-999.528] (-990.748) (-997.453) -- 0:02:03
      351500 -- [-991.150] (-992.471) (-992.274) (-995.084) * (-994.433) [-994.971] (-993.890) (-993.497) -- 0:02:03
      352000 -- (-993.798) [-999.524] (-993.728) (-994.776) * (-993.116) (-996.708) (-998.588) [-990.278] -- 0:02:03
      352500 -- (-993.801) (-994.745) (-992.321) [-996.444] * (-993.330) (-995.610) (-996.807) [-998.950] -- 0:02:03
      353000 -- [-991.798] (-999.374) (-993.436) (-996.196) * [-996.010] (-991.521) (-996.655) (-998.338) -- 0:02:04
      353500 -- (-993.953) [-994.834] (-997.808) (-995.964) * [-999.369] (-993.846) (-995.099) (-998.995) -- 0:02:04
      354000 -- (-995.074) (-993.556) [-994.901] (-992.440) * (-1002.678) [-994.558] (-992.177) (-994.375) -- 0:02:04
      354500 -- (-1000.267) (-996.678) (-994.227) [-993.297] * (-994.446) (-995.161) (-1002.472) [-990.423] -- 0:02:03
      355000 -- [-994.669] (-997.833) (-995.566) (-992.494) * (-992.175) (-999.144) [-990.152] (-994.611) -- 0:02:03

      Average standard deviation of split frequencies: 0.003310

      355500 -- [-993.375] (-993.383) (-993.859) (-987.810) * (-993.167) (-995.687) (-993.706) [-991.399] -- 0:02:03
      356000 -- (-996.214) (-1000.570) [-990.727] (-992.283) * (-998.525) (-997.823) [-995.093] (-993.830) -- 0:02:03
      356500 -- (-994.738) (-1000.489) [-991.189] (-995.823) * (-995.815) [-992.454] (-992.281) (-999.234) -- 0:02:02
      357000 -- (-989.791) (-1008.438) [-992.003] (-995.284) * (-995.126) (-996.446) (-996.112) [-992.438] -- 0:02:02
      357500 -- (-996.944) (-998.673) [-989.493] (-995.691) * [-992.849] (-995.003) (-1000.688) (-999.536) -- 0:02:02
      358000 -- (-998.736) (-1002.444) (-989.668) [-992.023] * (-999.701) [-999.380] (-994.158) (-995.719) -- 0:02:03
      358500 -- [-991.939] (-996.979) (-997.262) (-991.302) * (-993.468) (-992.457) (-1003.160) [-992.044] -- 0:02:03
      359000 -- (-989.955) (-991.463) [-994.031] (-992.028) * [-994.291] (-991.622) (-994.887) (-996.018) -- 0:02:03
      359500 -- [-994.502] (-992.943) (-997.123) (-993.117) * [-1002.014] (-994.192) (-1006.300) (-993.214) -- 0:02:02
      360000 -- (-993.098) (-993.348) [-993.458] (-995.038) * [-995.008] (-993.730) (-1000.129) (-994.497) -- 0:02:02

      Average standard deviation of split frequencies: 0.003268

      360500 -- (-992.170) [-995.368] (-991.842) (-1002.241) * (-997.422) (-994.657) (-996.801) [-998.476] -- 0:02:02
      361000 -- (-994.427) [-996.437] (-992.946) (-997.736) * (-998.613) (-993.893) [-992.086] (-997.512) -- 0:02:02
      361500 -- (-994.837) [-999.352] (-996.081) (-999.276) * [-999.564] (-992.468) (-993.628) (-1000.186) -- 0:02:01
      362000 -- (-995.280) [-994.975] (-1002.667) (-1000.002) * (-1000.100) (-997.704) (-994.826) [-997.195] -- 0:02:03
      362500 -- (-992.427) [-992.482] (-1000.282) (-990.519) * (-992.897) (-996.706) (-993.861) [-993.374] -- 0:02:03
      363000 -- (-989.785) (-992.571) (-1005.314) [-994.988] * [-992.767] (-992.977) (-994.798) (-993.023) -- 0:02:02
      363500 -- (-995.823) (-988.224) (-999.635) [-988.355] * (-999.277) (-994.763) [-993.888] (-998.395) -- 0:02:02
      364000 -- [-994.659] (-991.856) (-996.896) (-991.254) * (-991.785) [-989.853] (-996.118) (-990.894) -- 0:02:02
      364500 -- (-995.720) [-992.406] (-994.343) (-992.810) * (-991.474) [-992.159] (-993.622) (-996.589) -- 0:02:02
      365000 -- (-995.217) [-991.704] (-1000.298) (-993.990) * (-993.807) (-995.339) [-991.617] (-993.067) -- 0:02:01

      Average standard deviation of split frequencies: 0.003864

      365500 -- (-992.104) (-995.245) (-1002.970) [-992.536] * (-998.877) [-995.831] (-994.224) (-1000.692) -- 0:02:01
      366000 -- (-1001.523) (-997.518) (-1000.914) [-993.339] * (-996.095) [-995.988] (-997.615) (-1005.557) -- 0:02:01
      366500 -- (-1001.059) [-992.952] (-995.358) (-990.451) * [-993.912] (-996.362) (-992.940) (-998.884) -- 0:02:00
      367000 -- (-997.328) (-998.279) (-1005.864) [-996.457] * (-995.866) (-1002.773) (-994.608) [-997.870] -- 0:02:02
      367500 -- (-997.818) (-993.257) [-994.851] (-993.272) * (-997.126) [-991.239] (-994.228) (-995.652) -- 0:02:02
      368000 -- (-996.084) (-992.666) [-990.241] (-992.511) * (-995.194) (-996.978) (-994.099) [-992.987] -- 0:02:01
      368500 -- (-1000.924) [-994.898] (-993.589) (-990.640) * (-992.009) (-1000.811) [-992.512] (-997.343) -- 0:02:01
      369000 -- (-995.427) (-993.917) (-997.299) [-991.135] * (-992.587) [-995.253] (-993.530) (-995.073) -- 0:02:01
      369500 -- [-996.340] (-992.566) (-991.407) (-992.205) * (-992.626) (-992.112) [-994.978] (-994.942) -- 0:02:01
      370000 -- [-992.006] (-992.563) (-996.684) (-995.512) * (-998.674) (-1000.308) (-992.389) [-990.599] -- 0:02:00

      Average standard deviation of split frequencies: 0.003179

      370500 -- [-996.003] (-995.786) (-994.644) (-997.578) * (-995.724) (-993.110) (-1008.960) [-992.466] -- 0:02:00
      371000 -- [-994.274] (-999.682) (-994.587) (-997.932) * (-996.349) [-995.220] (-1001.189) (-994.359) -- 0:02:00
      371500 -- (-992.650) (-992.335) [-997.924] (-999.811) * (-990.607) [-993.528] (-996.895) (-996.806) -- 0:02:00
      372000 -- (-991.520) (-990.242) [-995.387] (-999.996) * (-991.009) [-995.245] (-991.738) (-1001.559) -- 0:01:59
      372500 -- (-990.025) [-990.907] (-994.571) (-997.438) * (-992.884) (-993.966) [-992.469] (-998.729) -- 0:02:01
      373000 -- (-993.103) (-992.107) (-996.115) [-996.004] * (-996.211) (-995.796) (-993.659) [-991.165] -- 0:02:01
      373500 -- [-990.323] (-989.572) (-995.509) (-997.513) * (-995.812) [-994.954] (-997.167) (-997.179) -- 0:02:00
      374000 -- [-991.876] (-995.380) (-997.468) (-998.258) * (-995.043) [-997.421] (-994.658) (-999.217) -- 0:02:00
      374500 -- (-993.087) [-991.713] (-997.911) (-994.741) * [-991.986] (-997.052) (-999.618) (-997.297) -- 0:02:00
      375000 -- (-1001.790) [-994.202] (-993.170) (-997.166) * (-995.567) (-991.964) (-992.398) [-995.776] -- 0:02:00

      Average standard deviation of split frequencies: 0.001881

      375500 -- (-991.816) (-988.912) [-993.848] (-994.322) * [-996.815] (-996.658) (-997.892) (-996.558) -- 0:01:59
      376000 -- [-997.899] (-991.139) (-999.145) (-996.574) * [-998.475] (-995.461) (-991.561) (-996.731) -- 0:01:59
      376500 -- (-998.823) [-992.615] (-990.015) (-993.903) * (-993.173) [-994.874] (-992.094) (-995.838) -- 0:01:59
      377000 -- [-1002.500] (-993.348) (-997.366) (-1003.144) * [-992.023] (-993.868) (-994.024) (-1006.124) -- 0:01:58
      377500 -- (-1001.172) (-994.843) [-991.517] (-995.351) * [-993.711] (-995.774) (-993.862) (-1004.910) -- 0:02:00
      378000 -- [-998.897] (-992.931) (-996.950) (-998.385) * [-1001.586] (-995.917) (-999.406) (-993.020) -- 0:02:00
      378500 -- (-992.988) (-996.368) [-991.318] (-992.631) * (-990.487) (-999.123) (-998.315) [-992.639] -- 0:01:59
      379000 -- (-991.431) [-995.164] (-991.446) (-996.382) * [-991.984] (-992.318) (-997.857) (-998.982) -- 0:01:59
      379500 -- (-998.464) [-997.197] (-997.146) (-998.761) * (-994.352) (-997.363) (-994.437) [-993.561] -- 0:01:59
      380000 -- [-990.480] (-1001.993) (-996.564) (-994.057) * (-997.469) (-996.486) (-996.386) [-994.569] -- 0:01:59

      Average standard deviation of split frequencies: 0.002477

      380500 -- (-991.107) (-997.843) (-996.776) [-991.901] * [-990.139] (-998.947) (-999.487) (-1000.940) -- 0:01:58
      381000 -- (-996.448) (-999.994) (-1001.148) [-992.843] * [-996.303] (-995.584) (-993.612) (-995.176) -- 0:01:58
      381500 -- (-994.015) (-1008.251) (-993.336) [-994.840] * (-999.509) (-998.974) (-995.073) [-993.064] -- 0:01:58
      382000 -- (-996.015) [-996.052] (-1000.686) (-995.602) * (-997.481) (-991.480) [-989.410] (-992.836) -- 0:01:58
      382500 -- (-996.944) [-992.881] (-995.056) (-993.286) * (-993.922) (-995.368) (-996.073) [-991.461] -- 0:01:57
      383000 -- (-1001.593) (-992.309) [-991.207] (-992.964) * (-1004.299) (-997.320) [-993.584] (-999.992) -- 0:01:59
      383500 -- (-1003.892) (-993.920) (-997.079) [-992.247] * (-1000.125) (-996.412) [-992.546] (-993.157) -- 0:01:58
      384000 -- (-999.954) (-998.280) [-995.128] (-995.846) * [-999.918] (-990.846) (-994.127) (-994.596) -- 0:01:58
      384500 -- [-990.675] (-1000.303) (-989.789) (-996.360) * (-999.440) [-992.708] (-994.391) (-998.341) -- 0:01:58
      385000 -- (-992.354) (-992.100) (-994.588) [-994.941] * [-995.465] (-995.588) (-995.811) (-994.777) -- 0:01:58

      Average standard deviation of split frequencies: 0.001832

      385500 -- (-997.440) (-991.130) (-997.030) [-1000.605] * (-991.466) [-993.983] (-997.622) (-994.188) -- 0:01:57
      386000 -- (-994.996) (-990.533) [-991.817] (-998.352) * (-993.689) (-994.971) [-996.856] (-993.929) -- 0:01:57
      386500 -- (-993.044) (-1006.141) [-994.925] (-994.411) * (-993.174) (-1004.524) (-992.889) [-991.550] -- 0:01:57
      387000 -- [-991.776] (-996.931) (-996.115) (-992.001) * (-999.812) (-996.457) (-994.757) [-995.507] -- 0:01:58
      387500 -- (-994.513) (-994.898) (-993.299) [-996.774] * (-997.121) (-997.658) [-996.196] (-993.662) -- 0:01:58
      388000 -- (-992.228) (-999.365) [-995.617] (-992.741) * (-996.909) (-995.658) (-988.649) [-994.164] -- 0:01:58
      388500 -- (-995.888) [-991.220] (-996.494) (-991.900) * (-992.380) (-996.422) [-991.777] (-998.375) -- 0:01:58
      389000 -- (-997.631) (-991.049) (-997.725) [-1000.107] * (-1000.513) (-995.965) (-990.644) [-995.160] -- 0:01:57
      389500 -- (-991.745) [-991.148] (-993.541) (-993.642) * (-1001.336) [-994.963] (-993.217) (-996.846) -- 0:01:57
      390000 -- (-998.187) (-992.382) [-992.844] (-1001.045) * (-999.066) (-996.860) [-992.085] (-992.599) -- 0:01:57

      Average standard deviation of split frequencies: 0.001810

      390500 -- [-1002.238] (-990.509) (-992.687) (-994.803) * (-999.065) (-997.532) (-996.499) [-994.558] -- 0:01:57
      391000 -- (-997.412) [-993.699] (-993.155) (-991.831) * (-995.002) (-994.623) [-997.080] (-996.716) -- 0:01:56
      391500 -- (-993.907) [-996.798] (-996.541) (-991.426) * (-1000.621) (-993.534) [-994.297] (-1002.940) -- 0:01:58
      392000 -- [-994.305] (-997.136) (-994.555) (-1002.636) * [-993.142] (-996.728) (-992.920) (-1000.266) -- 0:01:57
      392500 -- (-996.103) [-990.087] (-998.137) (-994.622) * (-1000.800) (-994.910) [-996.326] (-992.982) -- 0:01:57
      393000 -- (-996.317) (-997.201) (-1001.994) [-995.041] * (-995.870) [-995.085] (-1002.448) (-991.159) -- 0:01:57
      393500 -- (-999.284) (-990.672) (-1003.194) [-993.295] * (-995.943) (-995.220) (-996.521) [-992.446] -- 0:01:57
      394000 -- (-999.285) (-998.065) (-996.420) [-990.256] * [-996.203] (-995.277) (-992.397) (-996.090) -- 0:01:56
      394500 -- (-995.961) (-996.353) (-1001.061) [-993.617] * (-992.547) (-1005.369) [-993.569] (-1000.486) -- 0:01:56
      395000 -- (-995.446) [-994.359] (-998.254) (-993.687) * (-995.248) (-997.987) [-997.974] (-994.080) -- 0:01:56

      Average standard deviation of split frequencies: 0.001786

      395500 -- (-999.072) (-996.667) [-993.928] (-993.048) * [-996.125] (-995.528) (-994.150) (-995.134) -- 0:01:56
      396000 -- (-992.327) (-998.088) [-996.286] (-989.965) * (-994.879) (-992.940) (-998.560) [-1000.393] -- 0:01:55
      396500 -- (-998.526) (-990.209) [-993.064] (-1000.239) * (-998.250) [-994.206] (-999.619) (-996.313) -- 0:01:55
      397000 -- (-991.642) [-994.771] (-994.774) (-996.646) * (-1000.257) [-996.286] (-996.928) (-994.035) -- 0:01:56
      397500 -- (-996.964) (-1000.985) (-996.370) [-996.510] * (-996.568) [-993.672] (-994.477) (-994.252) -- 0:01:56
      398000 -- [-998.061] (-997.632) (-1006.572) (-991.302) * (-996.589) (-999.318) (-999.452) [-991.031] -- 0:01:56
      398500 -- [-998.238] (-993.765) (-1003.151) (-992.686) * [-996.223] (-997.778) (-1002.570) (-1000.548) -- 0:01:56
      399000 -- (-995.897) (-994.148) [-991.083] (-995.034) * [-1000.992] (-994.377) (-994.930) (-996.368) -- 0:01:55
      399500 -- (-994.877) [-996.328] (-995.406) (-990.860) * (-996.317) (-994.129) [-995.345] (-1004.138) -- 0:01:55
      400000 -- [-996.592] (-1001.722) (-995.118) (-1000.122) * (-992.406) [-995.085] (-999.051) (-1001.144) -- 0:01:55

      Average standard deviation of split frequencies: 0.001765

      400500 -- [-992.080] (-995.183) (-994.439) (-1000.714) * [-995.319] (-996.568) (-993.287) (-998.539) -- 0:01:55
      401000 -- (-990.974) (-995.415) (-992.780) [-993.873] * (-994.691) [-998.139] (-995.420) (-1000.247) -- 0:01:55
      401500 -- (-993.312) (-996.481) (-1001.223) [-990.956] * [-992.996] (-995.260) (-993.526) (-1001.022) -- 0:01:54
      402000 -- (-992.645) (-1001.799) (-999.436) [-993.972] * [-995.175] (-991.472) (-992.327) (-995.984) -- 0:01:54
      402500 -- [-998.059] (-993.317) (-993.776) (-996.825) * (-992.636) (-1001.194) (-991.404) [-991.719] -- 0:01:55
      403000 -- (-990.899) [-988.610] (-991.182) (-995.293) * (-994.142) (-993.874) [-991.185] (-995.209) -- 0:01:55
      403500 -- [-989.799] (-994.549) (-993.509) (-996.067) * [-992.279] (-994.161) (-990.655) (-992.648) -- 0:01:55
      404000 -- (-1000.166) [-994.322] (-990.617) (-994.625) * (-994.566) (-990.325) [-995.570] (-995.534) -- 0:01:55
      404500 -- (-998.741) [-993.708] (-994.273) (-995.898) * (-991.542) (-991.805) (-997.151) [-993.366] -- 0:01:54
      405000 -- (-991.638) [-992.230] (-990.971) (-994.756) * [-993.652] (-992.381) (-992.370) (-994.616) -- 0:01:54

      Average standard deviation of split frequencies: 0.001742

      405500 -- (-998.836) (-995.807) [-990.135] (-993.180) * (-996.272) [-993.359] (-992.912) (-1001.079) -- 0:01:54
      406000 -- [-994.276] (-999.304) (-995.832) (-1004.997) * [-992.901] (-998.368) (-997.092) (-1003.481) -- 0:01:54
      406500 -- (-992.198) (-990.110) [-1000.921] (-998.297) * (-993.856) [-990.404] (-995.104) (-998.510) -- 0:01:53
      407000 -- [-992.100] (-996.033) (-995.672) (-994.597) * (-997.811) [-996.991] (-998.403) (-994.109) -- 0:01:53
      407500 -- (-997.487) [-992.799] (-995.103) (-998.483) * (-993.298) (-999.734) (-998.235) [-993.485] -- 0:01:54
      408000 -- (-997.274) (-992.475) [-993.992] (-995.213) * (-999.042) [-994.318] (-998.095) (-994.264) -- 0:01:54
      408500 -- (-997.880) (-1000.566) (-994.329) [-1003.525] * (-997.466) (-995.362) [-992.701] (-991.939) -- 0:01:54
      409000 -- (-994.004) (-993.254) [-991.844] (-998.727) * [-996.996] (-997.774) (-990.737) (-990.801) -- 0:01:54
      409500 -- (-999.884) (-996.021) [-989.507] (-993.810) * (-996.160) [-995.175] (-993.149) (-997.009) -- 0:01:53
      410000 -- (-1000.206) (-989.990) (-992.414) [-997.435] * [-994.712] (-997.492) (-1000.983) (-993.623) -- 0:01:53

      Average standard deviation of split frequencies: 0.002870

      410500 -- (-998.022) (-997.858) (-991.820) [-1000.121] * [-997.794] (-1000.625) (-994.581) (-996.384) -- 0:01:53
      411000 -- (-996.120) [-992.980] (-991.408) (-993.932) * (-995.938) (-1004.643) (-998.494) [-990.145] -- 0:01:53
      411500 -- (-994.419) [-994.925] (-994.372) (-998.001) * (-996.397) [-996.223] (-993.849) (-1001.831) -- 0:01:52
      412000 -- (-996.891) (-990.091) [-993.318] (-997.700) * [-994.249] (-1002.447) (-994.860) (-998.701) -- 0:01:52
      412500 -- (-1004.464) (-996.882) (-995.150) [-993.570] * (-998.381) (-992.988) [-992.252] (-1001.417) -- 0:01:52
      413000 -- (-995.133) [-991.839] (-995.628) (-994.434) * [-996.277] (-997.567) (-995.325) (-999.047) -- 0:01:53
      413500 -- (-994.171) (-997.297) (-992.408) [-992.994] * (-1001.950) [-992.101] (-995.205) (-1000.445) -- 0:01:53
      414000 -- (-995.372) (-1004.508) (-991.460) [-991.888] * (-998.797) [-993.152] (-996.319) (-994.417) -- 0:01:53
      414500 -- (-990.048) (-1000.197) [-1001.620] (-996.730) * (-1008.752) (-998.481) (-994.775) [-997.846] -- 0:01:53
      415000 -- (-999.166) [-996.576] (-993.070) (-994.059) * (-999.818) [-991.821] (-996.496) (-1003.406) -- 0:01:52

      Average standard deviation of split frequencies: 0.002833

      415500 -- (-989.784) [-999.349] (-996.181) (-994.559) * (-993.918) [-994.893] (-997.531) (-1000.179) -- 0:01:52
      416000 -- (-998.770) (-997.961) (-992.777) [-999.190] * (-995.557) [-996.041] (-997.065) (-997.508) -- 0:01:52
      416500 -- (-995.404) [-1001.501] (-998.193) (-994.687) * (-1001.384) (-996.518) [-994.425] (-996.883) -- 0:01:52
      417000 -- (-1003.078) (-1004.106) [-997.743] (-998.937) * (-1003.674) (-994.100) [-993.872] (-1001.897) -- 0:01:51
      417500 -- (-1001.148) (-1002.337) [-992.806] (-1000.111) * (-998.514) [-995.718] (-998.528) (-998.097) -- 0:01:51
      418000 -- (-994.157) (-1000.436) (-1000.097) [-995.923] * (-1000.644) [-990.144] (-994.174) (-996.208) -- 0:01:52
      418500 -- (-992.349) [-1004.008] (-994.340) (-994.346) * (-999.818) [-994.619] (-995.172) (-997.967) -- 0:01:52
      419000 -- (-998.283) [-1001.852] (-996.729) (-994.075) * (-998.444) [-998.390] (-993.449) (-995.269) -- 0:01:52
      419500 -- [-994.864] (-996.870) (-994.001) (-999.335) * [-998.934] (-1000.237) (-996.208) (-997.137) -- 0:01:52
      420000 -- (-991.706) [-990.913] (-990.510) (-1001.342) * (-995.057) [-993.395] (-1002.934) (-997.231) -- 0:01:51

      Average standard deviation of split frequencies: 0.003362

      420500 -- (-995.038) (-993.389) (-995.407) [-995.067] * (-993.822) [-990.563] (-991.948) (-997.102) -- 0:01:51
      421000 -- (-994.496) (-992.969) [-996.185] (-996.795) * (-989.367) [-998.228] (-994.601) (-996.220) -- 0:01:51
      421500 -- (-998.764) (-995.349) (-992.326) [-994.925] * (-990.491) (-992.062) [-992.257] (-1000.057) -- 0:01:51
      422000 -- (-996.722) (-991.919) [-998.238] (-1001.471) * (-993.711) [-989.543] (-996.592) (-997.721) -- 0:01:50
      422500 -- [-991.891] (-994.751) (-993.312) (-1003.449) * [-996.580] (-996.277) (-999.167) (-995.266) -- 0:01:50
      423000 -- [-993.790] (-1001.131) (-993.357) (-999.956) * (-993.807) (-1000.038) [-997.507] (-997.199) -- 0:01:50
      423500 -- (-995.156) (-997.713) [-997.433] (-1005.152) * [-991.768] (-994.842) (-1001.577) (-996.413) -- 0:01:51
      424000 -- [-992.799] (-995.179) (-991.196) (-1003.258) * (-993.298) [-995.934] (-998.317) (-993.762) -- 0:01:51
      424500 -- (-996.882) [-993.656] (-995.853) (-1001.017) * [-995.639] (-991.827) (-997.782) (-993.061) -- 0:01:51
      425000 -- (-990.866) (-993.191) [-996.359] (-998.674) * (-996.038) [-994.764] (-992.265) (-993.168) -- 0:01:50

      Average standard deviation of split frequencies: 0.004426

      425500 -- (-993.364) (-994.849) (-992.345) [-999.405] * (-995.880) [-995.153] (-991.055) (-994.180) -- 0:01:50
      426000 -- (-996.144) (-992.395) (-991.297) [-998.144] * (-1001.999) (-991.279) [-991.524] (-995.391) -- 0:01:50
      426500 -- (-996.734) (-997.401) [-993.976] (-999.348) * (-998.543) (-994.339) [-993.496] (-999.625) -- 0:01:50
      427000 -- (-997.576) (-996.444) (-995.427) [-996.238] * (-1007.864) [-989.005] (-998.414) (-996.781) -- 0:01:50
      427500 -- [-990.795] (-998.551) (-994.209) (-998.339) * (-999.130) (-994.898) (-998.011) [-993.444] -- 0:01:49
      428000 -- (-990.871) (-996.212) (-995.662) [-992.743] * [-993.210] (-1000.169) (-1001.804) (-993.224) -- 0:01:49
      428500 -- (-992.926) (-998.134) [-993.309] (-996.217) * (-1000.568) [-996.265] (-998.468) (-991.282) -- 0:01:49
      429000 -- [-990.019] (-996.561) (-992.163) (-992.418) * [-992.432] (-1002.323) (-994.355) (-992.057) -- 0:01:50
      429500 -- [-992.944] (-997.419) (-996.644) (-997.782) * (-992.322) [-997.484] (-993.777) (-990.148) -- 0:01:50
      430000 -- [-999.679] (-994.370) (-994.065) (-997.689) * (-995.142) (-1001.381) (-999.435) [-994.565] -- 0:01:50

      Average standard deviation of split frequencies: 0.003831

      430500 -- [-996.957] (-1002.368) (-996.528) (-995.567) * (-995.757) (-1004.618) [-993.036] (-994.312) -- 0:01:49
      431000 -- (-996.187) [-996.762] (-992.409) (-991.575) * (-996.772) (-997.513) (-995.148) [-998.778] -- 0:01:49
      431500 -- [-995.796] (-992.305) (-991.980) (-999.919) * [-993.487] (-1002.830) (-994.974) (-996.225) -- 0:01:49
      432000 -- [-998.016] (-1000.428) (-993.733) (-997.429) * (-995.594) (-995.238) [-994.014] (-991.569) -- 0:01:49
      432500 -- (-997.886) [-991.403] (-993.896) (-997.125) * (-993.444) (-992.386) [-993.041] (-993.044) -- 0:01:48
      433000 -- (-992.316) (-990.937) [-992.206] (-993.589) * (-993.568) (-994.669) [-997.579] (-1000.605) -- 0:01:48
      433500 -- (-1004.273) (-993.534) [-1000.729] (-1000.946) * (-999.479) [-996.685] (-994.302) (-996.751) -- 0:01:48
      434000 -- (-995.360) (-993.419) (-993.151) [-994.348] * (-999.726) [-999.092] (-1000.526) (-999.931) -- 0:01:49
      434500 -- [-998.550] (-997.618) (-990.957) (-994.463) * (-1004.290) (-997.375) (-997.013) [-991.502] -- 0:01:49
      435000 -- (-991.571) [-995.405] (-995.750) (-992.592) * (-1001.939) [-992.048] (-999.119) (-993.610) -- 0:01:49

      Average standard deviation of split frequencies: 0.003784

      435500 -- (-999.496) (-999.090) (-995.657) [-995.397] * (-998.092) (-996.360) (-1000.413) [-997.798] -- 0:01:48
      436000 -- (-992.974) (-998.920) (-999.667) [-992.815] * (-997.552) (-993.886) [-998.465] (-996.721) -- 0:01:48
      436500 -- (-991.715) (-999.242) [-996.808] (-992.245) * (-995.412) (-999.051) [-1002.923] (-999.053) -- 0:01:48
      437000 -- (-992.763) [-998.304] (-999.432) (-992.527) * (-995.081) [-1000.982] (-1000.652) (-996.716) -- 0:01:48
      437500 -- (-997.109) [-993.567] (-998.830) (-998.726) * (-994.858) (-996.239) (-997.746) [-994.242] -- 0:01:48
      438000 -- [-993.526] (-1001.130) (-1003.934) (-997.829) * (-992.617) (-996.293) (-999.190) [-994.219] -- 0:01:47
      438500 -- (-994.369) (-992.281) (-994.841) [-995.993] * (-996.569) (-995.844) (-994.108) [-992.893] -- 0:01:47
      439000 -- (-1004.489) (-996.658) (-998.745) [-994.190] * (-995.421) [-999.197] (-1000.075) (-994.335) -- 0:01:47
      439500 -- (-1000.276) (-996.236) [-998.803] (-998.609) * (-997.989) [-998.212] (-994.175) (-994.760) -- 0:01:48
      440000 -- [-993.220] (-992.224) (-990.100) (-998.397) * (-999.343) [-994.405] (-995.964) (-991.322) -- 0:01:48

      Average standard deviation of split frequencies: 0.003744

      440500 -- (-994.094) [-995.333] (-994.148) (-999.051) * (-997.541) (-994.419) (-1003.646) [-990.549] -- 0:01:47
      441000 -- (-993.594) (-1001.513) (-996.607) [-993.955] * (-999.132) (-997.067) [-998.799] (-994.129) -- 0:01:47
      441500 -- (-1000.309) [-993.786] (-991.848) (-993.370) * (-999.428) (-1006.165) [-995.963] (-996.715) -- 0:01:47
      442000 -- (-999.418) [-999.233] (-995.451) (-1000.690) * [-1000.673] (-996.769) (-994.908) (-994.112) -- 0:01:47
      442500 -- (-998.498) [-990.989] (-998.372) (-1004.350) * (-997.494) (-993.904) [-993.500] (-995.717) -- 0:01:47
      443000 -- [-992.382] (-992.497) (-993.707) (-994.563) * (-1002.519) (-995.826) (-995.758) [-993.133] -- 0:01:46
      443500 -- [-993.417] (-993.910) (-996.352) (-991.918) * (-996.785) (-997.385) [-992.482] (-993.039) -- 0:01:46
      444000 -- [-998.326] (-997.824) (-989.481) (-1002.050) * (-996.304) (-993.804) (-995.506) [-1001.986] -- 0:01:46
      444500 -- [-998.537] (-991.034) (-994.021) (-1002.331) * (-1001.753) (-994.659) [-988.281] (-997.361) -- 0:01:47
      445000 -- (-996.146) (-991.409) [-994.323] (-1010.523) * [-996.935] (-1003.396) (-991.367) (-998.740) -- 0:01:47

      Average standard deviation of split frequencies: 0.003699

      445500 -- (-992.318) [-993.502] (-997.164) (-1002.617) * [-993.538] (-998.428) (-991.638) (-1002.590) -- 0:01:47
      446000 -- (-996.016) (-997.147) (-994.787) [-992.184] * (-992.445) [-995.249] (-997.691) (-997.687) -- 0:01:46
      446500 -- [-1000.318] (-992.171) (-993.345) (-995.007) * (-990.055) [-995.149] (-991.899) (-999.234) -- 0:01:46
      447000 -- (-1000.486) (-995.070) [-993.428] (-995.863) * (-991.484) (-1011.916) [-990.866] (-1004.534) -- 0:01:46
      447500 -- (-994.457) [-992.923] (-994.669) (-1003.512) * (-992.117) (-1002.661) [-996.542] (-1004.006) -- 0:01:46
      448000 -- [-993.781] (-998.055) (-994.221) (-993.344) * (-994.879) [-994.574] (-997.562) (-1000.219) -- 0:01:45
      448500 -- (-1002.278) [-992.472] (-991.221) (-994.027) * [-990.909] (-994.531) (-996.615) (-999.379) -- 0:01:45
      449000 -- [-996.018] (-991.409) (-995.608) (-993.087) * [-993.823] (-999.089) (-992.585) (-1002.203) -- 0:01:45
      449500 -- (-994.754) (-994.623) (-997.350) [-994.861] * (-992.580) (-1001.997) [-991.549] (-1003.525) -- 0:01:45
      450000 -- [-996.678] (-995.246) (-992.455) (-992.916) * [-994.945] (-997.347) (-993.111) (-1003.411) -- 0:01:46

      Average standard deviation of split frequencies: 0.003138

      450500 -- (-993.717) (-997.191) (-993.354) [-993.641] * (-993.312) [-997.612] (-993.229) (-997.317) -- 0:01:46
      451000 -- (-999.914) [-999.133] (-990.821) (-993.595) * (-993.961) (-999.230) [-995.560] (-1000.828) -- 0:01:45
      451500 -- (-993.439) (-996.633) (-993.283) [-996.049] * (-995.514) (-1001.539) (-994.971) [-992.257] -- 0:01:45
      452000 -- (-999.402) (-997.106) (-994.348) [-992.436] * (-993.501) (-1000.806) (-998.394) [-993.516] -- 0:01:45
      452500 -- [-1002.063] (-990.888) (-992.616) (-1001.951) * (-995.181) (-995.818) [-994.707] (-995.307) -- 0:01:45
      453000 -- (-1002.873) (-992.261) [-992.992] (-995.150) * (-996.617) [-993.546] (-999.854) (-993.246) -- 0:01:45
      453500 -- (-996.845) (-992.223) [-994.619] (-1000.306) * (-1000.505) (-993.853) (-1002.643) [-997.191] -- 0:01:44
      454000 -- (-990.316) (-1001.070) [-1001.529] (-999.738) * (-1005.492) (-1007.011) (-997.592) [-998.984] -- 0:01:44
      454500 -- (-991.825) (-998.453) [-996.879] (-997.168) * (-996.960) (-998.006) [-994.262] (-1000.998) -- 0:01:44
      455000 -- (-998.526) (-992.103) (-999.958) [-994.568] * (-996.719) (-998.478) (-995.308) [-1008.337] -- 0:01:45

      Average standard deviation of split frequencies: 0.003101

      455500 -- (-994.976) [-993.993] (-996.416) (-1002.911) * [-993.352] (-992.768) (-998.189) (-998.059) -- 0:01:45
      456000 -- [-994.125] (-997.201) (-1001.297) (-998.318) * (-994.267) (-994.780) (-994.780) [-995.739] -- 0:01:44
      456500 -- [-992.533] (-998.925) (-996.005) (-995.001) * (-994.317) [-989.960] (-996.373) (-996.924) -- 0:01:44
      457000 -- (-996.158) (-994.170) (-996.184) [-994.099] * (-994.844) [-992.270] (-1004.468) (-995.270) -- 0:01:44
      457500 -- (-993.467) [-994.967] (-995.746) (-995.769) * (-990.845) [-996.901] (-1000.433) (-995.334) -- 0:01:44
      458000 -- (-1000.280) (-995.516) (-1000.368) [-994.082] * (-991.986) (-991.290) (-995.093) [-995.435] -- 0:01:44
      458500 -- (-995.300) (-1005.361) [-997.504] (-993.228) * (-994.401) [-991.929] (-1000.182) (-999.585) -- 0:01:43
      459000 -- (-1000.421) (-993.945) [-997.634] (-992.328) * (-992.257) (-999.635) (-995.744) [-993.942] -- 0:01:43
      459500 -- (-993.925) (-989.749) (-1001.920) [-994.310] * [-991.409] (-994.368) (-998.426) (-991.570) -- 0:01:43
      460000 -- [-1000.714] (-999.498) (-994.948) (-991.176) * (-993.506) (-994.419) [-996.400] (-997.540) -- 0:01:43

      Average standard deviation of split frequencies: 0.002558

      460500 -- (-997.898) (-1005.348) (-993.749) [-993.332] * [-994.295] (-997.788) (-1012.084) (-995.020) -- 0:01:44
      461000 -- (-998.354) (-998.200) (-997.248) [-993.223] * (-1000.078) (-1002.192) [-999.881] (-998.983) -- 0:01:44
      461500 -- (-991.017) (-993.217) [-995.221] (-996.237) * (-992.652) (-1000.395) (-996.886) [-993.863] -- 0:01:43
      462000 -- (-993.581) [-992.893] (-998.149) (-994.718) * (-991.150) [-1000.586] (-995.887) (-998.466) -- 0:01:43
      462500 -- (-990.231) (-993.243) (-995.700) [-991.930] * [-1000.523] (-998.428) (-995.394) (-1000.886) -- 0:01:43
      463000 -- [-993.896] (-998.389) (-997.693) (-995.843) * [-993.821] (-1003.086) (-997.225) (-999.276) -- 0:01:43
      463500 -- [-991.225] (-995.946) (-999.335) (-998.409) * [-998.973] (-1001.431) (-997.210) (-994.190) -- 0:01:43
      464000 -- (-993.903) [-993.963] (-989.465) (-995.014) * (-996.924) (-1000.211) (-991.581) [-990.470] -- 0:01:42
      464500 -- [-992.231] (-991.028) (-993.566) (-995.890) * (-997.944) (-1004.063) [-994.086] (-999.785) -- 0:01:42
      465000 -- (-995.873) (-996.735) (-994.081) [-995.484] * (-997.528) (-993.975) (-995.932) [-1002.698] -- 0:01:42

      Average standard deviation of split frequencies: 0.001517

      465500 -- (-993.649) [-996.347] (-991.982) (-1001.375) * (-995.702) [-993.950] (-990.848) (-993.934) -- 0:01:42
      466000 -- (-996.720) [-994.750] (-996.537) (-993.884) * [-992.473] (-990.796) (-992.673) (-994.634) -- 0:01:43
      466500 -- (-992.071) (-992.746) [-992.980] (-993.652) * (-997.360) [-992.507] (-996.054) (-993.633) -- 0:01:42
      467000 -- [-994.476] (-996.105) (-991.245) (-997.820) * (-992.621) (-992.052) [-998.840] (-996.154) -- 0:01:42
      467500 -- (-996.035) (-999.756) [-995.964] (-1000.023) * (-1006.713) (-997.614) [-992.430] (-995.657) -- 0:01:42
      468000 -- (-992.493) (-996.442) [-996.437] (-993.663) * (-994.113) [-999.898] (-992.608) (-995.853) -- 0:01:42
      468500 -- [-996.404] (-995.135) (-993.373) (-991.876) * [-997.523] (-1002.565) (-993.863) (-994.487) -- 0:01:42
      469000 -- (-999.295) (-994.056) [-999.784] (-996.549) * (-995.288) (-1002.883) (-1003.865) [-993.831] -- 0:01:41
      469500 -- (-998.229) (-992.765) (-997.081) [-995.987] * (-992.804) [-997.298] (-1000.164) (-996.871) -- 0:01:41
      470000 -- [-1002.866] (-995.691) (-994.529) (-994.403) * [-996.578] (-996.370) (-995.650) (-997.393) -- 0:01:41

      Average standard deviation of split frequencies: 0.000501

      470500 -- [-999.281] (-996.065) (-995.549) (-999.844) * (-991.627) (-998.131) [-991.947] (-1000.874) -- 0:01:41
      471000 -- (-999.375) (-998.919) (-991.250) [-991.895] * [-992.814] (-999.552) (-990.817) (-1013.397) -- 0:01:42
      471500 -- (-1000.341) [-993.410] (-991.826) (-995.638) * [-992.327] (-996.532) (-990.014) (-1001.633) -- 0:01:42
      472000 -- (-1009.179) (-991.469) [-990.985] (-991.696) * (-991.962) (-994.933) (-989.489) [-993.478] -- 0:01:41
      472500 -- [-996.516] (-996.276) (-996.524) (-995.931) * (-998.075) (-998.556) (-991.855) [-995.127] -- 0:01:41
      473000 -- (-999.118) [-997.849] (-998.827) (-993.362) * [-993.169] (-1000.484) (-997.029) (-998.324) -- 0:01:41
      473500 -- (-998.143) (-996.801) (-998.736) [-990.902] * [-994.999] (-999.844) (-991.804) (-994.468) -- 0:01:41
      474000 -- [-991.332] (-997.035) (-993.946) (-991.199) * [-995.468] (-999.654) (-994.244) (-996.682) -- 0:01:40
      474500 -- (-997.183) (-996.469) [-991.236] (-991.728) * (-995.579) (-994.754) [-993.768] (-995.899) -- 0:01:40
      475000 -- (-1000.378) (-997.963) [-995.154] (-1000.735) * (-996.853) (-994.592) [-993.844] (-1000.418) -- 0:01:40

      Average standard deviation of split frequencies: 0.000495

      475500 -- (-995.939) (-996.552) [-995.802] (-991.356) * (-992.582) (-996.667) [-996.425] (-994.349) -- 0:01:40
      476000 -- (-997.091) [-991.377] (-993.724) (-994.355) * (-998.180) (-1000.478) (-995.325) [-990.547] -- 0:01:40
      476500 -- (-1000.010) [-995.739] (-991.369) (-1000.286) * (-992.406) (-996.292) (-991.275) [-992.841] -- 0:01:41
      477000 -- (-997.552) (-993.367) [-998.437] (-997.662) * (-998.836) [-997.093] (-994.240) (-992.860) -- 0:01:40
      477500 -- [-995.034] (-993.437) (-1001.963) (-998.623) * (-994.259) (-994.952) (-999.798) [-992.469] -- 0:01:40
      478000 -- (-996.966) (-994.991) [-995.727] (-995.274) * [-992.237] (-997.846) (-994.329) (-999.536) -- 0:01:40
      478500 -- [-997.400] (-999.385) (-994.006) (-991.571) * (-997.164) (-997.576) [-996.756] (-992.127) -- 0:01:40
      479000 -- [-995.867] (-995.160) (-999.626) (-999.957) * (-991.158) (-997.067) [-993.266] (-1001.941) -- 0:01:40
      479500 -- (-996.512) (-996.106) (-993.876) [-991.811] * [-990.425] (-994.298) (-997.408) (-997.019) -- 0:01:39
      480000 -- (-990.961) [-989.956] (-995.414) (-994.418) * (-993.704) (-997.380) (-991.133) [-998.242] -- 0:01:39

      Average standard deviation of split frequencies: 0.000000

      480500 -- (-995.207) (-991.900) [-997.519] (-992.295) * (-994.205) (-994.913) [-992.738] (-1000.253) -- 0:01:39
      481000 -- (-994.509) (-997.674) [-993.507] (-1000.918) * (-993.975) (-994.703) [-990.148] (-997.669) -- 0:01:39
      481500 -- (-993.884) (-992.468) (-992.068) [-991.155] * (-998.171) [-992.621] (-995.533) (-997.967) -- 0:01:40
      482000 -- [-993.023] (-991.105) (-1001.964) (-1002.900) * (-995.001) (-991.585) [-991.433] (-995.538) -- 0:01:39
      482500 -- (-989.777) [-992.807] (-999.914) (-999.899) * (-998.859) (-995.409) [-995.254] (-1000.343) -- 0:01:39
      483000 -- (-995.941) [-990.969] (-1000.072) (-999.225) * (-998.307) [-992.198] (-994.903) (-997.993) -- 0:01:39
      483500 -- (-993.984) [-995.461] (-994.474) (-998.090) * (-1000.578) (-997.783) [-996.691] (-994.810) -- 0:01:39
      484000 -- (-995.902) (-1001.102) (-994.134) [-1004.662] * (-994.746) (-990.518) [-994.300] (-996.309) -- 0:01:39
      484500 -- (-993.079) [-993.733] (-999.259) (-1001.987) * (-1001.913) (-997.960) [-997.257] (-994.207) -- 0:01:38
      485000 -- [-995.591] (-993.718) (-996.170) (-1000.057) * [-994.699] (-992.108) (-995.380) (-996.501) -- 0:01:38

      Average standard deviation of split frequencies: 0.000485

      485500 -- (-999.220) (-993.805) (-993.186) [-995.071] * (-994.007) (-999.973) (-1003.662) [-993.637] -- 0:01:38
      486000 -- [-994.086] (-993.868) (-994.293) (-994.520) * (-990.341) (-993.131) [-994.370] (-1002.044) -- 0:01:38
      486500 -- (-994.932) (-993.978) [-990.789] (-1004.182) * (-1004.586) (-995.842) [-994.420] (-997.328) -- 0:01:38
      487000 -- [-989.483] (-992.107) (-996.141) (-998.848) * (-997.333) (-996.946) (-992.533) [-1005.496] -- 0:01:39
      487500 -- [-990.791] (-997.868) (-994.920) (-1001.288) * (-997.198) [-994.639] (-996.603) (-999.468) -- 0:01:38
      488000 -- (-991.117) [-996.918] (-996.918) (-996.334) * (-1001.684) (-995.431) (-1001.321) [-995.376] -- 0:01:38
      488500 -- (-989.981) (-998.425) [-993.698] (-1001.126) * [-988.829] (-995.049) (-994.606) (-1001.812) -- 0:01:38
      489000 -- (-993.244) (-996.953) [-995.781] (-1001.776) * [-993.906] (-992.918) (-1000.235) (-1000.429) -- 0:01:38
      489500 -- (-998.092) (-999.941) [-994.699] (-997.268) * (-996.581) [-990.889] (-993.496) (-992.460) -- 0:01:38
      490000 -- (-994.929) [-994.062] (-1000.726) (-993.931) * [-989.592] (-992.906) (-992.752) (-997.361) -- 0:01:37

      Average standard deviation of split frequencies: 0.000961

      490500 -- (-997.168) [-998.767] (-999.021) (-992.624) * (-990.481) [-998.610] (-990.772) (-998.545) -- 0:01:37
      491000 -- [-991.279] (-1000.127) (-996.990) (-998.172) * (-993.647) [-996.289] (-989.659) (-990.698) -- 0:01:37
      491500 -- (-996.955) [-993.882] (-999.230) (-998.632) * (-997.206) (-998.560) [-993.900] (-1002.795) -- 0:01:37
      492000 -- (-998.060) [-997.898] (-995.476) (-998.881) * [-993.775] (-993.137) (-994.828) (-997.690) -- 0:01:38
      492500 -- (-1001.105) (-1002.980) [-992.556] (-994.827) * (-1000.334) (-997.302) (-994.413) [-998.118] -- 0:01:37
      493000 -- (-998.722) (-999.933) [-991.677] (-997.796) * (-994.011) (-1001.235) (-998.142) [-992.022] -- 0:01:37
      493500 -- (-996.058) [-991.144] (-993.489) (-995.438) * (-995.977) (-999.429) [-1001.799] (-990.419) -- 0:01:37
      494000 -- (-995.376) [-993.371] (-993.841) (-997.807) * (-993.192) (-998.783) (-1002.227) [-1000.996] -- 0:01:37
      494500 -- [-995.104] (-994.591) (-998.772) (-992.165) * [-995.912] (-996.779) (-997.903) (-992.814) -- 0:01:37
      495000 -- (-997.365) [-993.263] (-991.613) (-996.300) * (-995.651) [-994.143] (-995.002) (-998.297) -- 0:01:36

      Average standard deviation of split frequencies: 0.001901

      495500 -- (-995.847) (-989.869) (-993.297) [-989.759] * (-993.815) (-993.522) (-998.140) [-997.948] -- 0:01:36
      496000 -- (-1002.516) (-995.083) (-999.914) [-994.029] * [-998.429] (-998.047) (-994.155) (-992.042) -- 0:01:36
      496500 -- [-996.167] (-989.116) (-997.467) (-998.716) * [-992.006] (-1006.338) (-998.657) (-998.289) -- 0:01:36
      497000 -- (-1005.388) [-993.853] (-998.175) (-994.190) * [-992.476] (-1000.550) (-991.795) (-999.210) -- 0:01:36
      497500 -- (-999.051) [-996.243] (-995.598) (-996.530) * (-989.001) (-1000.210) (-996.711) [-992.979] -- 0:01:36
      498000 -- (-996.540) [-989.519] (-1000.665) (-1001.458) * (-995.209) (-998.292) (-999.274) [-993.504] -- 0:01:36
      498500 -- (-995.777) [-993.043] (-996.667) (-992.893) * [-992.415] (-988.582) (-1003.072) (-994.146) -- 0:01:36
      499000 -- (-999.318) (-994.062) [-989.472] (-995.248) * [-997.066] (-993.562) (-999.480) (-990.474) -- 0:01:36
      499500 -- (-1003.325) (-1004.266) [-994.204] (-996.451) * (-994.488) (-997.985) (-1000.398) [-994.614] -- 0:01:36
      500000 -- (-1001.209) [-995.687] (-996.278) (-1000.554) * [-994.934] (-999.404) (-999.519) (-1004.246) -- 0:01:36

      Average standard deviation of split frequencies: 0.001412

      500500 -- [-999.518] (-992.577) (-994.561) (-996.037) * (-1001.491) [-993.058] (-998.275) (-999.690) -- 0:01:35
      501000 -- (-1000.453) [-991.512] (-989.891) (-994.340) * (-996.061) (-994.475) (-998.126) [-998.280] -- 0:01:35
      501500 -- (-995.231) (-997.656) (-993.449) [-994.578] * (-998.901) [-993.671] (-1001.748) (-997.725) -- 0:01:35
      502000 -- (-998.886) [-989.231] (-992.167) (-995.071) * (-994.211) (-991.627) (-996.621) [-995.776] -- 0:01:35
      502500 -- (-994.091) [-988.603] (-998.779) (-1001.036) * [-997.595] (-992.170) (-1002.372) (-1000.805) -- 0:01:35
      503000 -- (-993.491) (-996.264) [-990.604] (-1000.907) * (-1000.321) (-999.401) [-996.872] (-1002.920) -- 0:01:35
      503500 -- (-999.117) [-990.469] (-994.619) (-1000.205) * (-998.313) (-999.178) [-997.913] (-1001.150) -- 0:01:35
      504000 -- (-995.359) (-991.260) [-990.421] (-996.502) * (-995.251) [-991.904] (-994.903) (-996.026) -- 0:01:35
      504500 -- (-992.067) [-990.415] (-991.714) (-998.099) * (-997.113) (-992.100) (-997.969) [-991.855] -- 0:01:35
      505000 -- [-994.779] (-994.323) (-996.185) (-995.817) * (-996.073) [-993.327] (-997.046) (-992.176) -- 0:01:35

      Average standard deviation of split frequencies: 0.001863

      505500 -- (-996.999) (-992.281) [-995.066] (-996.389) * (-993.275) (-994.515) (-993.261) [-994.782] -- 0:01:34
      506000 -- (-990.628) [-997.131] (-990.997) (-993.885) * (-1000.135) (-1001.114) [-995.293] (-994.121) -- 0:01:34
      506500 -- (-996.750) (-998.185) [-992.704] (-999.470) * (-999.632) (-997.090) (-995.122) [-993.159] -- 0:01:34
      507000 -- (-994.109) [-994.160] (-992.509) (-995.317) * (-1001.019) (-996.010) [-996.478] (-991.471) -- 0:01:34
      507500 -- (-998.540) (-993.466) [-993.914] (-994.289) * (-995.530) (-993.900) [-993.540] (-993.947) -- 0:01:34
      508000 -- (-999.590) [-992.839] (-994.285) (-994.015) * (-994.455) [-991.586] (-992.228) (-990.697) -- 0:01:34
      508500 -- [-994.333] (-998.192) (-997.689) (-996.290) * (-992.986) (-995.333) (-994.999) [-990.373] -- 0:01:34
      509000 -- (-995.837) (-996.640) [-995.869] (-997.649) * [-996.871] (-997.941) (-994.053) (-991.822) -- 0:01:34
      509500 -- (-998.506) (-993.047) (-994.795) [-1000.030] * (-1002.545) (-997.447) [-988.823] (-993.905) -- 0:01:34
      510000 -- (-996.854) (-994.562) [-993.218] (-995.508) * (-998.377) (-1003.215) [-991.827] (-992.535) -- 0:01:34

      Average standard deviation of split frequencies: 0.001846

      510500 -- (-1002.789) (-997.099) (-997.156) [-994.505] * (-995.074) [-997.149] (-993.058) (-999.020) -- 0:01:33
      511000 -- (-1001.241) [-1000.079] (-998.621) (-993.697) * (-994.299) [-996.703] (-993.630) (-996.152) -- 0:01:33
      511500 -- (-995.840) [-1000.300] (-1003.835) (-997.242) * [-995.054] (-1002.017) (-1001.859) (-996.616) -- 0:01:33
      512000 -- (-992.610) (-1002.350) (-994.749) [-1000.944] * (-991.198) (-996.517) (-991.251) [-992.202] -- 0:01:33
      512500 -- (-995.498) (-999.747) (-994.561) [-990.723] * (-999.241) [-993.893] (-996.645) (-996.091) -- 0:01:33
      513000 -- (-994.530) (-1011.958) (-996.579) [-997.787] * (-998.760) (-996.951) (-997.019) [-990.809] -- 0:01:33
      513500 -- (-987.949) (-1000.677) [-993.081] (-1002.577) * (-999.673) [-995.309] (-993.161) (-990.926) -- 0:01:33
      514000 -- (-1000.507) (-997.090) [-995.030] (-1000.694) * (-991.069) (-999.175) [-995.232] (-994.276) -- 0:01:33
      514500 -- [-989.839] (-998.759) (-992.936) (-995.324) * (-994.319) (-996.176) (-994.967) [-998.921] -- 0:01:33
      515000 -- (-998.891) [-996.408] (-993.747) (-996.108) * [-997.038] (-997.727) (-995.610) (-994.746) -- 0:01:33

      Average standard deviation of split frequencies: 0.001827

      515500 -- [-998.447] (-994.372) (-993.808) (-1003.116) * (-997.076) (-993.895) (-993.063) [-998.235] -- 0:01:33
      516000 -- (-1001.691) (-995.330) [-995.191] (-995.635) * [-992.156] (-996.294) (-1002.840) (-995.100) -- 0:01:32
      516500 -- (-997.424) (-998.836) [-995.737] (-990.493) * (-1003.402) [-995.587] (-999.699) (-996.023) -- 0:01:32
      517000 -- (-997.464) (-994.870) (-993.711) [-993.834] * (-1001.681) (-994.191) (-996.695) [-996.642] -- 0:01:32
      517500 -- (-996.004) [-990.158] (-994.566) (-996.750) * (-993.433) (-994.496) (-992.985) [-996.085] -- 0:01:32
      518000 -- (-991.039) (-994.393) [-993.831] (-993.044) * (-992.436) (-994.723) [-993.011] (-1004.284) -- 0:01:32
      518500 -- [-993.845] (-998.375) (-992.087) (-991.460) * [-991.587] (-1002.144) (-995.788) (-997.898) -- 0:01:32
      519000 -- (-994.426) (-998.977) [-991.146] (-998.080) * (-993.852) (-996.115) (-997.817) [-997.753] -- 0:01:32
      519500 -- (-992.147) (-994.226) [-994.596] (-990.389) * (-995.281) (-994.248) [-995.680] (-994.599) -- 0:01:32
      520000 -- (-999.861) (-998.387) [-990.175] (-991.622) * (-999.517) (-993.953) (-997.248) [-996.103] -- 0:01:32

      Average standard deviation of split frequencies: 0.001358

      520500 -- (-994.619) (-1002.049) (-996.655) [-991.125] * [-997.128] (-995.091) (-1000.697) (-996.076) -- 0:01:32
      521000 -- (-997.100) [-996.222] (-994.287) (-993.387) * (-991.700) [-1005.762] (-1004.047) (-1005.186) -- 0:01:31
      521500 -- [-995.964] (-999.694) (-999.419) (-995.424) * [-990.737] (-998.659) (-1001.158) (-1002.205) -- 0:01:31
      522000 -- [-994.965] (-999.931) (-997.338) (-994.971) * [-993.935] (-994.524) (-1000.081) (-996.415) -- 0:01:31
      522500 -- (-992.450) (-996.312) (-998.294) [-995.561] * [-994.137] (-996.134) (-990.349) (-994.447) -- 0:01:31
      523000 -- (-989.860) (-995.303) [-998.149] (-1003.940) * (-991.112) (-993.209) [-993.268] (-991.169) -- 0:01:31
      523500 -- (-991.929) (-994.013) [-994.102] (-1015.823) * [-994.284] (-991.712) (-992.083) (-993.653) -- 0:01:31
      524000 -- (-990.882) (-994.450) [-994.098] (-1004.314) * (-991.919) [-990.304] (-998.712) (-994.696) -- 0:01:31
      524500 -- (-990.414) (-994.562) (-995.404) [-1000.420] * (-1001.844) (-994.218) [-993.319] (-995.209) -- 0:01:31
      525000 -- [-994.005] (-995.155) (-994.133) (-998.952) * (-996.100) (-990.977) (-993.825) [-993.035] -- 0:01:31

      Average standard deviation of split frequencies: 0.000896

      525500 -- (-992.610) (-991.985) (-995.174) [-1002.396] * (-990.472) (-1003.956) (-996.813) [-993.153] -- 0:01:31
      526000 -- (-994.184) (-996.944) (-996.634) [-996.730] * (-996.937) [-994.665] (-998.208) (-997.092) -- 0:01:31
      526500 -- [-994.384] (-992.934) (-998.093) (-1002.121) * (-996.598) (-994.398) (-995.825) [-991.715] -- 0:01:30
      527000 -- (-990.668) [-1002.235] (-996.591) (-992.300) * (-994.904) (-995.777) [-997.948] (-997.122) -- 0:01:30
      527500 -- (-995.621) (-998.711) (-994.317) [-997.555] * (-999.444) [-991.664] (-996.982) (-991.891) -- 0:01:30
      528000 -- (-998.234) (-995.853) [-995.781] (-1001.062) * (-1000.064) (-994.590) [-995.142] (-1002.032) -- 0:01:30
      528500 -- (-1001.693) (-993.277) [-992.689] (-995.168) * [-996.555] (-994.837) (-992.028) (-998.068) -- 0:01:30
      529000 -- (-994.253) (-993.129) (-997.252) [-992.410] * [-998.162] (-996.284) (-996.746) (-998.264) -- 0:01:29
      529500 -- (-1003.661) (-995.736) (-997.548) [-993.484] * (-996.645) (-991.703) (-994.758) [-991.957] -- 0:01:30
      530000 -- (-1001.303) (-991.295) (-990.932) [-988.132] * [-995.157] (-998.727) (-996.068) (-993.633) -- 0:01:30

      Average standard deviation of split frequencies: 0.000444

      530500 -- (-996.380) [-997.592] (-996.732) (-991.557) * (-994.543) (-995.772) (-995.734) [-992.958] -- 0:01:30
      531000 -- [-994.664] (-994.120) (-992.092) (-996.025) * [-995.287] (-991.540) (-992.087) (-998.851) -- 0:01:30
      531500 -- (-996.012) (-997.012) [-999.834] (-999.787) * (-998.125) [-992.086] (-993.846) (-999.281) -- 0:01:29
      532000 -- (-997.846) (-1000.480) [-992.875] (-996.932) * (-999.626) (-996.019) [-993.455] (-1005.630) -- 0:01:29
      532500 -- [-992.278] (-1000.052) (-991.035) (-992.191) * (-996.035) (-999.436) (-996.527) [-995.862] -- 0:01:29
      533000 -- (-993.382) (-996.257) (-992.510) [-993.264] * (-997.622) [-998.307] (-994.390) (-996.482) -- 0:01:29
      533500 -- (-993.656) [-996.971] (-994.239) (-995.854) * [-997.929] (-1000.381) (-992.525) (-995.663) -- 0:01:29
      534000 -- (-991.586) (-994.721) [-994.441] (-990.574) * (-995.262) [-997.030] (-995.721) (-995.795) -- 0:01:29
      534500 -- [-996.231] (-993.532) (-995.292) (-997.455) * (-995.664) (-993.027) [-990.558] (-1001.781) -- 0:01:29
      535000 -- (-991.406) (-997.670) (-996.737) [-994.264] * (-997.538) [-991.118] (-995.559) (-996.389) -- 0:01:29

      Average standard deviation of split frequencies: 0.000000

      535500 -- (-997.702) (-993.600) [-996.593] (-996.377) * (-990.677) (-994.826) [-994.494] (-993.381) -- 0:01:29
      536000 -- (-998.217) (-994.929) [-992.962] (-998.252) * (-993.712) (-991.118) (-993.640) [-991.775] -- 0:01:29
      536500 -- (-996.805) [-998.603] (-989.720) (-994.283) * [-992.178] (-997.397) (-995.697) (-993.019) -- 0:01:28
      537000 -- [-991.835] (-993.394) (-994.751) (-992.255) * (-997.627) (-997.533) (-996.124) [-993.084] -- 0:01:28
      537500 -- (-993.130) [-995.409] (-993.152) (-997.578) * [-996.323] (-996.026) (-1003.255) (-998.586) -- 0:01:28
      538000 -- (-990.378) (-992.523) [-992.389] (-991.351) * (-995.786) [-992.392] (-995.646) (-998.301) -- 0:01:28
      538500 -- [-1001.837] (-996.995) (-995.464) (-994.961) * [-999.458] (-995.985) (-999.655) (-1000.641) -- 0:01:28
      539000 -- (-995.245) [-994.437] (-997.577) (-998.858) * (-992.639) (-994.313) [-993.628] (-997.368) -- 0:01:28
      539500 -- (-991.451) [-994.123] (-1004.462) (-1002.018) * [-996.368] (-995.259) (-999.707) (-993.998) -- 0:01:27
      540000 -- (-995.682) (-997.804) (-996.233) [-992.425] * (-998.693) (-995.482) (-992.931) [-999.073] -- 0:01:28

      Average standard deviation of split frequencies: 0.000436

      540500 -- (-992.388) (-1003.412) (-997.705) [-993.700] * (-999.394) [-992.989] (-994.951) (-992.572) -- 0:01:28
      541000 -- [-991.651] (-999.933) (-1001.333) (-996.356) * [-993.408] (-996.131) (-994.414) (-990.121) -- 0:01:28
      541500 -- (-993.528) (-994.927) (-994.251) [-999.584] * (-992.868) (-995.748) (-990.746) [-991.969] -- 0:01:28
      542000 -- (-995.113) (-992.816) (-999.630) [-994.242] * (-994.466) (-1005.946) [-993.435] (-994.799) -- 0:01:27
      542500 -- (-991.521) (-998.098) (-996.036) [-996.936] * (-992.357) (-994.980) (-995.719) [-998.473] -- 0:01:27
      543000 -- [-993.001] (-997.724) (-992.020) (-1001.901) * (-996.521) (-992.954) (-992.418) [-998.047] -- 0:01:27
      543500 -- (-995.875) [-991.585] (-997.457) (-997.413) * (-997.719) (-995.755) [-997.797] (-999.690) -- 0:01:27
      544000 -- [-993.731] (-1001.019) (-993.043) (-996.122) * (-1003.440) (-990.813) (-996.030) [-995.659] -- 0:01:27
      544500 -- [-994.075] (-992.902) (-992.204) (-998.829) * (-997.173) [-990.191] (-1003.386) (-992.777) -- 0:01:27
      545000 -- (-995.173) [-994.768] (-995.736) (-999.278) * [-997.041] (-992.000) (-1002.756) (-995.139) -- 0:01:27

      Average standard deviation of split frequencies: 0.000432

      545500 -- (-998.390) (-1001.425) (-997.466) [-994.100] * (-994.192) (-996.065) (-996.922) [-993.938] -- 0:01:27
      546000 -- [-995.451] (-992.580) (-1001.026) (-997.193) * (-997.415) (-998.865) [-993.508] (-1003.937) -- 0:01:27
      546500 -- (-991.552) (-990.021) (-998.838) [-992.163] * (-999.594) (-998.049) [-992.040] (-998.928) -- 0:01:27
      547000 -- (-996.857) [-993.211] (-992.543) (-990.964) * [-1002.684] (-1003.581) (-994.911) (-1000.288) -- 0:01:26
      547500 -- (-997.364) (-993.074) (-993.767) [-994.641] * (-995.535) [-992.527] (-990.863) (-995.694) -- 0:01:26
      548000 -- (-992.401) (-991.404) [-998.598] (-994.532) * (-997.031) [-995.035] (-995.254) (-993.477) -- 0:01:26
      548500 -- (-991.585) [-1000.968] (-995.407) (-995.104) * (-998.917) (-997.210) (-994.053) [-995.928] -- 0:01:26
      549000 -- (-995.506) (-1005.812) (-994.661) [-995.484] * (-996.295) (-992.829) (-990.674) [-994.803] -- 0:01:26
      549500 -- [-992.183] (-994.588) (-994.838) (-996.179) * (-999.230) (-995.975) (-999.037) [-990.729] -- 0:01:26
      550000 -- (-996.901) (-993.393) [-993.778] (-1001.055) * (-994.329) [-991.198] (-991.473) (-995.857) -- 0:01:25

      Average standard deviation of split frequencies: 0.000856

      550500 -- (-995.444) (-991.813) (-998.408) [-994.652] * [-993.952] (-1003.670) (-995.331) (-995.502) -- 0:01:26
      551000 -- (-997.647) (-995.792) (-995.540) [-994.459] * (-998.049) (-995.190) [-992.938] (-992.170) -- 0:01:26
      551500 -- (-999.331) (-990.262) [-996.310] (-1003.197) * [-1004.354] (-1002.008) (-995.579) (-995.701) -- 0:01:26
      552000 -- [-994.799] (-993.304) (-996.660) (-997.820) * (-994.302) (-999.907) (-994.837) [-997.511] -- 0:01:26
      552500 -- [-992.601] (-993.190) (-996.576) (-993.790) * [-990.361] (-996.822) (-997.082) (-1000.510) -- 0:01:25
      553000 -- (-994.021) (-995.536) [-999.335] (-992.978) * (-999.703) (-995.985) [-994.354] (-996.966) -- 0:01:25
      553500 -- (-1002.148) (-1000.366) [-1002.410] (-996.935) * (-992.100) [-998.377] (-1000.935) (-993.852) -- 0:01:25
      554000 -- [-996.632] (-996.180) (-992.379) (-993.290) * (-996.314) (-999.196) (-990.983) [-994.515] -- 0:01:25
      554500 -- (-998.180) [-996.453] (-998.326) (-999.311) * (-1000.904) (-1003.425) [-995.369] (-994.410) -- 0:01:25
      555000 -- (-995.599) (-994.344) (-997.254) [-994.276] * (-995.409) (-998.270) [-992.737] (-991.627) -- 0:01:24

      Average standard deviation of split frequencies: 0.000848

      555500 -- (-993.728) (-990.716) (-998.222) [-993.336] * (-998.953) (-998.702) [-993.010] (-995.587) -- 0:01:24
      556000 -- (-1004.257) (-1000.720) (-993.663) [-998.362] * (-998.116) [-995.590] (-993.338) (-993.520) -- 0:01:25
      556500 -- [-994.624] (-995.348) (-993.130) (-1001.588) * [-1001.729] (-992.006) (-1003.758) (-995.180) -- 0:01:25
      557000 -- (-997.245) (-994.827) [-994.317] (-1000.394) * [-995.987] (-996.716) (-995.811) (-994.020) -- 0:01:25
      557500 -- [-989.493] (-993.972) (-995.440) (-998.588) * [-990.792] (-994.480) (-994.397) (-1000.788) -- 0:01:24
      558000 -- (-992.004) [-993.900] (-990.764) (-1001.681) * [-992.389] (-997.466) (-1002.694) (-994.745) -- 0:01:24
      558500 -- (-995.139) [-993.483] (-992.560) (-999.415) * (-991.808) (-1000.276) (-995.328) [-998.744] -- 0:01:24
      559000 -- (-993.798) (-991.876) [-991.263] (-995.992) * (-998.735) (-996.582) (-1003.729) [-992.944] -- 0:01:24
      559500 -- [-996.604] (-994.502) (-998.712) (-994.330) * (-990.834) (-1010.834) (-993.540) [-994.946] -- 0:01:24
      560000 -- (-998.660) (-995.874) (-990.853) [-994.843] * (-993.888) (-1000.261) [-991.635] (-994.213) -- 0:01:24

      Average standard deviation of split frequencies: 0.000841

      560500 -- (-992.892) (-999.783) (-991.060) [-995.395] * [-995.573] (-996.797) (-999.237) (-999.596) -- 0:01:23
      561000 -- (-992.490) (-997.197) [-995.333] (-994.349) * (-992.068) (-1000.540) [-997.989] (-995.223) -- 0:01:24
      561500 -- [-990.519] (-997.952) (-992.421) (-993.409) * (-1000.298) (-994.801) (-997.124) [-994.737] -- 0:01:24
      562000 -- (-1000.227) (-996.912) [-996.199] (-994.441) * (-994.985) (-996.706) [-992.328] (-993.903) -- 0:01:24
      562500 -- (-995.307) (-1003.888) (-992.261) [-993.593] * (-994.234) [-993.928] (-997.603) (-997.758) -- 0:01:24
      563000 -- (-999.928) (-996.822) (-996.660) [-992.527] * [-996.499] (-998.184) (-995.965) (-993.628) -- 0:01:23
      563500 -- (-1002.229) (-996.985) (-992.944) [-993.429] * (-991.474) [-1000.750] (-1003.366) (-994.919) -- 0:01:23
      564000 -- (-995.628) [-1001.930] (-991.943) (-995.211) * (-994.964) (-996.428) (-1000.477) [-992.681] -- 0:01:23
      564500 -- (-993.368) (-995.775) [-994.922] (-994.033) * (-992.746) (-994.983) (-998.186) [-993.301] -- 0:01:23
      565000 -- [-996.324] (-994.082) (-1003.031) (-995.131) * [-996.573] (-994.637) (-997.377) (-996.174) -- 0:01:23

      Average standard deviation of split frequencies: 0.000833

      565500 -- (-997.070) (-999.546) (-992.675) [-993.873] * [-993.837] (-996.377) (-1001.438) (-995.117) -- 0:01:22
      566000 -- (-996.443) (-993.364) [-994.785] (-993.568) * [-993.273] (-997.383) (-997.569) (-999.468) -- 0:01:22
      566500 -- (-993.918) (-992.151) [-992.049] (-995.255) * (-995.335) (-999.335) [-995.320] (-998.554) -- 0:01:23
      567000 -- (-996.990) (-994.711) [-996.413] (-999.196) * (-994.572) (-999.297) [-991.773] (-987.678) -- 0:01:23
      567500 -- (-999.087) (-999.495) [-992.917] (-1000.171) * [-994.694] (-997.364) (-997.832) (-1001.449) -- 0:01:23
      568000 -- (-994.962) (-998.175) [-993.825] (-994.757) * (-993.729) (-998.816) (-992.515) [-996.650] -- 0:01:22
      568500 -- (-999.918) [-995.181] (-992.290) (-994.367) * (-995.495) (-995.181) (-993.477) [-994.033] -- 0:01:22
      569000 -- (-997.495) (-990.982) (-991.338) [-991.975] * (-992.166) [-996.900] (-999.670) (-995.174) -- 0:01:22
      569500 -- (-1008.022) (-1000.498) (-997.992) [-993.029] * (-995.979) (-998.613) (-997.361) [-994.551] -- 0:01:22
      570000 -- (-1006.226) (-999.231) [-993.573] (-1001.797) * (-1002.059) (-996.792) (-992.172) [-993.769] -- 0:01:22

      Average standard deviation of split frequencies: 0.001239

      570500 -- (-1002.374) [-995.350] (-994.167) (-1000.303) * (-1003.995) (-996.416) (-996.012) [-1000.044] -- 0:01:22
      571000 -- (-997.101) [-997.511] (-992.635) (-997.312) * (-995.708) (-996.698) [-995.763] (-996.372) -- 0:01:22
      571500 -- [-993.264] (-997.142) (-994.286) (-996.413) * [-993.471] (-997.253) (-1000.527) (-999.041) -- 0:01:22
      572000 -- (-989.670) (-994.051) (-992.958) [-996.415] * (-995.283) [-992.176] (-995.921) (-994.807) -- 0:01:22
      572500 -- [-991.900] (-995.463) (-999.076) (-993.775) * [-994.199] (-996.216) (-995.000) (-994.815) -- 0:01:22
      573000 -- [-995.794] (-994.921) (-995.506) (-994.912) * (-997.302) (-994.290) (-994.852) [-995.069] -- 0:01:21
      573500 -- [-996.384] (-996.598) (-999.798) (-994.064) * (-994.641) (-996.324) (-1001.707) [-999.741] -- 0:01:21
      574000 -- (-994.779) [-994.509] (-999.941) (-994.533) * (-996.234) (-996.865) [-996.573] (-1001.197) -- 0:01:21
      574500 -- (-990.714) (-994.016) (-996.355) [-1002.805] * (-992.582) (-994.972) (-1000.650) [-995.265] -- 0:01:21
      575000 -- [-998.790] (-992.594) (-995.010) (-993.885) * (-996.544) (-1003.496) (-1000.471) [-995.808] -- 0:01:21

      Average standard deviation of split frequencies: 0.001228

      575500 -- (-992.967) (-1000.780) [-992.390] (-995.735) * (-997.613) (-996.312) (-999.699) [-993.010] -- 0:01:21
      576000 -- (-991.840) [-994.113] (-999.559) (-993.549) * [-993.007] (-997.204) (-996.297) (-994.112) -- 0:01:21
      576500 -- (-998.398) (-1000.711) (-993.222) [-991.425] * (-995.986) [-998.697] (-999.139) (-996.470) -- 0:01:21
      577000 -- (-991.826) [-1001.066] (-1001.241) (-994.781) * [-994.246] (-1007.963) (-1001.960) (-991.767) -- 0:01:21
      577500 -- (-996.156) (-1004.770) (-1000.830) [-993.154] * (-998.925) (-998.779) [-995.954] (-992.202) -- 0:01:21
      578000 -- (-996.422) (-996.169) (-1005.018) [-996.083] * (-997.640) (-1006.632) (-996.239) [-998.090] -- 0:01:21
      578500 -- (-994.227) (-998.002) (-1005.347) [-991.432] * (-993.859) (-996.949) (-994.506) [-989.862] -- 0:01:20
      579000 -- (-993.122) [-1001.388] (-1002.933) (-996.875) * (-993.751) (-996.010) [-989.813] (-993.971) -- 0:01:20
      579500 -- (-991.506) (-996.392) (-1005.590) [-997.112] * (-1000.367) (-997.361) (-998.469) [-992.938] -- 0:01:20
      580000 -- [-994.145] (-996.904) (-994.576) (-996.693) * (-1001.171) (-1002.353) [-997.435] (-996.954) -- 0:01:20

      Average standard deviation of split frequencies: 0.001624

      580500 -- (-997.444) [-996.529] (-996.957) (-1000.061) * (-996.928) [-991.906] (-995.961) (-1002.809) -- 0:01:20
      581000 -- (-999.226) (-998.160) [-995.968] (-994.560) * (-994.306) [-991.872] (-997.947) (-995.881) -- 0:01:20
      581500 -- (-995.441) (-997.840) (-993.302) [-999.692] * (-991.661) [-995.553] (-998.039) (-996.941) -- 0:01:20
      582000 -- [-995.928] (-997.186) (-1000.997) (-991.208) * (-992.313) (-999.010) (-997.793) [-991.253] -- 0:01:20
      582500 -- (-992.367) (-992.632) (-998.351) [-989.797] * [-998.190] (-999.597) (-994.841) (-994.822) -- 0:01:20
      583000 -- (-988.819) (-999.077) (-998.294) [-993.566] * (-992.018) (-997.347) [-991.195] (-994.328) -- 0:01:20
      583500 -- [-991.216] (-995.277) (-997.165) (-995.212) * [-992.616] (-994.758) (-989.524) (-999.007) -- 0:01:19
      584000 -- [-993.588] (-998.176) (-996.054) (-999.246) * (-990.169) [-988.940] (-998.229) (-992.561) -- 0:01:19
      584500 -- (-996.270) [-992.688] (-994.512) (-1003.280) * (-995.934) (-994.290) [-994.517] (-995.781) -- 0:01:19
      585000 -- [-991.880] (-993.482) (-1000.288) (-995.698) * [-990.290] (-993.501) (-1004.296) (-991.302) -- 0:01:19

      Average standard deviation of split frequencies: 0.001609

      585500 -- [-990.519] (-991.956) (-998.891) (-996.159) * (-995.710) (-993.869) (-993.242) [-991.667] -- 0:01:19
      586000 -- (-1005.173) (-996.229) (-994.211) [-993.258] * (-1004.156) (-992.020) [-994.911] (-993.170) -- 0:01:19
      586500 -- (-995.052) [-996.179] (-991.742) (-994.188) * [-994.583] (-996.492) (-997.602) (-992.738) -- 0:01:19
      587000 -- (-995.975) [-996.732] (-989.445) (-997.592) * [-995.392] (-1000.052) (-995.884) (-996.797) -- 0:01:19
      587500 -- [-993.747] (-996.911) (-993.265) (-999.267) * [-996.456] (-995.564) (-990.199) (-996.145) -- 0:01:19
      588000 -- (-998.990) (-994.625) (-993.237) [-993.510] * (-1001.636) [-994.208] (-999.432) (-998.484) -- 0:01:19
      588500 -- [-1000.205] (-995.611) (-992.370) (-993.946) * (-992.537) [-996.050] (-995.194) (-996.490) -- 0:01:19
      589000 -- [-999.284] (-995.292) (-992.363) (-999.041) * [-991.462] (-998.280) (-996.150) (-1000.215) -- 0:01:18
      589500 -- (-999.623) [-996.318] (-997.863) (-990.508) * [-996.612] (-1001.475) (-995.843) (-992.629) -- 0:01:18
      590000 -- (-995.485) [-1001.482] (-995.383) (-993.764) * (-996.357) [-995.609] (-994.050) (-994.672) -- 0:01:18

      Average standard deviation of split frequencies: 0.001596

      590500 -- (-1002.645) (-999.676) (-998.220) [-996.217] * (-995.594) (-997.987) (-996.085) [-991.191] -- 0:01:18
      591000 -- (-1006.782) [-995.786] (-995.080) (-1000.289) * (-996.545) [-996.282] (-1001.056) (-994.919) -- 0:01:18
      591500 -- [-1000.633] (-995.408) (-1000.121) (-997.002) * (-997.174) (-995.646) [-998.079] (-996.589) -- 0:01:18
      592000 -- (-996.638) [-994.997] (-994.163) (-995.185) * (-1000.670) [-991.988] (-994.897) (-998.633) -- 0:01:18
      592500 -- (-999.048) (-998.698) (-997.473) [-992.751] * (-992.722) (-995.344) [-992.245] (-992.080) -- 0:01:18
      593000 -- (-993.387) (-997.290) [-998.961] (-997.497) * (-995.671) (-995.570) (-991.425) [-994.648] -- 0:01:18
      593500 -- (-997.452) (-1000.903) [-994.989] (-999.924) * (-990.078) (-993.248) [-993.702] (-992.088) -- 0:01:18
      594000 -- (-994.470) (-999.178) (-998.079) [-991.674] * (-996.206) (-993.982) [-991.848] (-999.793) -- 0:01:17
      594500 -- (-996.727) (-1000.515) (-995.560) [-991.572] * [-997.038] (-994.226) (-1000.290) (-990.893) -- 0:01:17
      595000 -- [-993.093] (-1000.701) (-1003.091) (-990.853) * (-1002.862) [-1000.480] (-998.364) (-997.928) -- 0:01:17

      Average standard deviation of split frequencies: 0.000395

      595500 -- (-990.799) (-999.319) (-997.149) [-990.177] * (-1005.389) (-992.118) (-998.550) [-997.637] -- 0:01:17
      596000 -- (-993.930) (-992.595) (-996.236) [-1002.446] * (-995.995) [-993.740] (-999.616) (-997.777) -- 0:01:17
      596500 -- (-996.918) (-998.019) (-995.208) [-994.734] * (-999.518) [-994.659] (-996.935) (-997.579) -- 0:01:17
      597000 -- (-995.419) (-996.554) [-990.153] (-998.190) * [-993.337] (-992.169) (-996.561) (-997.431) -- 0:01:17
      597500 -- (-992.649) [-998.260] (-995.674) (-993.461) * (-998.209) (-996.403) (-996.006) [-993.220] -- 0:01:17
      598000 -- (-993.882) [-990.741] (-996.028) (-992.689) * (-996.152) (-993.209) (-995.575) [-989.358] -- 0:01:17
      598500 -- (-994.153) (-995.400) (-997.274) [-995.619] * [-996.096] (-1010.024) (-1000.653) (-998.369) -- 0:01:17
      599000 -- [-996.153] (-995.059) (-1002.594) (-990.772) * (-1003.473) (-999.028) [-999.253] (-995.794) -- 0:01:16
      599500 -- (-998.931) (-992.860) (-993.509) [-996.155] * (-994.645) (-998.326) (-998.524) [-991.616] -- 0:01:16
      600000 -- (-994.387) (-993.309) [-995.160] (-990.309) * (-992.105) [-998.250] (-993.021) (-995.902) -- 0:01:16

      Average standard deviation of split frequencies: 0.000785

      600500 -- (-994.096) (-994.055) [-995.112] (-994.265) * (-999.277) [-1005.001] (-994.095) (-990.651) -- 0:01:16
      601000 -- [-993.312] (-992.977) (-991.254) (-996.146) * (-994.460) (-1003.645) (-997.180) [-992.495] -- 0:01:16
      601500 -- (-999.505) [-991.800] (-995.084) (-994.017) * (-995.251) [-999.015] (-993.452) (-998.607) -- 0:01:16
      602000 -- (-998.757) [-994.782] (-991.800) (-995.615) * (-992.899) (-994.771) [-1000.566] (-992.863) -- 0:01:16
      602500 -- (-998.956) (-990.566) [-992.807] (-991.662) * (-998.538) [-992.884] (-998.332) (-993.676) -- 0:01:16
      603000 -- (-1002.940) [-992.587] (-992.354) (-990.679) * (-990.498) (-995.970) (-999.182) [-999.290] -- 0:01:16
      603500 -- (-997.749) (-990.905) [-994.067] (-991.850) * (-997.530) [-1002.328] (-1004.362) (-1000.441) -- 0:01:16
      604000 -- (-995.883) (-996.070) (-993.550) [-991.592] * (-996.433) (-999.557) (-993.307) [-993.597] -- 0:01:16
      604500 -- (-998.957) (-998.184) [-995.649] (-996.117) * [-994.363] (-998.580) (-991.282) (-993.014) -- 0:01:15
      605000 -- (-996.347) [-992.498] (-1005.459) (-994.344) * [-996.221] (-1005.994) (-996.224) (-998.130) -- 0:01:15

      Average standard deviation of split frequencies: 0.000778

      605500 -- (-1005.365) [-990.475] (-1002.699) (-991.274) * [-996.049] (-999.011) (-991.373) (-1000.129) -- 0:01:15
      606000 -- (-996.532) [-991.016] (-999.449) (-1000.131) * [-996.327] (-1001.575) (-993.924) (-997.763) -- 0:01:15
      606500 -- (-997.119) (-995.885) (-996.668) [-993.731] * [-995.862] (-998.140) (-994.894) (-992.558) -- 0:01:15
      607000 -- (-1002.785) (-993.684) (-1000.206) [-999.675] * (-998.193) [-992.242] (-993.070) (-996.446) -- 0:01:15
      607500 -- (-1005.412) [-998.764] (-996.317) (-995.105) * (-1001.514) (-1011.009) [-991.015] (-991.039) -- 0:01:15
      608000 -- (-997.675) (-989.816) (-996.488) [-993.767] * [-992.591] (-994.255) (-994.828) (-995.070) -- 0:01:15
      608500 -- (-998.531) [-994.820] (-1001.972) (-994.002) * (-992.383) (-990.588) (-996.574) [-991.433] -- 0:01:15
      609000 -- (-996.149) (-996.568) [-995.432] (-1004.055) * [-993.490] (-997.828) (-998.258) (-993.835) -- 0:01:15
      609500 -- (-997.174) [-995.697] (-997.109) (-1002.871) * [-992.092] (-994.711) (-991.943) (-1003.326) -- 0:01:14
      610000 -- [-1003.508] (-991.974) (-991.835) (-994.689) * (-990.419) [-994.934] (-995.039) (-996.121) -- 0:01:14

      Average standard deviation of split frequencies: 0.001158

      610500 -- (-998.753) (-996.217) [-993.727] (-993.146) * (-999.747) (-994.856) (-995.113) [-992.301] -- 0:01:14
      611000 -- (-997.191) (-997.272) [-998.286] (-998.452) * [-996.285] (-1000.028) (-993.880) (-991.254) -- 0:01:14
      611500 -- [-995.383] (-994.920) (-997.210) (-996.837) * (-990.848) (-993.205) (-993.403) [-991.590] -- 0:01:14
      612000 -- [-997.915] (-990.931) (-1000.930) (-994.365) * (-996.814) (-997.765) (-992.855) [-998.404] -- 0:01:14
      612500 -- [-993.569] (-999.007) (-997.810) (-991.288) * (-996.965) [-995.374] (-995.864) (-994.105) -- 0:01:14
      613000 -- (-1000.261) (-995.554) [-990.168] (-997.558) * [-999.425] (-996.230) (-1005.758) (-993.763) -- 0:01:14
      613500 -- (-1003.911) (-993.336) (-994.036) [-993.770] * (-996.987) (-997.837) [-992.681] (-994.608) -- 0:01:14
      614000 -- (-1000.691) (-994.462) [-995.269] (-997.298) * (-999.427) (-998.392) (-993.324) [-1001.297] -- 0:01:14
      614500 -- (-998.385) [-995.799] (-996.239) (-989.791) * [-993.706] (-994.481) (-993.705) (-995.392) -- 0:01:14
      615000 -- (-993.794) (-994.862) (-993.184) [-992.410] * (-999.606) (-1003.396) [-998.108] (-1002.532) -- 0:01:13

      Average standard deviation of split frequencies: 0.001148

      615500 -- (-1002.012) (-998.476) (-997.729) [-994.438] * [-991.623] (-1004.682) (-996.183) (-1006.026) -- 0:01:13
      616000 -- (-995.018) [-992.524] (-992.717) (-994.073) * (-993.261) [-996.790] (-991.959) (-1002.903) -- 0:01:13
      616500 -- (-1001.933) [-994.670] (-998.724) (-990.672) * [-992.861] (-997.129) (-996.646) (-998.168) -- 0:01:13
      617000 -- [-998.527] (-992.174) (-998.447) (-990.714) * (-990.404) [-996.323] (-998.796) (-995.090) -- 0:01:13
      617500 -- (-1005.507) (-988.562) (-995.891) [-996.160] * (-997.294) (-1002.389) [-994.803] (-1008.322) -- 0:01:13
      618000 -- (-990.961) (-995.281) [-995.283] (-991.179) * (-993.823) (-995.562) [-997.711] (-1001.153) -- 0:01:13
      618500 -- (-993.752) (-993.300) [-992.648] (-1004.391) * (-995.299) (-999.291) [-993.661] (-999.197) -- 0:01:13
      619000 -- [-994.927] (-993.784) (-993.513) (-992.184) * (-994.821) (-993.775) (-994.503) [-996.765] -- 0:01:13
      619500 -- (-995.423) [-991.832] (-994.172) (-998.550) * (-992.120) (-995.256) (-994.573) [-994.552] -- 0:01:13
      620000 -- (-996.286) (-996.611) [-990.387] (-999.017) * (-996.163) (-996.567) (-989.543) [-990.322] -- 0:01:12

      Average standard deviation of split frequencies: 0.000760

      620500 -- (-995.320) [-994.983] (-995.764) (-996.562) * (-996.210) [-998.604] (-993.131) (-995.317) -- 0:01:12
      621000 -- (-994.207) (-996.800) (-997.147) [-994.270] * (-995.839) [-991.114] (-997.311) (-995.081) -- 0:01:12
      621500 -- [-990.874] (-996.278) (-996.043) (-994.675) * (-998.128) [-992.568] (-991.620) (-993.503) -- 0:01:12
      622000 -- (-1008.281) (-1005.140) (-994.470) [-994.568] * (-1002.455) (-992.191) (-1005.521) [-991.738] -- 0:01:12
      622500 -- (-992.088) (-999.009) [-996.469] (-994.717) * (-997.890) (-999.932) (-999.558) [-992.960] -- 0:01:12
      623000 -- (-994.757) (-995.549) (-993.906) [-995.231] * (-994.724) [-992.252] (-994.745) (-995.294) -- 0:01:12
      623500 -- (-998.507) (-995.873) [-997.914] (-994.178) * (-992.503) (-991.481) (-995.304) [-995.675] -- 0:01:12
      624000 -- (-999.001) (-997.227) (-993.330) [-993.105] * (-998.261) [-995.559] (-993.563) (-1001.721) -- 0:01:12
      624500 -- [-1000.628] (-1003.820) (-996.679) (-1001.593) * (-1001.548) (-993.167) [-991.997] (-992.849) -- 0:01:12
      625000 -- (-999.678) (-1000.715) [-993.460] (-996.828) * (-997.553) (-995.086) [-993.594] (-994.560) -- 0:01:12

      Average standard deviation of split frequencies: 0.000753

      625500 -- [-995.088] (-1000.919) (-1001.171) (-993.124) * [-1000.154] (-998.953) (-994.468) (-995.017) -- 0:01:11
      626000 -- [-988.933] (-1004.361) (-998.095) (-992.310) * (-1000.189) (-1000.665) (-991.466) [-995.567] -- 0:01:11
      626500 -- (-992.283) (-1004.138) [-993.983] (-1001.577) * (-999.180) (-993.474) [-995.608] (-1008.254) -- 0:01:11
      627000 -- (-990.256) (-1001.754) (-993.777) [-994.333] * (-1001.938) [-994.088] (-996.423) (-1001.264) -- 0:01:11
      627500 -- (-993.458) [-998.341] (-995.799) (-993.037) * (-1000.387) (-994.739) [-994.808] (-1002.635) -- 0:01:11
      628000 -- [-995.619] (-995.584) (-995.099) (-1001.701) * [-998.947] (-996.310) (-992.566) (-993.134) -- 0:01:11
      628500 -- (-993.958) [-993.165] (-997.604) (-993.039) * (-997.174) (-1000.216) [-1001.088] (-993.997) -- 0:01:11
      629000 -- (-998.178) [-997.332] (-995.994) (-990.293) * (-993.429) (-992.523) [-993.102] (-1004.315) -- 0:01:11
      629500 -- (-1002.725) (-991.807) [-992.566] (-997.652) * [-996.209] (-995.279) (-996.234) (-992.414) -- 0:01:11
      630000 -- (-1001.945) (-1000.721) [-992.156] (-995.316) * (-995.438) [-992.113] (-992.481) (-999.069) -- 0:01:11

      Average standard deviation of split frequencies: 0.000747

      630500 -- [-997.364] (-993.500) (-994.031) (-995.769) * (-992.091) (-991.234) [-996.561] (-1003.368) -- 0:01:10
      631000 -- (-999.413) [-994.648] (-1004.580) (-998.253) * [-990.960] (-1001.141) (-994.663) (-1004.687) -- 0:01:10
      631500 -- (-998.962) [-999.864] (-996.646) (-996.905) * [-994.996] (-998.369) (-995.732) (-999.017) -- 0:01:10
      632000 -- (-996.754) (-996.346) (-1006.230) [-995.063] * (-993.375) (-994.063) (-991.760) [-1000.689] -- 0:01:10
      632500 -- (-994.632) (-995.706) [-997.053] (-992.529) * [-992.765] (-996.610) (-996.230) (-1000.390) -- 0:01:10
      633000 -- [-994.687] (-991.804) (-998.756) (-997.634) * (-995.592) [-996.804] (-1002.024) (-999.633) -- 0:01:10
      633500 -- (-993.943) (-1001.099) [-994.268] (-997.106) * (-992.741) (-996.063) [-995.325] (-995.143) -- 0:01:10
      634000 -- (-993.983) (-1001.359) [-997.611] (-995.259) * (-994.922) (-993.460) (-990.222) [-991.026] -- 0:01:10
      634500 -- [-993.242] (-997.829) (-997.068) (-998.975) * (-995.661) (-993.354) (-994.758) [-998.879] -- 0:01:10
      635000 -- (-996.504) [-989.879] (-998.247) (-996.259) * (-994.525) (-992.687) [-995.304] (-1015.000) -- 0:01:10

      Average standard deviation of split frequencies: 0.000371

      635500 -- (-999.902) [-992.757] (-993.642) (-993.890) * (-998.380) (-995.391) [-990.778] (-1003.610) -- 0:01:09
      636000 -- (-993.912) (-991.357) [-997.708] (-997.378) * (-995.728) [-998.370] (-992.871) (-998.437) -- 0:01:09
      636500 -- (-990.097) (-994.941) [-1000.436] (-996.498) * (-993.179) (-1007.760) [-993.671] (-997.666) -- 0:01:09
      637000 -- (-991.187) (-995.002) (-999.014) [-994.985] * [-995.401] (-1006.155) (-996.010) (-994.500) -- 0:01:09
      637500 -- (-995.896) (-994.866) (-995.067) [-998.054] * [-992.847] (-997.136) (-999.028) (-994.319) -- 0:01:09
      638000 -- (-995.916) [-991.291] (-997.798) (-998.618) * (-994.716) (-996.426) [-990.897] (-993.659) -- 0:01:09
      638500 -- (-999.869) (-993.439) (-995.755) [-993.717] * (-994.926) [-998.207] (-1000.330) (-994.575) -- 0:01:09
      639000 -- (-996.739) (-995.950) [-993.567] (-991.188) * [-992.500] (-992.444) (-993.418) (-1000.573) -- 0:01:09
      639500 -- [-989.607] (-996.445) (-995.358) (-994.070) * [-995.616] (-998.507) (-994.094) (-1002.490) -- 0:01:09
      640000 -- (-996.563) [-993.121] (-997.932) (-992.300) * (-997.232) [-994.931] (-995.992) (-998.837) -- 0:01:09

      Average standard deviation of split frequencies: 0.000736

      640500 -- [-991.428] (-996.695) (-997.466) (-993.222) * (-992.289) [-993.261] (-995.497) (-996.546) -- 0:01:09
      641000 -- [-991.237] (-998.886) (-994.380) (-993.079) * (-989.473) (-991.968) (-997.362) [-989.696] -- 0:01:08
      641500 -- (-993.005) [-998.446] (-998.106) (-991.145) * [-995.019] (-999.530) (-992.862) (-996.739) -- 0:01:08
      642000 -- [-992.695] (-1001.838) (-996.561) (-995.659) * [-992.856] (-994.760) (-998.617) (-995.894) -- 0:01:08
      642500 -- (-992.617) (-997.472) [-992.418] (-995.120) * (-991.979) (-992.610) (-1001.024) [-992.642] -- 0:01:08
      643000 -- (-993.409) (-998.968) [-993.987] (-991.909) * [-996.688] (-993.200) (-999.015) (-1002.956) -- 0:01:08
      643500 -- (-999.079) (-994.072) (-993.824) [-1002.656] * (-1001.671) (-999.278) [-995.915] (-995.694) -- 0:01:08
      644000 -- (-997.338) (-1000.056) [-992.322] (-995.470) * (-995.443) [-997.754] (-999.099) (-994.974) -- 0:01:07
      644500 -- [-999.742] (-998.125) (-998.858) (-997.354) * (-994.437) (-1004.352) [-995.871] (-993.701) -- 0:01:08
      645000 -- (-997.808) [-994.715] (-1000.160) (-998.272) * (-994.215) (-1000.178) [-997.411] (-997.840) -- 0:01:08

      Average standard deviation of split frequencies: 0.000730

      645500 -- (-995.787) (-996.018) (-992.950) [-995.607] * (-994.455) [-994.025] (-993.580) (-997.737) -- 0:01:08
      646000 -- (-1004.247) [-990.327] (-993.944) (-995.324) * (-996.750) [-993.831] (-992.012) (-996.877) -- 0:01:07
      646500 -- [-992.580] (-994.846) (-995.356) (-995.839) * (-995.082) (-1001.104) [-994.888] (-996.306) -- 0:01:07
      647000 -- (-996.731) [-995.799] (-996.758) (-995.624) * (-997.646) [-994.877] (-1002.556) (-996.608) -- 0:01:07
      647500 -- (-994.575) (-995.234) [-991.733] (-997.010) * (-990.792) (-996.326) (-994.770) [-998.216] -- 0:01:07
      648000 -- (-997.057) (-997.181) [-991.625] (-1001.512) * (-991.551) [-998.343] (-993.411) (-993.234) -- 0:01:07
      648500 -- (-992.628) (-994.694) [-991.732] (-995.013) * (-999.298) (-991.851) (-994.753) [-996.272] -- 0:01:07
      649000 -- (-996.229) (-1002.650) (-996.762) [-997.916] * [-997.687] (-997.957) (-996.562) (-992.886) -- 0:01:07
      649500 -- (-998.315) [-993.091] (-993.430) (-999.896) * (-997.413) [-992.276] (-998.308) (-994.739) -- 0:01:06
      650000 -- (-992.634) [-991.423] (-1002.779) (-992.993) * (-995.193) [-996.939] (-1001.499) (-994.467) -- 0:01:07

      Average standard deviation of split frequencies: 0.000362

      650500 -- (-994.951) [-991.647] (-1002.570) (-990.614) * (-990.867) (-992.897) [-995.341] (-994.370) -- 0:01:07
      651000 -- (-993.520) (-996.342) (-997.697) [-991.285] * [-994.050] (-993.429) (-997.990) (-996.853) -- 0:01:07
      651500 -- (-994.141) (-993.036) (-994.843) [-992.770] * (-996.315) (-997.823) [-996.133] (-996.426) -- 0:01:06
      652000 -- (-998.477) (-993.807) (-994.946) [-993.056] * [-994.731] (-995.236) (-991.674) (-999.960) -- 0:01:06
      652500 -- (-1001.781) (-996.608) (-998.041) [-992.758] * (-989.121) [-994.179] (-998.870) (-992.303) -- 0:01:06
      653000 -- (-1000.064) (-994.611) [-994.763] (-995.703) * (-998.649) (-998.340) [-991.753] (-990.841) -- 0:01:06
      653500 -- [-995.777] (-997.702) (-990.541) (-999.940) * [-995.408] (-998.453) (-993.576) (-994.359) -- 0:01:06
      654000 -- (-994.657) (-996.035) [-992.775] (-998.365) * (-995.131) (-991.786) (-1002.471) [-991.686] -- 0:01:06
      654500 -- (-990.617) (-993.482) [-991.885] (-995.111) * (-995.838) [-994.500] (-999.287) (-992.697) -- 0:01:05
      655000 -- [-991.721] (-996.369) (-1000.562) (-999.245) * (-990.805) (-992.135) (-998.375) [-995.020] -- 0:01:06

      Average standard deviation of split frequencies: 0.000359

      655500 -- (-998.237) (-997.266) (-999.614) [-993.369] * (-997.932) (-995.605) [-1001.538] (-998.073) -- 0:01:06
      656000 -- (-1001.306) (-992.962) [-994.544] (-990.890) * (-989.059) [-991.092] (-993.376) (-997.950) -- 0:01:06
      656500 -- (-993.536) (-1000.875) (-996.199) [-993.030] * (-1001.350) [-995.881] (-997.699) (-1003.419) -- 0:01:05
      657000 -- (-998.660) (-997.812) (-998.391) [-992.459] * [-996.589] (-993.355) (-1001.314) (-993.860) -- 0:01:05
      657500 -- (-1006.096) [-991.810] (-991.716) (-994.595) * [-991.532] (-995.505) (-995.304) (-997.646) -- 0:01:05
      658000 -- [-998.170] (-994.387) (-992.946) (-994.245) * (-997.294) (-997.346) (-1003.508) [-994.970] -- 0:01:05
      658500 -- [-990.491] (-993.469) (-994.279) (-996.372) * (-998.007) (-998.290) (-1002.891) [-996.213] -- 0:01:05
      659000 -- [-996.094] (-993.254) (-996.516) (-993.492) * (-995.336) (-1001.004) (-994.960) [-995.919] -- 0:01:05
      659500 -- [-992.788] (-1001.189) (-1000.941) (-995.003) * [-996.763] (-995.340) (-995.202) (-990.594) -- 0:01:05
      660000 -- [-995.120] (-997.400) (-1002.374) (-997.823) * (-995.680) (-994.506) (-1000.213) [-992.855] -- 0:01:05

      Average standard deviation of split frequencies: 0.000000

      660500 -- (-997.362) (-993.423) (-999.474) [-997.506] * [-992.322] (-992.471) (-996.216) (-993.872) -- 0:01:05
      661000 -- [-989.893] (-991.502) (-997.273) (-994.477) * [-993.906] (-995.506) (-990.301) (-993.008) -- 0:01:05
      661500 -- [-993.097] (-992.946) (-994.904) (-994.138) * (-994.934) (-1001.140) [-993.612] (-996.133) -- 0:01:04
      662000 -- (-993.691) (-992.500) (-996.805) [-998.301] * (-992.700) (-997.047) (-994.289) [-991.508] -- 0:01:04
      662500 -- (-996.689) (-993.867) (-1010.985) [-993.563] * (-996.721) (-991.987) [-997.571] (-994.359) -- 0:01:04
      663000 -- (-999.995) (-996.946) (-991.551) [-996.119] * [-990.118] (-996.557) (-997.328) (-996.270) -- 0:01:04
      663500 -- [-998.208] (-993.798) (-1000.642) (-996.687) * (-1001.965) [-993.827] (-999.515) (-997.476) -- 0:01:04
      664000 -- (-989.667) (-1005.087) [-991.225] (-1004.941) * [-995.066] (-995.507) (-993.919) (-996.734) -- 0:01:04
      664500 -- (-992.489) (-989.990) (-993.919) [-995.352] * (-999.978) [-992.091] (-996.587) (-995.790) -- 0:01:04
      665000 -- (-996.803) [-993.279] (-1001.328) (-1000.046) * (-992.617) (-994.106) [-991.092] (-998.966) -- 0:01:04

      Average standard deviation of split frequencies: 0.000000

      665500 -- (-999.787) (-998.734) (-997.147) [-991.753] * (-993.578) [-1002.197] (-990.996) (-998.596) -- 0:01:04
      666000 -- [-994.451] (-991.228) (-995.577) (-993.319) * [-992.835] (-999.018) (-991.261) (-1001.581) -- 0:01:04
      666500 -- (-992.230) (-1000.911) [-996.914] (-999.935) * [-994.287] (-992.672) (-999.651) (-997.686) -- 0:01:04
      667000 -- (-991.906) (-995.344) [-991.816] (-1002.292) * (-992.378) [-992.749] (-995.589) (-994.822) -- 0:01:03
      667500 -- (-990.017) [-999.394] (-997.556) (-1000.590) * [-994.110] (-992.734) (-995.495) (-993.285) -- 0:01:03
      668000 -- (-993.193) (-999.103) [-998.647] (-1000.462) * [-992.450] (-997.299) (-1000.406) (-992.649) -- 0:01:03
      668500 -- (-990.872) [-990.743] (-995.217) (-995.932) * [-993.407] (-997.431) (-993.416) (-994.581) -- 0:01:03
      669000 -- (-993.746) [-994.637] (-995.360) (-993.848) * [-989.847] (-997.387) (-998.271) (-996.905) -- 0:01:03
      669500 -- [-994.517] (-993.477) (-996.175) (-997.396) * [-988.457] (-995.759) (-997.802) (-996.680) -- 0:01:03
      670000 -- (-993.383) (-999.556) [-998.403] (-991.665) * (-995.436) (-992.103) (-995.688) [-993.234] -- 0:01:03

      Average standard deviation of split frequencies: 0.000703

      670500 -- [-993.765] (-1001.994) (-995.827) (-994.139) * (-993.890) [-995.902] (-998.216) (-997.370) -- 0:01:03
      671000 -- (-994.138) (-993.332) [-1000.622] (-994.226) * (-992.800) [-997.345] (-991.921) (-996.203) -- 0:01:03
      671500 -- (-996.017) (-993.454) (-999.423) [-990.114] * (-992.377) (-997.710) [-991.997] (-1000.685) -- 0:01:03
      672000 -- (-998.868) [-992.765] (-997.879) (-993.343) * (-998.345) [-992.854] (-992.611) (-996.559) -- 0:01:02
      672500 -- (-993.114) (-996.010) [-992.125] (-992.239) * (-995.485) (-994.930) [-993.792] (-997.402) -- 0:01:02
      673000 -- (-1004.734) (-994.599) [-999.147] (-994.211) * (-992.214) [-992.306] (-991.660) (-999.963) -- 0:01:02
      673500 -- (-997.354) [-996.706] (-997.963) (-998.133) * [-991.421] (-992.968) (-998.769) (-995.950) -- 0:01:02
      674000 -- [-993.826] (-995.087) (-995.939) (-995.837) * (-998.631) [-991.889] (-1007.999) (-996.024) -- 0:01:02
      674500 -- (-997.729) [-993.176] (-994.037) (-996.193) * [-994.089] (-994.211) (-996.036) (-999.475) -- 0:01:02
      675000 -- [-993.024] (-996.837) (-996.463) (-999.076) * (-996.092) [-994.142] (-992.796) (-994.622) -- 0:01:02

      Average standard deviation of split frequencies: 0.000697

      675500 -- (-992.878) [-991.663] (-994.096) (-991.425) * (-992.857) [-995.450] (-991.076) (-995.073) -- 0:01:02
      676000 -- (-998.619) [-996.964] (-990.437) (-991.060) * [-995.223] (-995.495) (-994.350) (-991.172) -- 0:01:02
      676500 -- [-993.151] (-997.536) (-994.980) (-1002.407) * (-996.236) [-999.430] (-1004.481) (-991.003) -- 0:01:02
      677000 -- (-991.106) (-993.723) (-991.763) [-992.799] * (-998.340) (-995.490) [-996.145] (-992.512) -- 0:01:02
      677500 -- (-992.948) (-994.856) (-996.360) [-992.774] * (-1000.187) [-996.601] (-995.808) (-995.313) -- 0:01:01
      678000 -- (-995.295) (-1001.158) (-996.007) [-995.574] * (-996.043) [-993.425] (-993.603) (-991.331) -- 0:01:01
      678500 -- [-995.796] (-996.964) (-1002.562) (-998.857) * (-1002.679) [-991.507] (-993.437) (-995.131) -- 0:01:01
      679000 -- (-993.216) [-990.866] (-996.801) (-991.966) * (-997.064) (-996.184) (-990.656) [-993.455] -- 0:01:01
      679500 -- (-997.723) [-992.258] (-992.744) (-1001.086) * (-994.839) (-996.138) [-990.334] (-994.605) -- 0:01:01
      680000 -- (-1006.909) (-993.752) (-989.013) [-996.540] * [-995.320] (-992.704) (-994.117) (-998.605) -- 0:01:01

      Average standard deviation of split frequencies: 0.000000

      680500 -- (-997.263) (-993.930) [-990.248] (-999.357) * (-999.164) [-993.090] (-997.004) (-991.641) -- 0:01:01
      681000 -- [-995.297] (-993.947) (-992.023) (-999.690) * [-993.981] (-998.653) (-995.588) (-989.722) -- 0:01:01
      681500 -- (-996.060) (-995.627) [-990.443] (-998.901) * (-994.242) (-994.842) [-993.265] (-993.459) -- 0:01:01
      682000 -- (-998.355) (-991.148) [-993.788] (-996.392) * [-992.641] (-997.312) (-994.068) (-995.146) -- 0:01:01
      682500 -- (-999.283) (-994.183) [-993.918] (-999.736) * [-992.466] (-994.908) (-994.435) (-990.518) -- 0:01:00
      683000 -- (-994.277) (-991.608) [-992.199] (-997.177) * [-992.336] (-993.370) (-997.674) (-1003.219) -- 0:01:00
      683500 -- [-990.226] (-998.112) (-999.751) (-1002.411) * (-997.395) [-1000.456] (-1000.260) (-996.403) -- 0:01:00
      684000 -- (-998.390) (-994.361) [-995.804] (-994.444) * (-995.741) (-997.192) [-994.423] (-1003.735) -- 0:01:00
      684500 -- (-996.844) (-997.948) (-995.386) [-996.758] * (-996.194) (-996.498) [-994.904] (-998.212) -- 0:01:00
      685000 -- (-993.231) (-990.033) (-992.395) [-993.300] * (-994.509) (-1002.359) (-994.584) [-992.286] -- 0:01:00

      Average standard deviation of split frequencies: 0.000344

      685500 -- (-992.138) (-995.417) (-994.237) [-999.157] * (-996.667) (-1006.950) [-997.196] (-991.078) -- 0:01:00
      686000 -- (-999.366) [-991.080] (-992.999) (-996.704) * (-1000.116) (-997.786) [-990.315] (-988.966) -- 0:01:00
      686500 -- (-995.966) [-997.003] (-999.440) (-995.899) * (-995.768) (-994.705) (-993.092) [-993.277] -- 0:01:00
      687000 -- [-991.700] (-1000.114) (-989.658) (-995.289) * (-992.576) (-996.895) (-993.411) [-996.688] -- 0:01:00
      687500 -- (-995.166) (-988.070) [-999.375] (-989.493) * [-994.220] (-989.940) (-991.858) (-991.576) -- 0:01:00
      688000 -- [-992.245] (-994.053) (-995.608) (-994.444) * (-1003.431) (-999.745) (-1003.662) [-996.506] -- 0:00:59
      688500 -- (-992.360) [-996.380] (-994.335) (-993.286) * (-1000.766) (-994.604) [-997.110] (-1000.246) -- 0:00:59
      689000 -- (-993.146) [-994.973] (-999.489) (-991.565) * (-998.828) (-993.135) [-996.650] (-998.574) -- 0:01:00
      689500 -- (-995.172) (-994.363) [-1000.044] (-995.035) * [-1001.737] (-991.838) (-997.064) (-998.293) -- 0:00:59
      690000 -- [-994.829] (-997.693) (-993.981) (-994.051) * [-1000.343] (-1004.642) (-1000.619) (-995.107) -- 0:00:59

      Average standard deviation of split frequencies: 0.000341

      690500 -- [-997.846] (-995.515) (-998.823) (-995.184) * (-1004.539) (-994.351) [-993.791] (-995.509) -- 0:00:59
      691000 -- (-992.968) [-992.610] (-998.378) (-993.950) * (-1003.671) (-999.337) [-995.049] (-1001.774) -- 0:00:59
      691500 -- (-995.997) [-995.447] (-1003.099) (-997.127) * (-998.626) (-999.218) (-998.999) [-994.620] -- 0:00:59
      692000 -- (-995.852) (-992.238) (-1000.157) [-991.043] * (-993.816) (-1000.725) (-999.195) [-996.045] -- 0:00:59
      692500 -- [-992.336] (-992.801) (-998.396) (-994.959) * [-990.165] (-992.879) (-1003.539) (-997.447) -- 0:00:59
      693000 -- (-998.775) (-998.900) (-994.895) [-992.502] * (-996.799) (-993.820) (-992.877) [-998.401] -- 0:00:58
      693500 -- (-999.054) (-999.801) (-994.306) [-991.738] * (-992.343) (-994.920) [-996.405] (-993.231) -- 0:00:58
      694000 -- (-997.237) [-996.597] (-997.554) (-994.873) * (-992.397) [-992.300] (-995.716) (-995.493) -- 0:00:58
      694500 -- (-989.658) [-1000.557] (-992.007) (-993.861) * (-995.736) [-996.515] (-994.110) (-995.958) -- 0:00:58
      695000 -- (-998.730) (-990.024) (-1000.002) [-996.684] * [-992.831] (-997.210) (-1000.262) (-999.099) -- 0:00:58

      Average standard deviation of split frequencies: 0.000339

      695500 -- (-992.488) [-991.620] (-995.115) (-1004.333) * [-995.684] (-998.355) (-996.364) (-999.180) -- 0:00:58
      696000 -- [-991.876] (-993.891) (-998.922) (-999.211) * (-993.481) [-993.074] (-991.344) (-998.586) -- 0:00:58
      696500 -- [-995.441] (-1000.055) (-993.098) (-998.725) * [-990.418] (-993.832) (-997.512) (-998.898) -- 0:00:58
      697000 -- (-994.427) (-996.574) (-995.548) [-994.098] * [-993.764] (-993.090) (-997.637) (-994.717) -- 0:00:58
      697500 -- (-999.650) [-993.906] (-1001.646) (-1002.427) * (-994.944) [-994.152] (-997.825) (-994.571) -- 0:00:58
      698000 -- (-998.228) (-992.032) [-1002.646] (-996.163) * (-1004.201) (-991.833) [-996.642] (-998.350) -- 0:00:57
      698500 -- (-997.724) (-996.365) (-1000.855) [-998.380] * (-998.448) (-996.955) [-992.991] (-994.430) -- 0:00:57
      699000 -- [-994.763] (-995.901) (-998.952) (-998.227) * (-997.183) (-996.752) (-993.199) [-995.344] -- 0:00:57
      699500 -- [-992.325] (-994.740) (-991.536) (-991.345) * (-995.590) (-999.411) [-992.186] (-996.740) -- 0:00:57
      700000 -- (-999.582) [-990.668] (-998.402) (-991.701) * (-994.594) (-995.018) (-995.281) [-994.577] -- 0:00:57

      Average standard deviation of split frequencies: 0.000673

      700500 -- (-997.443) (-991.324) (-995.024) [-991.485] * (-1000.927) (-993.299) [-996.314] (-1001.254) -- 0:00:57
      701000 -- (-995.709) (-992.774) [-990.696] (-1002.037) * [-989.949] (-993.712) (-997.706) (-993.744) -- 0:00:57
      701500 -- (-996.681) [-989.952] (-996.837) (-996.906) * (-990.996) [-991.115] (-993.569) (-999.933) -- 0:00:57
      702000 -- [-994.333] (-989.297) (-1004.280) (-993.192) * (-1001.694) (-998.832) (-993.618) [-994.762] -- 0:00:57
      702500 -- (-996.549) (-993.460) [-992.559] (-999.866) * (-993.606) [-995.931] (-997.483) (-1003.931) -- 0:00:57
      703000 -- (-996.704) [-1001.201] (-994.582) (-1001.896) * (-998.916) [-992.192] (-996.367) (-999.282) -- 0:00:57
      703500 -- (-998.410) (-997.036) (-997.306) [-995.428] * (-996.493) [-995.355] (-998.015) (-1001.740) -- 0:00:56
      704000 -- (-998.739) [-993.476] (-1001.374) (-994.534) * (-992.738) (-996.714) [-996.987] (-1007.882) -- 0:00:56
      704500 -- (-999.426) (-995.679) [-994.575] (-1002.301) * [-993.951] (-992.485) (-996.823) (-995.982) -- 0:00:56
      705000 -- [-994.501] (-1000.865) (-991.082) (-997.798) * (-996.062) (-990.573) [-998.402] (-997.505) -- 0:00:56

      Average standard deviation of split frequencies: 0.000668

      705500 -- (-996.575) [-996.941] (-997.661) (-994.614) * [-993.828] (-999.110) (-996.510) (-994.861) -- 0:00:56
      706000 -- (-994.055) (-995.706) [-990.935] (-998.385) * (-995.466) [-990.948] (-996.790) (-999.796) -- 0:00:56
      706500 -- [-996.758] (-990.884) (-996.984) (-999.107) * (-992.746) (-998.171) [-991.361] (-997.676) -- 0:00:56
      707000 -- (-994.329) [-996.834] (-992.909) (-1005.203) * (-993.760) (-992.166) [-994.735] (-993.856) -- 0:00:56
      707500 -- (-999.265) [-1003.865] (-993.341) (-998.867) * (-993.099) [-990.203] (-996.752) (-996.156) -- 0:00:56
      708000 -- [-993.211] (-1005.489) (-996.355) (-997.400) * (-991.509) (-1006.036) (-1000.637) [-990.019] -- 0:00:56
      708500 -- [-991.789] (-1000.953) (-992.506) (-997.147) * (-995.434) (-995.007) [-992.858] (-992.758) -- 0:00:55
      709000 -- (-991.559) (-995.812) (-998.008) [-993.851] * (-994.185) (-993.643) (-995.572) [-993.657] -- 0:00:55
      709500 -- [-993.701] (-996.576) (-993.348) (-992.124) * (-997.992) [-994.473] (-990.744) (-993.602) -- 0:00:55
      710000 -- (-998.864) [-996.772] (-993.797) (-993.831) * (-992.622) (-996.384) [-993.232] (-994.529) -- 0:00:55

      Average standard deviation of split frequencies: 0.000663

      710500 -- (-991.637) (-1002.145) (-990.350) [-993.706] * [-997.761] (-998.314) (-999.049) (-994.627) -- 0:00:55
      711000 -- (-996.395) [-996.025] (-995.399) (-991.959) * (-995.668) [-992.629] (-992.859) (-994.115) -- 0:00:55
      711500 -- [-995.302] (-999.658) (-995.124) (-994.802) * (-994.653) [-993.917] (-996.610) (-996.732) -- 0:00:55
      712000 -- (-1005.121) (-997.422) (-995.003) [-994.473] * (-995.449) (-1003.446) (-999.767) [-994.566] -- 0:00:55
      712500 -- (-1001.947) (-996.104) (-997.970) [-996.333] * [-992.491] (-996.180) (-995.649) (-994.864) -- 0:00:55
      713000 -- [-993.539] (-993.117) (-1005.551) (-996.392) * (-997.801) (-991.363) (-994.179) [-995.346] -- 0:00:55
      713500 -- (-990.116) (-990.851) [-992.783] (-999.288) * (-994.673) (-994.502) (-993.947) [-993.505] -- 0:00:55
      714000 -- (-995.629) (-991.080) (-997.530) [-998.486] * (-999.491) [-995.089] (-994.185) (-998.258) -- 0:00:54
      714500 -- [-1001.715] (-994.265) (-998.109) (-1001.292) * [-989.430] (-999.432) (-991.857) (-1000.636) -- 0:00:54
      715000 -- (-1001.620) (-995.632) (-1003.116) [-992.513] * (-1000.488) (-998.465) (-997.423) [-996.624] -- 0:00:54

      Average standard deviation of split frequencies: 0.000658

      715500 -- (-992.380) (-996.496) (-1004.097) [-992.272] * (-996.830) (-998.693) (-1000.990) [-1002.713] -- 0:00:54
      716000 -- (-997.297) (-1002.639) (-1004.780) [-991.839] * (-994.712) (-993.540) (-991.369) [-1000.245] -- 0:00:54
      716500 -- (-997.102) (-1000.822) (-1000.658) [-991.524] * (-994.898) (-997.071) (-993.599) [-992.339] -- 0:00:54
      717000 -- (-993.105) (-994.406) [-994.419] (-997.526) * (-1004.913) (-992.918) (-998.870) [-995.675] -- 0:00:54
      717500 -- [-993.272] (-994.399) (-995.771) (-992.737) * (-1004.315) (-992.243) (-994.027) [-994.636] -- 0:00:54
      718000 -- (-993.777) [-992.205] (-1006.680) (-998.460) * (-998.350) (-991.057) (-997.386) [-993.006] -- 0:00:54
      718500 -- (-997.673) (-991.684) (-1008.744) [-999.950] * (-1001.664) (-992.062) [-993.904] (-994.975) -- 0:00:54
      719000 -- (-995.902) (-990.937) [-1006.335] (-998.289) * (-995.249) [-991.542] (-995.883) (-995.693) -- 0:00:53
      719500 -- (-990.808) (-992.569) (-1003.108) [-1003.738] * (-998.903) (-996.283) [-995.914] (-1001.442) -- 0:00:53
      720000 -- (-994.041) (-1004.016) (-997.441) [-991.965] * (-997.912) [-992.647] (-993.154) (-997.817) -- 0:00:53

      Average standard deviation of split frequencies: 0.000000

      720500 -- (-996.423) (-1002.060) (-993.836) [-990.782] * (-995.946) (-994.896) [-992.799] (-992.021) -- 0:00:53
      721000 -- [-994.687] (-995.893) (-1000.101) (-997.889) * [-1003.359] (-996.496) (-989.296) (-993.714) -- 0:00:53
      721500 -- (-997.585) [-994.408] (-997.239) (-998.766) * (-1001.191) [-993.178] (-991.966) (-996.449) -- 0:00:53
      722000 -- [-995.643] (-997.213) (-996.814) (-1005.537) * (-1001.842) (-997.690) (-991.707) [-993.749] -- 0:00:53
      722500 -- [-1000.562] (-1003.084) (-999.169) (-994.100) * (-1002.497) (-1001.899) [-995.335] (-992.818) -- 0:00:53
      723000 -- (-995.286) (-1001.402) [-991.551] (-1002.981) * [-1000.616] (-998.628) (-992.784) (-996.841) -- 0:00:53
      723500 -- (-996.820) (-995.775) (-990.656) [-995.284] * (-999.615) (-1002.730) [-993.188] (-1001.741) -- 0:00:53
      724000 -- (-1002.626) (-997.079) [-997.214] (-992.282) * (-1001.069) (-991.355) (-996.929) [-993.894] -- 0:00:52
      724500 -- (-995.968) [-998.766] (-1000.187) (-1000.025) * (-1008.211) (-996.949) (-994.740) [-995.936] -- 0:00:52
      725000 -- [-995.560] (-1000.375) (-999.133) (-993.817) * (-998.900) (-995.958) [-998.540] (-1001.201) -- 0:00:52

      Average standard deviation of split frequencies: 0.000000

      725500 -- (-999.193) (-998.772) [-994.305] (-991.441) * (-994.144) [-994.672] (-998.101) (-998.316) -- 0:00:52
      726000 -- [-996.447] (-997.497) (-994.464) (-994.110) * [-990.532] (-994.823) (-1005.805) (-994.364) -- 0:00:52
      726500 -- (-992.873) (-998.942) [-995.168] (-994.525) * (-999.265) (-994.977) [-999.926] (-999.741) -- 0:00:52
      727000 -- (-996.945) (-999.564) [-998.850] (-992.125) * [-997.561] (-993.078) (-1003.885) (-998.631) -- 0:00:52
      727500 -- (-996.872) [-995.369] (-1002.410) (-992.708) * (-997.946) [-994.194] (-1004.053) (-998.826) -- 0:00:52
      728000 -- (-1005.222) (-998.965) (-991.930) [-998.169] * (-1001.788) (-990.498) (-1003.565) [-993.617] -- 0:00:52
      728500 -- (-992.049) [-989.560] (-995.464) (-995.568) * (-1000.849) (-991.531) [-1000.023] (-996.737) -- 0:00:52
      729000 -- [-994.349] (-996.997) (-1000.808) (-1002.402) * (-993.529) [-993.925] (-1000.372) (-995.320) -- 0:00:52
      729500 -- (-993.333) [-999.104] (-995.302) (-998.711) * (-993.780) (-993.581) [-994.229] (-993.542) -- 0:00:51
      730000 -- (-994.225) [-990.728] (-993.046) (-996.116) * [-994.547] (-995.516) (-993.171) (-994.407) -- 0:00:51

      Average standard deviation of split frequencies: 0.000323

      730500 -- [-998.568] (-995.572) (-991.815) (-997.236) * [-1000.313] (-994.235) (-995.657) (-989.071) -- 0:00:51
      731000 -- [-996.716] (-994.455) (-992.820) (-996.126) * (-993.755) (-993.789) [-993.808] (-992.489) -- 0:00:51
      731500 -- (-998.765) (-998.180) (-994.216) [-994.324] * (-989.887) (-991.501) [-997.852] (-1000.422) -- 0:00:51
      732000 -- (-995.723) (-999.430) (-990.736) [-992.928] * (-995.547) [-998.120] (-1002.907) (-998.373) -- 0:00:51
      732500 -- (-996.454) (-992.019) (-992.702) [-996.674] * (-996.736) (-996.105) [-991.955] (-995.894) -- 0:00:51
      733000 -- (-995.043) (-989.763) [-996.317] (-995.531) * (-997.207) [-990.465] (-993.221) (-992.217) -- 0:00:51
      733500 -- (-998.263) (-992.579) [-991.161] (-994.313) * (-998.406) (-993.524) (-990.436) [-989.502] -- 0:00:51
      734000 -- [-993.512] (-996.353) (-991.023) (-997.286) * (-994.146) [-991.542] (-994.014) (-998.457) -- 0:00:51
      734500 -- (-996.570) (-996.936) (-997.823) [-997.150] * (-995.450) (-991.937) [-997.815] (-993.836) -- 0:00:50
      735000 -- (-995.835) (-991.454) (-990.870) [-990.207] * [-995.477] (-995.558) (-994.951) (-1002.493) -- 0:00:50

      Average standard deviation of split frequencies: 0.000640

      735500 -- (-1000.327) (-994.918) (-994.392) [-997.169] * (-997.302) (-991.227) [-994.344] (-992.018) -- 0:00:50
      736000 -- (-1001.239) (-992.930) (-991.773) [-989.881] * (-998.442) (-995.078) (-996.717) [-992.619] -- 0:00:50
      736500 -- (-996.121) (-997.851) (-1001.306) [-994.091] * (-1001.491) (-997.334) [-993.776] (-998.395) -- 0:00:50
      737000 -- (-995.005) [-989.560] (-1004.556) (-994.623) * [-996.466] (-999.517) (-992.839) (-999.508) -- 0:00:50
      737500 -- [-994.585] (-991.698) (-1004.094) (-999.044) * [-996.777] (-999.077) (-997.680) (-1003.488) -- 0:00:50
      738000 -- (-995.695) (-991.100) (-996.030) [-992.270] * [-994.746] (-998.387) (-995.303) (-999.728) -- 0:00:50
      738500 -- [-995.829] (-995.063) (-997.957) (-1001.089) * [-1001.877] (-1000.848) (-992.972) (-991.721) -- 0:00:50
      739000 -- (-1004.005) (-1000.361) (-997.346) [-991.815] * (-993.930) (-1002.397) [-991.964] (-995.355) -- 0:00:50
      739500 -- [-996.281] (-988.933) (-995.224) (-1003.443) * [-990.606] (-1000.196) (-1003.336) (-990.741) -- 0:00:50
      740000 -- (-1001.765) (-994.742) (-995.404) [-992.632] * (-1001.620) (-997.594) [-996.467] (-993.085) -- 0:00:49

      Average standard deviation of split frequencies: 0.000636

      740500 -- (-999.108) (-990.353) [-995.243] (-992.546) * [-1000.176] (-1005.177) (-993.318) (-997.625) -- 0:00:49
      741000 -- (-993.062) [-988.085] (-993.992) (-999.826) * [-994.148] (-1003.720) (-1006.038) (-995.639) -- 0:00:49
      741500 -- (-996.357) [-992.056] (-993.957) (-1000.003) * (-998.415) (-996.377) (-1006.190) [-996.780] -- 0:00:49
      742000 -- [-995.885] (-1000.484) (-995.504) (-992.785) * (-993.760) [-997.890] (-1003.747) (-1000.183) -- 0:00:49
      742500 -- (-990.945) (-995.942) (-1002.942) [-994.073] * (-994.644) (-999.938) (-1001.159) [-990.399] -- 0:00:49
      743000 -- [-991.924] (-993.300) (-1002.756) (-1002.422) * (-994.508) [-997.323] (-1000.452) (-996.270) -- 0:00:49
      743500 -- (-996.096) (-1000.299) [-992.113] (-996.568) * [-992.223] (-997.586) (-1005.361) (-994.983) -- 0:00:49
      744000 -- [-994.674] (-998.385) (-993.864) (-992.219) * [-998.293] (-1000.699) (-999.493) (-1000.490) -- 0:00:49
      744500 -- (-995.049) (-997.516) [-998.706] (-999.662) * (-994.121) (-1003.303) (-995.408) [-993.865] -- 0:00:49
      745000 -- (-998.428) [-993.717] (-993.185) (-996.608) * (-997.063) (-994.798) [-991.599] (-997.290) -- 0:00:48

      Average standard deviation of split frequencies: 0.000948

      745500 -- (-991.584) [-995.456] (-997.401) (-1000.109) * [-997.237] (-997.675) (-994.856) (-994.995) -- 0:00:48
      746000 -- (-996.564) [-996.427] (-994.789) (-1004.905) * (-996.595) (-999.763) (-996.306) [-991.113] -- 0:00:48
      746500 -- (-993.739) [-994.366] (-992.918) (-994.315) * (-1001.956) (-999.320) (-995.731) [-990.985] -- 0:00:48
      747000 -- (-997.532) (-998.029) (-991.087) [-990.746] * (-997.723) (-992.750) (-994.526) [-997.756] -- 0:00:48
      747500 -- (-993.317) (-995.938) (-997.960) [-991.040] * (-993.231) [-992.605] (-1004.096) (-996.429) -- 0:00:48
      748000 -- (-997.474) (-994.188) (-994.983) [-993.957] * [-990.236] (-994.669) (-994.356) (-1005.151) -- 0:00:48
      748500 -- [-994.506] (-995.559) (-996.688) (-995.237) * (-992.535) [-997.334] (-993.450) (-994.667) -- 0:00:48
      749000 -- (-993.334) (-1000.038) (-995.775) [-990.591] * (-996.367) (-992.590) [-992.887] (-992.042) -- 0:00:48
      749500 -- (-1000.474) [-997.282] (-996.771) (-994.704) * (-992.071) [-994.909] (-993.813) (-996.648) -- 0:00:48
      750000 -- [-1000.952] (-999.195) (-996.651) (-997.695) * (-1000.873) [-996.122] (-995.632) (-995.663) -- 0:00:48

      Average standard deviation of split frequencies: 0.000942

      750500 -- (-994.703) [-993.002] (-999.303) (-993.487) * (-994.181) (-998.455) [-995.727] (-999.621) -- 0:00:48
      751000 -- (-998.377) (-1001.259) (-994.104) [-993.498] * (-998.477) (-1001.392) (-995.007) [-995.315] -- 0:00:48
      751500 -- (-995.748) [-996.508] (-993.373) (-996.812) * (-994.585) (-994.650) (-995.351) [-998.621] -- 0:00:47
      752000 -- (-1001.137) (-993.185) (-997.003) [-998.889] * (-996.978) (-995.872) (-997.314) [-994.876] -- 0:00:47
      752500 -- (-994.088) [-990.406] (-999.542) (-994.175) * [-993.512] (-993.016) (-998.867) (-998.885) -- 0:00:47
      753000 -- [-996.386] (-993.039) (-996.230) (-996.672) * (-995.149) (-994.948) [-997.491] (-996.376) -- 0:00:47
      753500 -- [-994.263] (-996.403) (-995.874) (-1004.281) * (-996.974) [-993.475] (-997.705) (-995.713) -- 0:00:47
      754000 -- (-1004.290) [-994.361] (-997.759) (-1001.460) * (-1002.362) [-990.579] (-992.686) (-996.016) -- 0:00:47
      754500 -- [-990.061] (-1000.540) (-999.700) (-1002.333) * (-994.204) [-998.623] (-996.965) (-999.530) -- 0:00:47
      755000 -- (-994.638) (-1000.217) [-994.704] (-1002.468) * (-993.943) (-993.412) (-993.086) [-993.874] -- 0:00:47

      Average standard deviation of split frequencies: 0.000624

      755500 -- (-994.190) (-1006.446) [-1003.531] (-997.473) * (-996.879) [-994.343] (-1002.985) (-1001.902) -- 0:00:47
      756000 -- (-997.708) (-1004.567) (-998.836) [-994.951] * (-995.299) (-991.882) (-1000.445) [-992.594] -- 0:00:47
      756500 -- [-996.445] (-1002.909) (-999.050) (-996.516) * (-996.507) [-997.855] (-1003.874) (-992.891) -- 0:00:46
      757000 -- (-996.416) (-1010.779) [-997.905] (-993.538) * [-998.562] (-998.489) (-1000.630) (-1001.660) -- 0:00:46
      757500 -- [-995.810] (-1004.246) (-991.390) (-994.470) * (-993.913) (-1000.912) (-992.641) [-993.761] -- 0:00:46
      758000 -- [-992.198] (-1001.136) (-991.839) (-996.563) * [-995.060] (-996.984) (-992.767) (-1003.417) -- 0:00:46
      758500 -- (-993.958) (-994.303) [-995.002] (-1001.097) * (-996.545) (-993.143) (-991.966) [-992.761] -- 0:00:46
      759000 -- (-997.744) (-997.717) [-998.083] (-995.525) * (-999.242) (-995.346) [-994.824] (-991.398) -- 0:00:46
      759500 -- [-991.056] (-999.798) (-994.371) (-992.889) * [-995.394] (-993.692) (-995.006) (-995.233) -- 0:00:46
      760000 -- [-997.056] (-997.790) (-1001.919) (-994.263) * [-991.849] (-994.572) (-1001.816) (-997.272) -- 0:00:46

      Average standard deviation of split frequencies: 0.000620

      760500 -- (-996.235) [-999.235] (-1000.612) (-995.550) * (-996.812) (-995.529) [-993.147] (-1001.751) -- 0:00:46
      761000 -- (-998.999) (-997.344) (-997.836) [-999.569] * (-998.198) (-996.928) [-995.313] (-991.876) -- 0:00:46
      761500 -- (-993.420) (-995.139) (-997.849) [-991.836] * (-997.109) (-993.573) [-1004.662] (-991.689) -- 0:00:46
      762000 -- (-993.577) (-990.982) (-997.458) [-1000.239] * [-995.624] (-995.451) (-998.929) (-996.008) -- 0:00:45
      762500 -- (-992.156) [-993.130] (-994.720) (-991.878) * (-996.734) (-994.782) (-996.395) [-994.366] -- 0:00:45
      763000 -- (-995.182) (-993.791) [-996.765] (-988.219) * (-997.017) [-989.325] (-989.969) (-989.918) -- 0:00:45
      763500 -- [-993.726] (-992.616) (-998.896) (-996.266) * (-1006.879) (-992.477) [-997.471] (-994.152) -- 0:00:45
      764000 -- [-999.158] (-994.152) (-995.750) (-998.513) * (-994.726) (-996.577) [-995.468] (-997.905) -- 0:00:45
      764500 -- (-994.772) [-990.434] (-1001.001) (-998.779) * [-997.049] (-997.697) (-993.714) (-997.066) -- 0:00:45
      765000 -- (-995.557) (-993.184) (-994.603) [-991.846] * (-1000.511) (-992.267) (-997.843) [-1000.681] -- 0:00:45

      Average standard deviation of split frequencies: 0.000308

      765500 -- (-991.430) (-993.975) (-995.617) [-993.673] * (-997.200) (-993.694) (-997.235) [-991.977] -- 0:00:45
      766000 -- (-996.767) [-991.558] (-995.674) (-990.943) * (-997.840) (-1000.693) (-995.247) [-995.122] -- 0:00:45
      766500 -- (-999.929) (-993.479) [-994.100] (-996.253) * (-1006.220) [-993.982] (-996.724) (-996.626) -- 0:00:45
      767000 -- [-994.111] (-994.280) (-994.603) (-991.654) * (-997.024) [-991.084] (-1000.708) (-994.542) -- 0:00:44
      767500 -- [-991.670] (-993.875) (-992.171) (-998.666) * (-1001.266) (-1000.507) [-993.786] (-999.345) -- 0:00:44
      768000 -- [-992.834] (-998.601) (-995.556) (-1002.528) * (-996.326) (-994.628) [-992.810] (-998.358) -- 0:00:44
      768500 -- (-997.378) (-998.369) (-1000.250) [-991.771] * (-998.718) [-992.148] (-990.823) (-992.992) -- 0:00:44
      769000 -- [-997.724] (-992.704) (-997.435) (-991.816) * (-1001.874) (-993.353) [-991.178] (-996.502) -- 0:00:44
      769500 -- (-993.704) [-1005.723] (-1008.742) (-991.436) * (-995.444) (-993.420) (-991.879) [-989.542] -- 0:00:44
      770000 -- [-990.008] (-996.897) (-1002.300) (-1000.030) * (-994.357) (-992.074) [-991.150] (-998.678) -- 0:00:44

      Average standard deviation of split frequencies: 0.000306

      770500 -- (-996.574) (-993.447) [-995.735] (-991.946) * (-997.639) (-996.313) [-992.105] (-1000.016) -- 0:00:44
      771000 -- (-992.146) [-993.968] (-997.342) (-994.185) * (-995.483) [-988.835] (-994.374) (-991.426) -- 0:00:44
      771500 -- (-994.946) (-999.042) (-997.382) [-991.454] * (-995.680) [-997.689] (-995.061) (-997.929) -- 0:00:44
      772000 -- (-995.280) [-997.701] (-993.573) (-998.021) * (-997.374) (-1003.204) (-999.177) [-993.291] -- 0:00:44
      772500 -- (-995.087) (-996.929) (-995.432) [-997.561] * [-997.543] (-995.334) (-993.511) (-1000.210) -- 0:00:43
      773000 -- [-992.386] (-997.627) (-996.446) (-991.556) * (-998.328) [-994.840] (-994.093) (-1004.869) -- 0:00:43
      773500 -- (-995.096) (-1003.835) (-995.440) [-992.407] * (-996.747) [-993.012] (-996.422) (-997.791) -- 0:00:43
      774000 -- (-1000.080) (-998.975) (-998.693) [-993.947] * [-999.754] (-992.261) (-991.316) (-996.895) -- 0:00:43
      774500 -- [-989.021] (-995.105) (-989.204) (-998.932) * (-999.722) (-1000.068) [-993.804] (-995.387) -- 0:00:43
      775000 -- (-993.833) (-1010.496) [-994.677] (-994.011) * [-991.650] (-1000.598) (-991.719) (-997.645) -- 0:00:43

      Average standard deviation of split frequencies: 0.000304

      775500 -- (-999.568) [-994.051] (-997.139) (-992.149) * (-997.171) [-999.723] (-993.439) (-995.941) -- 0:00:43
      776000 -- (-993.228) [-999.009] (-994.219) (-1002.496) * (-994.105) (-1000.371) (-993.733) [-991.747] -- 0:00:43
      776500 -- (-994.583) [-994.427] (-995.337) (-1009.921) * [-997.967] (-995.644) (-996.027) (-995.597) -- 0:00:43
      777000 -- (-992.822) (-993.631) [-992.437] (-1002.433) * (-1000.261) (-1000.270) [-999.653] (-994.460) -- 0:00:43
      777500 -- (-1000.611) (-996.193) (-993.914) [-993.342] * [-994.660] (-1000.613) (-993.957) (-996.307) -- 0:00:42
      778000 -- (-990.585) (-991.955) (-996.639) [-996.118] * (-998.420) [-993.301] (-991.145) (-994.199) -- 0:00:42
      778500 -- (-991.500) (-995.321) [-997.097] (-993.602) * (-999.782) (-996.024) [-995.033] (-997.787) -- 0:00:42
      779000 -- (-995.922) (-989.413) (-1000.061) [-991.738] * (-993.579) [-994.277] (-996.041) (-996.541) -- 0:00:42
      779500 -- [-994.978] (-993.598) (-993.930) (-995.332) * (-992.690) (-994.084) (-994.608) [-994.582] -- 0:00:42
      780000 -- [-995.937] (-998.700) (-990.348) (-1003.800) * (-994.490) (-994.351) [-998.689] (-995.568) -- 0:00:42

      Average standard deviation of split frequencies: 0.000000

      780500 -- (-994.730) (-993.726) (-994.875) [-992.741] * [-992.592] (-993.722) (-992.783) (-990.871) -- 0:00:42
      781000 -- [-992.824] (-995.366) (-992.544) (-999.990) * [-990.100] (-996.226) (-996.757) (-1000.629) -- 0:00:42
      781500 -- [-998.741] (-996.971) (-997.830) (-996.057) * (-1002.233) [-995.257] (-992.707) (-995.973) -- 0:00:42
      782000 -- (-991.208) [-991.886] (-1001.521) (-995.818) * (-995.213) (-994.541) (-993.765) [-998.732] -- 0:00:42
      782500 -- (-994.844) (-996.907) [-994.636] (-997.949) * (-998.997) [-991.206] (-993.024) (-990.800) -- 0:00:41
      783000 -- (-995.462) [-994.227] (-992.346) (-994.334) * [-998.586] (-991.232) (-992.349) (-991.363) -- 0:00:41
      783500 -- (-996.787) (-993.419) (-996.933) [-989.323] * (-994.740) (-990.917) (-1001.089) [-992.501] -- 0:00:41
      784000 -- (-998.954) [-992.161] (-989.863) (-989.689) * [-992.960] (-992.574) (-993.040) (-1001.758) -- 0:00:41
      784500 -- (-995.246) (-995.290) (-995.385) [-994.033] * (-1001.089) [-992.851] (-1005.668) (-996.093) -- 0:00:41
      785000 -- (-995.096) [-997.634] (-995.015) (-995.750) * (-994.847) (-1001.304) (-999.852) [-989.987] -- 0:00:41

      Average standard deviation of split frequencies: 0.000000

      785500 -- (-999.590) [-997.223] (-994.936) (-995.016) * (-999.426) [-993.968] (-1000.349) (-993.444) -- 0:00:41
      786000 -- [-991.231] (-995.001) (-991.166) (-997.024) * (-998.242) (-997.205) (-1001.402) [-994.408] -- 0:00:41
      786500 -- (-997.956) (-1004.030) [-991.338] (-991.318) * (-1002.577) [-993.530] (-993.437) (-992.768) -- 0:00:40
      787000 -- (-995.037) (-1006.709) (-994.797) [-991.502] * (-992.749) (-999.585) [-993.557] (-997.017) -- 0:00:41
      787500 -- (-995.830) (-1002.290) (-991.531) [-997.988] * (-993.986) (-10