--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Nov 17 16:51:53 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/100/CG2034-PB/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2621.36 -2634.89 2 -2621.59 -2637.33 -------------------------------------- TOTAL -2621.47 -2636.72 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.779663 0.006734 0.629642 0.943847 0.773218 1203.55 1352.28 1.001 r(A<->C){all} 0.086651 0.000400 0.051370 0.128583 0.085229 1218.04 1230.31 1.000 r(A<->G){all} 0.238300 0.001321 0.173523 0.312639 0.235503 614.91 777.70 1.000 r(A<->T){all} 0.197501 0.001655 0.120352 0.277447 0.195508 929.44 932.23 1.000 r(C<->G){all} 0.044300 0.000146 0.020022 0.067380 0.043567 961.68 1064.80 1.000 r(C<->T){all} 0.324947 0.001799 0.242997 0.409177 0.323865 889.23 944.60 1.000 r(G<->T){all} 0.108302 0.000646 0.062211 0.160564 0.106249 673.98 728.17 1.000 pi(A){all} 0.221604 0.000168 0.196999 0.247555 0.221297 1155.00 1307.61 1.000 pi(C){all} 0.329344 0.000222 0.302974 0.360473 0.329315 1342.36 1359.13 1.000 pi(G){all} 0.278205 0.000209 0.252199 0.307758 0.277970 1081.96 1119.08 1.000 pi(T){all} 0.170846 0.000137 0.147577 0.192946 0.170569 936.55 1014.05 1.000 alpha{1,2} 0.134058 0.001498 0.052669 0.210920 0.134628 1108.09 1192.13 1.000 alpha{3} 2.319434 0.740613 1.004297 4.143426 2.182697 989.25 1180.87 1.000 pinvar{all} 0.188331 0.008083 0.004948 0.336468 0.192165 996.61 1205.45 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2332.085329 Model 2: PositiveSelection -2331.58815 Model 0: one-ratio -2363.002381 Model 3: discrete -2331.539283 Model 7: beta -2332.170787 Model 8: beta&w>1 -2330.454256 Model 0 vs 1 61.83410399999957 Model 2 vs 1 0.9943579999999201 Model 8 vs 7 3.4330620000000636
>C1 MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYANNNTGSTTDSNSTGFNVILPTLADLLCYQTPAFI FGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCEYLAELVLRLESD KLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLPAGASPKQPSPEA EQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSEGNIIYTPDADDD FDEEDPDEDLCIoooooooooooo >C2 MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYANNNTGSTTDSNFTGFNVILPTLADLLCYQTPAFI FGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCEYLAELVLRLETD KLLSLISRKPGGGVTNRRYSCEVSKTQFKVTPLDGGRPAGASSKQPSPEA EQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPEGNIIYTPDADDD FDEEDPDEDLCIoooooooooooo >C3 MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYANNNTGSTTDPNFTGFNVILPTLADLLCYQTPAFI FGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCEYLAELVLRLESD KLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLPAGASPKQPSPEA EQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPEGNIIYTPDADDD FDEEDPDEDLCIoooooooooooo >C4 MLSNLVVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV SLKHVATFEALITECANTKNNNTASSPRSKSTGFNVILPTLADLLCYQTP AFIFGFLNRLRRSENVCRVFLWASPQHLQNPHADYILAGCEYLAELVLRL ESDKLLSLISRKPGGGVSNRRYSCQVSKTSFQVTPLDGGLPAGASPKQPS PESEQTPEPASSTFKIELDEDEVVARNALTLPYERTCEPSEGNIIYTPDA DDDFDEEDPDEDLCIooooooooo >C5 MLSNLLVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV SLKHVATFEALIGECANHKNNNTGSIPGSKATGFNVILPTLADLLCYQTP AFIFGFLNRLRRSENVCRVFLWASPQHLQNPHAEYILAGCEYLAELVLRL ESDKLLSLISRKPGGAVSNKRYSCQVSKTFFQVTPLDGGLPAGGSPKQPS PETEQTPEPASSTFKIELDEDEVMARNALTLPYERTCEPSEGNIIYTPDA DDDFDEEDPDEDLCIooooooooo >C6 MLSNLLVTKQKLVLVIDKLNRERIAPKFIGSLLHEQGQGTETIKALPTGV SLKLVATFEALLSECANQNNNNNTAGTPGSGAGKPAGFNVILPTLADLLC YQSPAFIFGFLNRLRRSEHVRRVFLWASPQHLQHPHAEYILAGCEYLAEL VLRLETDKQLSLISRKPGGGVTNRRFACQISKTEFQVTPLDEGQPAGASP KQSSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPTEGNIIY TPDADDDFDEEDPDEDLCIooooo >C7 MLSNLLVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGTETIKTLPTGI SLKHVATFEALIAECANQNNTGKPSGFNVILPTLADLLCYQSPAFIFSFL NRLRRSEHVRRVFLWASPQHLQHPHADYILAGCEYLAELVLRLETDKLLS LISRKPGGGVSNRRFACQVSKTQFQVTPLDEGLPTGVSPKQPTPEAEQTP EPASSTFKIELDEDEMVARNALTLPYERTSEPTEGNIIYTPDADDDFDEE DPDEDLCIoooooooooooooooo >C8 MLSNLVVTNQKVVLIIDELNRERIAPKFIGSLLHEQGQGTDTIKALPTGV SLKHVATFESLIDECANHNNNNTPAGEVGDVDAVTPGSKSTGFNVILPTL ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPHHLQHPHAAYILAGCE YLAKLVLRLETDKLLSIISRKPGGGVTNRRFSCQVSKTQFLVTPVDGGLP AGVSPKQPSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPSE GNIIYTPDADDDFDEEDPDEDLCI CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=290 C1 MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV C2 MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV C3 MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV C4 MLSNLVVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV C5 MLSNLLVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV C6 MLSNLLVTKQKLVLVIDKLNRERIAPKFIGSLLHEQGQGTETIKALPTGV C7 MLSNLLVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGTETIKTLPTGI C8 MLSNLVVTNQKVVLIIDELNRERIAPKFIGSLLHEQGQGTDTIKALPTGV *****:**:**:**:**:*********************::***:****: C1 SLKHVATFEALIDKYAN---NNTGS---------TTDSNSTGFNVILPTL C2 SLKHVATFEALIDKYAN---NNTGS---------TTDSNFTGFNVILPTL C3 SLKHVATFEALIDKYAN---NNTGS---------TTDPNFTGFNVILPTL C4 SLKHVATFEALITECANTKNNNTAS---------SPRSKSTGFNVILPTL C5 SLKHVATFEALIGECANHKNNNTGS---------IPGSKATGFNVILPTL C6 SLKLVATFEALLSECANQNNNNNTAGTPG-----SGAGKPAGFNVILPTL C7 SLKHVATFEALIAECANQNN----------------TGKPSGFNVILPTL C8 SLKHVATFESLIDECANHNNNNTPAGEVGDVDAVTPGSKSTGFNVILPTL *** *****:*: : ** : :********* C1 ADLLCYQTPAFIFGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCE C2 ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE C3 ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE C4 ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHADYILAGCE C5 ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHAEYILAGCE C6 ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPQHLQHPHAEYILAGCE C7 ADLLCYQSPAFIFSFLNRLRRSEHVRRVFLWASPQHLQHPHADYILAGCE C8 ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPHHLQHPHAAYILAGCE *******:*****.********::* ********:***.*** ******* C1 YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP C2 YLAELVLRLETDKLLSLISRKPGGGVTNRRYSCEVSKTQFKVTPLDGGRP C3 YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP C4 YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCQVSKTSFQVTPLDGGLP C5 YLAELVLRLESDKLLSLISRKPGGAVSNKRYSCQVSKTFFQVTPLDGGLP C6 YLAELVLRLETDKQLSLISRKPGGGVTNRRFACQISKTEFQVTPLDEGQP C7 YLAELVLRLETDKLLSLISRKPGGGVSNRRFACQVSKTQFQVTPLDEGLP C8 YLAKLVLRLETDKLLSIISRKPGGGVTNRRFSCQVSKTQFLVTPVDGGLP ***:******:** **:*******.*:*:*::*::*** * ***:* * * C1 AGASPKQPSPEAEQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSE C2 AGASSKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE C3 AGASPKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE C4 AGASPKQPSPESEQTPEPASSTFKIELDEDEVVARNALTLPYERTCEPSE C5 AGGSPKQPSPETEQTPEPASSTFKIELDEDEVMARNALTLPYERTCEPSE C6 AGASPKQSSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPTE C7 TGVSPKQPTPEAEQTPEPASSTFKIELDEDEMVARNALTLPYERTSEPTE C8 AGVSPKQPSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPSE :* *.**.:**:***.***************::************.**.* C1 GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo---- C2 GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo---- C3 GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo---- C4 GNIIYTPDADDDFDEEDPDEDLCIooooooooo------- C5 GNIIYTPDADDDFDEEDPDEDLCIooooooooo------- C6 GNIIYTPDADDDFDEEDPDEDLCIooooo----------- C7 GNIIYTPDADDDFDEEDPDEDLCIoooooooooooooooo C8 GNIIYTPDADDDFDEEDPDEDLCI---------------- ************************ PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 8 SEQUENCES [PROTEIN] Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 274 type PROTEIN Struct Unchecked Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21128] Library Relaxation: Multi_proc [72] Relaxation Summary: [21128]--->[18506] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.464 Mb, Max= 31.039 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYAN---NNTGS---------TTDSNSTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCE YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP AGASPKQPSPEAEQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSE GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo---- >C2 MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYAN---NNTGS---------TTDSNFTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE YLAELVLRLETDKLLSLISRKPGGGVTNRRYSCEVSKTQFKVTPLDGGRP AGASSKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo---- >C3 MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYAN---NNTGS---------TTDPNFTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP AGASPKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo---- >C4 MLSNLVVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV SLKHVATFEALITECANTKNNNTAS---------SPRSKSTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHADYILAGCE YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCQVSKTSFQVTPLDGGLP AGASPKQPSPESEQTPEPASSTFKIELDEDEVVARNALTLPYERTCEPSE GNIIYTPDADDDFDEEDPDEDLCIooooooooo------- >C5 MLSNLLVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV SLKHVATFEALIGECANHKNNNTGS---------IPGSKATGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHAEYILAGCE YLAELVLRLESDKLLSLISRKPGGAVSNKRYSCQVSKTFFQVTPLDGGLP AGGSPKQPSPETEQTPEPASSTFKIELDEDEVMARNALTLPYERTCEPSE GNIIYTPDADDDFDEEDPDEDLCIooooooooo------- >C6 MLSNLLVTKQKLVLVIDKLNRERIAPKFIGSLLHEQGQGTETIKALPTGV SLKLVATFEALLSECANQNNNNNTAGTPG-----SGAGKPAGFNVILPTL ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPQHLQHPHAEYILAGCE YLAELVLRLETDKQLSLISRKPGGGVTNRRFACQISKTEFQVTPLDEGQP AGASPKQSSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPTE GNIIYTPDADDDFDEEDPDEDLCIooooo----------- >C7 MLSNLLVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGTETIKTLPTGI SLKHVATFEALIAECANQNN----------------TGKPSGFNVILPTL ADLLCYQSPAFIFSFLNRLRRSEHVRRVFLWASPQHLQHPHADYILAGCE YLAELVLRLETDKLLSLISRKPGGGVSNRRFACQVSKTQFQVTPLDEGLP TGVSPKQPTPEAEQTPEPASSTFKIELDEDEMVARNALTLPYERTSEPTE GNIIYTPDADDDFDEEDPDEDLCIoooooooooooooooo >C8 MLSNLVVTNQKVVLIIDELNRERIAPKFIGSLLHEQGQGTDTIKALPTGV SLKHVATFESLIDECANHNNNNTPAGEVGDVDAVTPGSKSTGFNVILPTL ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPHHLQHPHAAYILAGCE YLAKLVLRLETDKLLSIISRKPGGGVTNRRFSCQVSKTQFLVTPVDGGLP AGVSPKQPSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPSE GNIIYTPDADDDFDEEDPDEDLCI---------------- FORMAT of file /tmp/tmp7865505796080635989aln Not Supported[FATAL:T-COFFEE] >C1 MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYAN---NNTGS---------TTDSNSTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCE YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP AGASPKQPSPEAEQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSE GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo---- >C2 MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYAN---NNTGS---------TTDSNFTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE YLAELVLRLETDKLLSLISRKPGGGVTNRRYSCEVSKTQFKVTPLDGGRP AGASSKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo---- >C3 MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYAN---NNTGS---------TTDPNFTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP AGASPKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo---- >C4 MLSNLVVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV SLKHVATFEALITECANTKNNNTAS---------SPRSKSTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHADYILAGCE YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCQVSKTSFQVTPLDGGLP AGASPKQPSPESEQTPEPASSTFKIELDEDEVVARNALTLPYERTCEPSE GNIIYTPDADDDFDEEDPDEDLCIooooooooo------- >C5 MLSNLLVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV SLKHVATFEALIGECANHKNNNTGS---------IPGSKATGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHAEYILAGCE YLAELVLRLESDKLLSLISRKPGGAVSNKRYSCQVSKTFFQVTPLDGGLP AGGSPKQPSPETEQTPEPASSTFKIELDEDEVMARNALTLPYERTCEPSE GNIIYTPDADDDFDEEDPDEDLCIooooooooo------- >C6 MLSNLLVTKQKLVLVIDKLNRERIAPKFIGSLLHEQGQGTETIKALPTGV SLKLVATFEALLSECANQNNNNNTAGTPG-----SGAGKPAGFNVILPTL ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPQHLQHPHAEYILAGCE YLAELVLRLETDKQLSLISRKPGGGVTNRRFACQISKTEFQVTPLDEGQP AGASPKQSSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPTE GNIIYTPDADDDFDEEDPDEDLCIooooo----------- >C7 MLSNLLVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGTETIKTLPTGI SLKHVATFEALIAECANQNN----------------TGKPSGFNVILPTL ADLLCYQSPAFIFSFLNRLRRSEHVRRVFLWASPQHLQHPHADYILAGCE YLAELVLRLETDKLLSLISRKPGGGVSNRRFACQVSKTQFQVTPLDEGLP TGVSPKQPTPEAEQTPEPASSTFKIELDEDEMVARNALTLPYERTSEPTE GNIIYTPDADDDFDEEDPDEDLCIoooooooooooooooo >C8 MLSNLVVTNQKVVLIIDELNRERIAPKFIGSLLHEQGQGTDTIKALPTGV SLKHVATFESLIDECANHNNNNTPAGEVGDVDAVTPGSKSTGFNVILPTL ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPHHLQHPHAAYILAGCE YLAKLVLRLETDKLLSIISRKPGGGVTNRRFSCQVSKTQFLVTPVDGGLP AGVSPKQPSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPSE GNIIYTPDADDDFDEEDPDEDLCI---------------- input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:290 S:94 BS:290 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # SEQ_INDEX C8 7 # PW_SEQ_DISTANCES BOT 0 1 96.72 C1 C2 96.72 TOP 1 0 96.72 C2 C1 96.72 BOT 0 2 97.81 C1 C3 97.81 TOP 2 0 97.81 C3 C1 97.81 BOT 0 3 92.62 C1 C4 92.62 TOP 3 0 92.62 C4 C1 92.62 BOT 0 4 90.77 C1 C5 90.77 TOP 4 0 90.77 C5 C1 90.77 BOT 0 5 85.02 C1 C6 85.02 TOP 5 0 85.02 C6 C1 85.02 BOT 0 6 88.39 C1 C7 88.39 TOP 6 0 88.39 C7 C1 88.39 BOT 0 7 89.31 C1 C8 89.31 TOP 7 0 89.31 C8 C1 89.31 BOT 1 2 98.18 C2 C3 98.18 TOP 2 1 98.18 C3 C2 98.18 BOT 1 3 90.77 C2 C4 90.77 TOP 3 1 90.77 C4 C2 90.77 BOT 1 4 89.30 C2 C5 89.30 TOP 4 1 89.30 C5 C2 89.30 BOT 1 5 85.77 C2 C6 85.77 TOP 5 1 85.77 C6 C2 85.77 BOT 1 6 88.01 C2 C7 88.01 TOP 6 1 88.01 C7 C2 88.01 BOT 1 7 89.69 C2 C8 89.69 TOP 7 1 89.69 C8 C2 89.69 BOT 2 3 91.88 C3 C4 91.88 TOP 3 2 91.88 C4 C3 91.88 BOT 2 4 90.41 C3 C5 90.41 TOP 4 2 90.41 C5 C3 90.41 BOT 2 5 85.39 C3 C6 85.39 TOP 5 2 85.39 C6 C3 85.39 BOT 2 6 88.76 C3 C7 88.76 TOP 6 2 88.76 C7 C3 88.76 BOT 2 7 89.31 C3 C8 89.31 TOP 7 2 89.31 C8 C3 89.31 BOT 3 4 94.89 C4 C5 94.89 TOP 4 3 94.89 C5 C4 94.89 BOT 3 5 86.67 C4 C6 86.67 TOP 5 3 86.67 C6 C4 86.67 BOT 3 6 89.14 C4 C7 89.14 TOP 6 3 89.14 C7 C4 89.14 BOT 3 7 89.43 C4 C8 89.43 TOP 7 3 89.43 C8 C4 89.43 BOT 4 5 85.56 C5 C6 85.56 TOP 5 4 85.56 C6 C5 85.56 BOT 4 6 88.01 C5 C7 88.01 TOP 6 4 88.01 C7 C5 88.01 BOT 4 7 88.30 C5 C8 88.30 TOP 7 4 88.30 C8 C5 88.30 BOT 5 6 92.02 C6 C7 92.02 TOP 6 5 92.02 C7 C6 92.02 BOT 5 7 86.62 C6 C8 86.62 TOP 7 5 86.62 C8 C6 86.62 BOT 6 7 89.53 C7 C8 89.53 TOP 7 6 89.53 C8 C7 89.53 AVG 0 C1 * 91.52 AVG 1 C2 * 91.21 AVG 2 C3 * 91.68 AVG 3 C4 * 90.77 AVG 4 C5 * 89.61 AVG 5 C6 * 86.72 AVG 6 C7 * 89.12 AVG 7 C8 * 88.89 TOT TOT * 89.94 CLUSTAL W (1.83) multiple sequence alignment C1 ATGCTCTCCAACCTGGTGGTGACCAAGCAGAAAGTGGTCCTCGTAATAGA C2 ATGCTCTCCAACCTGGTGGTCACCAAGCAGAAAGTGGTCCTCATAATAGA C3 ATGCTCTCCAACCTGGTGGTCACCAAGCAGAAAGTGGTCCTCATAATAGA C4 ATGCTCTCCAACCTGGTGGTGACCAATCAGAAAGTGGTCCTCGTAATAGA C5 ATGCTCTCCAACCTGTTGGTGACCAATCAGAAAGTGGTCCTCGTTATAGA C6 ATGCTCTCCAACCTGCTGGTGACCAAACAAAAGCTGGTCCTCGTAATAGA C7 ATGCTCTCCAACCTGCTGGTGACCAAACAAAAAGTGGTCCTCGTAATAGA C8 ATGCTTTCAAATCTTGTGGTGACCAATCAAAAAGTGGTCCTCATAATAGA ***** **.** ** **** ***** **.**. ********.*:***** C1 TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGTCTGCTGC C2 TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC C3 TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC C4 TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGTCTGCTGC C5 TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC C6 TAAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC C7 TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC C8 TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCTTGCTTC *.**************************************** **** * C1 ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTGCCCACCGGCGTC C2 ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTCCCCACCGGCGTC C3 ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTCCCCACCGGCGTC C4 ACGAGCAGGGACAGGGGGCGGAAACCATCAAGGCCCTGCCCACCGGCGTC C5 ACGAGCAGGGACAGGGGGCGGAAACTATCAAGGCCCTGCCCACCGGCGTC C6 ACGAGCAGGGCCAGGGGACGGAGACCATCAAGGCCCTGCCCACCGGCGTC C7 ACGAACAGGGCCAGGGGACGGAGACCATCAAGACCCTGCCCACCGGCATC C8 ACGAACAGGGACAGGGGACAGATACAATCAAGGCCTTGCCCACCGGCGTC ****.*****.******.*.** ** ******.** * *********.** C1 AGCCTTAAGCACGTGGCCACCTTCGAGGCACTGATCGACAAGTACGCCAA C2 AGCCTGAAGCACGTGGCCACCTTTGAGGCACTGATCGACAAGTACGCCAA C3 AGCCTGAAGCACGTGGCCACCTTCGAGGCACTGATCGACAAGTACGCCAA C4 AGCCTGAAGCACGTGGCCACCTTCGAGGCGCTGATCACCGAGTGCGCCAA C5 AGTCTGAAGCACGTGGCCACCTTCGAGGCGCTGATTGGCGAGTGCGCCAA C6 AGCCTCAAGCTCGTGGCCACCTTCGAGGCGCTGCTCTCGGAGTGCGCCAA C7 AGCCTGAAGCACGTGGCCACCTTCGAGGCACTGATCGCCGAGTGCGCCAA C8 AGTCTGAAGCACGTGGCCACCTTCGAATCGCTGATCGACGAGTGCGCCAA ** ** ****:************ **. *.***.* .***.****** C1 C---------AACAACACTGGGAGT------------------------- C2 C---------AACAACACTGGGAGT------------------------- C3 C---------AACAACACTGGGAGT------------------------- C4 CACCAAAAACAACAACACTGCGAGC------------------------- C5 CCACAAAAACAACAACACTGGGAGC------------------------- C6 CCAAAACAACAACAACAACACTGCGGGCACTCCGGGC------------- C7 CCAAAACAAC---------------------------------------- C8 CCATAACAACAACAACACCCCTGCCGGAGAAGTGGGCGACGTGGATGCGG * C1 --ACTACGGATTCCAACTCCACTGGCTTTAACGTCATCCTGCCAACATTG C2 --ACTACGGATTCCAACTTCACTGGCTTTAACGTCATCCTGCCCACATTG C3 --ACTACGGATCCCAACTTCACTGGCTTTAACGTCATCCTGCCCACATTG C4 --AGTCCTCGCTCGAAATCCACTGGCTTCAACGTCATCCTGCCCACCTTG C5 --ATTCCGGGATCCAAAGCCACTGGCTTCAACGTCATCCTGCCCACCTTG C6 --TCAGGAGCAGGAAAGCCCGCCGGTTTCAACGTCATCCTGCCCACACTG C7 --------ACAGGGAAACCCTCCGGCTTCAACGTCATCCTGCCCACACTG C8 TTACTCCGGGATCGAAATCTACCGGCTTCAACGTCATCCTGCCCACCTTG ** * ** ** **************.**. ** C1 GCAGACCTGCTGTGCTACCAGACGCCTGCTTTCATATTTGGCTTCCTCAA C2 GCCGACCTGCTGTGCTACCAGACGCCCGCTTTCATATTTGGCTTTCTCAA C3 GCCGACCTGCTGTGCTACCAGACGCCCGCTTTCATATTTGGCTTCCTCAA C4 GCCGATCTGCTGTGCTACCAGACGCCCGCTTTCATCTTTGGCTTCCTCAA C5 GCCGACCTGCTGTGCTACCAGACGCCCGCCTTCATCTTTGGCTTCCTCAA C6 GCCGACCTGCTGTGCTACCAGTCGCCCGCCTTCATCTTTGGCTTCCTCAA C7 GCCGACCTGCTGTGCTACCAGTCGCCCGCCTTTATCTTTAGCTTCCTCAA C8 GCTGACCTGCTGTGCTATCAGTCGCCCGCTTTTATTTTTGGCTTCCTTAA ** ** *********** ***:**** ** ** ** ***.**** ** ** C1 CCGCCTACGCCGCTCGGACAATGTGCGTCGGGTTTTCCTTTGGGCCTCCC C2 CCGCCTACGACGCTCGGAAAATGTGCGTCGGGTGTTCCTTTGGGCCTCCC C3 CCGCCTACGACGCTCGGAAAATGTGCGTCGGGTGTTCCTTTGGGCCTCCC C4 CCGCCTGCGGCGCTCGGAGAATGTGTGCCGTGTGTTCCTGTGGGCCTCCC C5 CCGCCTGCGGCGCTCGGAGAACGTGTGCCGCGTGTTCCTGTGGGCCTCCC C6 CCGCCTGCGTCGTTCGGAGCACGTGCGTCGTGTGTTCCTCTGGGCCTCCC C7 CCGCCTGCGTCGCTCGGAGCACGTGCGTCGTGTGTTCCTCTGGGCCTCCC C8 CCGCCTACGTCGCTCGGAGCATGTGCGTCGAGTGTTCCTCTGGGCTTCCC ******.** ** ***** .* *** * ** ** ***** ***** **** C1 CGCAGCACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG C2 CGCAACACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG C3 CGCAGCACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG C4 CGCAGCACCTACAGAATCCCCATGCCGACTACATCCTGGCGGGCTGCGAG C5 CACAACACTTACAGAATCCCCATGCCGAATACATCCTGGCTGGCTGCGAG C6 CGCAGCACCTGCAGCATCCGCATGCGGAGTACATCCTGGCTGGCTGCGAG C7 CGCAGCACCTCCAGCATCCCCATGCCGACTACATCCTGGCTGGCTGCGAG C8 CGCACCATCTGCAGCATCCTCATGCTGCCTACATTCTGGCTGGCTGCGAA *.** ** * *** **** ***** *. ***** ***** ********. C1 TACCTGGCCGAGCTGGTCCTCCGACTGGAATCGGACAAACTACTCTCGCT C2 TACCTGGCCGAGCTGGTCCTCCGACTGGAAACGGACAAACTACTCTCGCT C3 TACCTGGCCGAGCTGGTCCTCCGACTGGAATCGGACAAACTACTCTCGCT C4 TACCTGGCCGAGTTGGTCCTACGACTAGAATCCGACAAATTACTCTCACT C5 TACCTGGCCGAGTTGGTCCTACGACTGGAATCCGACAAATTACTCTCGCT C6 TACCTGGCGGAGTTGGTCCTTCGCCTGGAGACGGACAAGCAACTATCGCT C7 TACCTGGCGGAGCTGGTGCTTCGCCTGGAGACGGACAAGCTACTATCACT C8 TACTTGGCCAAGTTGGTGCTCCGCTTGGAAACAGACAAGCTACTGTCCAT *** **** .** **** ** **. *.**.:* *****. :*** ** .* C1 GATATCACGCAAGCCGGGCGGAGGGGTGTCCAACAGGCGCTACTCCTGCG C2 GATATCACGCAAGCCGGGTGGAGGGGTGACCAACAGGCGCTACTCCTGCG C3 GATATCACGCAAGCCGGGCGGAGGGGTGTCCAACAGGCGCTACTCCTGCG C4 GATTTCAAGAAAGCCGGGCGGTGGGGTGTCCAACAGGCGCTACTCCTGCC C5 GATTTCACGCAAGCCGGGCGGTGCGGTGTCCAACAAGCGCTACTCCTGCC C6 GATATCGCGTAAACCCGGTGGCGGAGTGACCAACAGGCGCTTCGCCTGCC C7 GATATCGCGCAAACCCGGTGGCGGGGTGTCCAACAGGCGGTTCGCCTGCC C8 AATATCACGCAAGCCGGGCGGAGGAGTTACAAACAGACGCTTCTCATGCC .**:**..* **.** ** ** * .** :*.****..** *:* *.*** C1 AAGTCAGCAAAACCCAGTTCAAGGTGACGCCGCTGGACGGAGGACTGCCT C2 AAGTCAGCAAAACCCAATTTAAGGTGACGCCGCTTGACGGAGGACGTCCT C3 AAGTCAGCAAAACCCAGTTCAAGGTGACGCCGCTGGACGGAGGACTTCCT C4 AAGTCAGCAAAACCTCTTTCCAGGTAACGCCGCTGGACGGAGGACTACCT C5 AAGTCAGCAAAACCTTTTTCCAGGTGACGCCGCTGGACGGAGGGCTACCT C6 AGATCAGCAAGACCGAGTTCCAGGTGACGCCGCTGGACGAAGGACAGCCC C7 AGGTCAGCAAGACCCAGTTCCAGGTGACGCCGCTTGACGAAGGGCTGCCC C8 AGGTCAGCAAAACCCAGTTCCTGGTGACGCCGGTGGACGGAGGACTCCCG *..*******.*** ** .:***.****** * ****.***.* ** C1 GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCACAGA C2 GCAGGTGCCTCCTCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCCCAGA C3 GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCCCAGA C4 GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAATCGGAGCAGACCCCAGA C5 GCAGGTGGCTCCCCCAAGCAGCCCTCGCCCGAGACGGAGCAGACCCCAGA C6 GCAGGAGCCTCACCCAAACAGTCTTCCCCGGAGGCGGAGCAAACCCCAGA C7 ACAGGTGTCTCACCCAAACAGCCTACCCCGGAGGCGGAGCAAACCCCAGA C8 GCAGGTGTCTCTCCCAAGCAGCCCTCGCCAGAGGCAGAGCAAACCCCAGA .****:* *** ****.*** * :* ** **. *.*****.***.**** C1 GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAAGTGTTGG C2 GCCGGCCAGCAGCACCTTTAAAATCGAGCTTGACGAGGATGAAGTGCTGG C3 GCCGGCCAGCAGCACCTTTAAAATCGAGCTTGACGAGGATGAAGTGCTGG C4 GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAAGTGGTGG C5 GCCGGCCAGCAGCACCTTCAAAATCGAACTTGACGAGGATGAAGTGATGG C6 GCCGGCCAGCAGCACCTTCAAAATCGAGCTCGACGAGGACGAGGTGGTGG C7 GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAGATGGTGG C8 ACCGGCCAGCAGCACCTTTAAGATCGAGCTCGACGAGGATGAAGTGGTTG .***************** **.*****.** ******** **..** * * C1 CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGTCTGAG C2 CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGCCTGAG C3 CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGCCTGAG C4 CCCGCAATGCACTCACCCTTCCATACGAACGCACATGCGAACCGTCTGAG C5 CCCGCAATGCACTCACCCTGCCATACGAACGCACGTGCGAGCCGTCTGAG C6 CCCGCAATGCACTCACCCTGCCATACGAACGCACCAGCGAGCCGACCGAG C7 CCCGCAATGCACTCACCCTGCCATATGAACGCACCAGCGAGCCGACTGAG C8 CTCGCAATGCACTTACCCTGCCATACGAACGCACAAGCGAGCCGTCCGAG * *********** ***** ***** ******** : ***.*** * *** C1 GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA C2 GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA C3 GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA C4 GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA C5 GGAAACATAATATACACGCCCGATGCCGACGATGATTTCGACGAGGAGGA C6 GGCAACATTATATACACACCCGATGCCGACGACGACTTCGACGAGGAGGA C7 GGCAACATCATATACACACCCGATGCTGACGACGACTTCGATGAGGAGGA C8 GGAAACATTATATACACGCCCGATGCCGACGACGACTTTGATGAGGAGGA **.***** ********.******** ***** ** ** ** ******** C1 TCCGGACGAGGATCTGTGCATC---------------------------- C2 TCCGGACGAGGATCTGTGCATC---------------------------- C3 TCCGGACGAGGATCTGTGCATC---------------------------- C4 TCCGGACGAGGATCTGTGCATC---------------------------- C5 TCCGGACGAGGATCTGTGCATC---------------------------- C6 TCCGGACGAGGATCTGTGCATC---------------------------- C7 TCCGGACGAGGATCTGTGCATC---------------------------- C8 TCCTGACGAGGATCTGTGCATC---------------------------- *** ****************** C1 -------------------- C2 -------------------- C3 -------------------- C4 -------------------- C5 -------------------- C6 -------------------- C7 -------------------- C8 -------------------- >C1 ATGCTCTCCAACCTGGTGGTGACCAAGCAGAAAGTGGTCCTCGTAATAGA TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGTCTGCTGC ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTGCCCACCGGCGTC AGCCTTAAGCACGTGGCCACCTTCGAGGCACTGATCGACAAGTACGCCAA C---------AACAACACTGGGAGT------------------------- --ACTACGGATTCCAACTCCACTGGCTTTAACGTCATCCTGCCAACATTG GCAGACCTGCTGTGCTACCAGACGCCTGCTTTCATATTTGGCTTCCTCAA CCGCCTACGCCGCTCGGACAATGTGCGTCGGGTTTTCCTTTGGGCCTCCC CGCAGCACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG TACCTGGCCGAGCTGGTCCTCCGACTGGAATCGGACAAACTACTCTCGCT GATATCACGCAAGCCGGGCGGAGGGGTGTCCAACAGGCGCTACTCCTGCG AAGTCAGCAAAACCCAGTTCAAGGTGACGCCGCTGGACGGAGGACTGCCT GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCACAGA GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAAGTGTTGG CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGTCTGAG GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA TCCGGACGAGGATCTGTGCATC---------------------------- -------------------- >C2 ATGCTCTCCAACCTGGTGGTCACCAAGCAGAAAGTGGTCCTCATAATAGA TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTCCCCACCGGCGTC AGCCTGAAGCACGTGGCCACCTTTGAGGCACTGATCGACAAGTACGCCAA C---------AACAACACTGGGAGT------------------------- --ACTACGGATTCCAACTTCACTGGCTTTAACGTCATCCTGCCCACATTG GCCGACCTGCTGTGCTACCAGACGCCCGCTTTCATATTTGGCTTTCTCAA CCGCCTACGACGCTCGGAAAATGTGCGTCGGGTGTTCCTTTGGGCCTCCC CGCAACACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG TACCTGGCCGAGCTGGTCCTCCGACTGGAAACGGACAAACTACTCTCGCT GATATCACGCAAGCCGGGTGGAGGGGTGACCAACAGGCGCTACTCCTGCG AAGTCAGCAAAACCCAATTTAAGGTGACGCCGCTTGACGGAGGACGTCCT GCAGGTGCCTCCTCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCCCAGA GCCGGCCAGCAGCACCTTTAAAATCGAGCTTGACGAGGATGAAGTGCTGG CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGCCTGAG GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA TCCGGACGAGGATCTGTGCATC---------------------------- -------------------- >C3 ATGCTCTCCAACCTGGTGGTCACCAAGCAGAAAGTGGTCCTCATAATAGA TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTCCCCACCGGCGTC AGCCTGAAGCACGTGGCCACCTTCGAGGCACTGATCGACAAGTACGCCAA C---------AACAACACTGGGAGT------------------------- --ACTACGGATCCCAACTTCACTGGCTTTAACGTCATCCTGCCCACATTG GCCGACCTGCTGTGCTACCAGACGCCCGCTTTCATATTTGGCTTCCTCAA CCGCCTACGACGCTCGGAAAATGTGCGTCGGGTGTTCCTTTGGGCCTCCC CGCAGCACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG TACCTGGCCGAGCTGGTCCTCCGACTGGAATCGGACAAACTACTCTCGCT GATATCACGCAAGCCGGGCGGAGGGGTGTCCAACAGGCGCTACTCCTGCG AAGTCAGCAAAACCCAGTTCAAGGTGACGCCGCTGGACGGAGGACTTCCT GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCCCAGA GCCGGCCAGCAGCACCTTTAAAATCGAGCTTGACGAGGATGAAGTGCTGG CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGCCTGAG GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA TCCGGACGAGGATCTGTGCATC---------------------------- -------------------- >C4 ATGCTCTCCAACCTGGTGGTGACCAATCAGAAAGTGGTCCTCGTAATAGA TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGTCTGCTGC ACGAGCAGGGACAGGGGGCGGAAACCATCAAGGCCCTGCCCACCGGCGTC AGCCTGAAGCACGTGGCCACCTTCGAGGCGCTGATCACCGAGTGCGCCAA CACCAAAAACAACAACACTGCGAGC------------------------- --AGTCCTCGCTCGAAATCCACTGGCTTCAACGTCATCCTGCCCACCTTG GCCGATCTGCTGTGCTACCAGACGCCCGCTTTCATCTTTGGCTTCCTCAA CCGCCTGCGGCGCTCGGAGAATGTGTGCCGTGTGTTCCTGTGGGCCTCCC CGCAGCACCTACAGAATCCCCATGCCGACTACATCCTGGCGGGCTGCGAG TACCTGGCCGAGTTGGTCCTACGACTAGAATCCGACAAATTACTCTCACT GATTTCAAGAAAGCCGGGCGGTGGGGTGTCCAACAGGCGCTACTCCTGCC AAGTCAGCAAAACCTCTTTCCAGGTAACGCCGCTGGACGGAGGACTACCT GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAATCGGAGCAGACCCCAGA GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAAGTGGTGG CCCGCAATGCACTCACCCTTCCATACGAACGCACATGCGAACCGTCTGAG GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA TCCGGACGAGGATCTGTGCATC---------------------------- -------------------- >C5 ATGCTCTCCAACCTGTTGGTGACCAATCAGAAAGTGGTCCTCGTTATAGA TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC ACGAGCAGGGACAGGGGGCGGAAACTATCAAGGCCCTGCCCACCGGCGTC AGTCTGAAGCACGTGGCCACCTTCGAGGCGCTGATTGGCGAGTGCGCCAA CCACAAAAACAACAACACTGGGAGC------------------------- --ATTCCGGGATCCAAAGCCACTGGCTTCAACGTCATCCTGCCCACCTTG GCCGACCTGCTGTGCTACCAGACGCCCGCCTTCATCTTTGGCTTCCTCAA CCGCCTGCGGCGCTCGGAGAACGTGTGCCGCGTGTTCCTGTGGGCCTCCC CACAACACTTACAGAATCCCCATGCCGAATACATCCTGGCTGGCTGCGAG TACCTGGCCGAGTTGGTCCTACGACTGGAATCCGACAAATTACTCTCGCT GATTTCACGCAAGCCGGGCGGTGCGGTGTCCAACAAGCGCTACTCCTGCC AAGTCAGCAAAACCTTTTTCCAGGTGACGCCGCTGGACGGAGGGCTACCT GCAGGTGGCTCCCCCAAGCAGCCCTCGCCCGAGACGGAGCAGACCCCAGA GCCGGCCAGCAGCACCTTCAAAATCGAACTTGACGAGGATGAAGTGATGG CCCGCAATGCACTCACCCTGCCATACGAACGCACGTGCGAGCCGTCTGAG GGAAACATAATATACACGCCCGATGCCGACGATGATTTCGACGAGGAGGA TCCGGACGAGGATCTGTGCATC---------------------------- -------------------- >C6 ATGCTCTCCAACCTGCTGGTGACCAAACAAAAGCTGGTCCTCGTAATAGA TAAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC ACGAGCAGGGCCAGGGGACGGAGACCATCAAGGCCCTGCCCACCGGCGTC AGCCTCAAGCTCGTGGCCACCTTCGAGGCGCTGCTCTCGGAGTGCGCCAA CCAAAACAACAACAACAACACTGCGGGCACTCCGGGC------------- --TCAGGAGCAGGAAAGCCCGCCGGTTTCAACGTCATCCTGCCCACACTG GCCGACCTGCTGTGCTACCAGTCGCCCGCCTTCATCTTTGGCTTCCTCAA CCGCCTGCGTCGTTCGGAGCACGTGCGTCGTGTGTTCCTCTGGGCCTCCC CGCAGCACCTGCAGCATCCGCATGCGGAGTACATCCTGGCTGGCTGCGAG TACCTGGCGGAGTTGGTCCTTCGCCTGGAGACGGACAAGCAACTATCGCT GATATCGCGTAAACCCGGTGGCGGAGTGACCAACAGGCGCTTCGCCTGCC AGATCAGCAAGACCGAGTTCCAGGTGACGCCGCTGGACGAAGGACAGCCC GCAGGAGCCTCACCCAAACAGTCTTCCCCGGAGGCGGAGCAAACCCCAGA GCCGGCCAGCAGCACCTTCAAAATCGAGCTCGACGAGGACGAGGTGGTGG CCCGCAATGCACTCACCCTGCCATACGAACGCACCAGCGAGCCGACCGAG GGCAACATTATATACACACCCGATGCCGACGACGACTTCGACGAGGAGGA TCCGGACGAGGATCTGTGCATC---------------------------- -------------------- >C7 ATGCTCTCCAACCTGCTGGTGACCAAACAAAAAGTGGTCCTCGTAATAGA TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC ACGAACAGGGCCAGGGGACGGAGACCATCAAGACCCTGCCCACCGGCATC AGCCTGAAGCACGTGGCCACCTTCGAGGCACTGATCGCCGAGTGCGCCAA CCAAAACAAC---------------------------------------- --------ACAGGGAAACCCTCCGGCTTCAACGTCATCCTGCCCACACTG GCCGACCTGCTGTGCTACCAGTCGCCCGCCTTTATCTTTAGCTTCCTCAA CCGCCTGCGTCGCTCGGAGCACGTGCGTCGTGTGTTCCTCTGGGCCTCCC CGCAGCACCTCCAGCATCCCCATGCCGACTACATCCTGGCTGGCTGCGAG TACCTGGCGGAGCTGGTGCTTCGCCTGGAGACGGACAAGCTACTATCACT GATATCGCGCAAACCCGGTGGCGGGGTGTCCAACAGGCGGTTCGCCTGCC AGGTCAGCAAGACCCAGTTCCAGGTGACGCCGCTTGACGAAGGGCTGCCC ACAGGTGTCTCACCCAAACAGCCTACCCCGGAGGCGGAGCAAACCCCAGA GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAGATGGTGG CCCGCAATGCACTCACCCTGCCATATGAACGCACCAGCGAGCCGACTGAG GGCAACATCATATACACACCCGATGCTGACGACGACTTCGATGAGGAGGA TCCGGACGAGGATCTGTGCATC---------------------------- -------------------- >C8 ATGCTTTCAAATCTTGTGGTGACCAATCAAAAAGTGGTCCTCATAATAGA TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCTTGCTTC ACGAACAGGGACAGGGGACAGATACAATCAAGGCCTTGCCCACCGGCGTC AGTCTGAAGCACGTGGCCACCTTCGAATCGCTGATCGACGAGTGCGCCAA CCATAACAACAACAACACCCCTGCCGGAGAAGTGGGCGACGTGGATGCGG TTACTCCGGGATCGAAATCTACCGGCTTCAACGTCATCCTGCCCACCTTG GCTGACCTGCTGTGCTATCAGTCGCCCGCTTTTATTTTTGGCTTCCTTAA CCGCCTACGTCGCTCGGAGCATGTGCGTCGAGTGTTCCTCTGGGCTTCCC CGCACCATCTGCAGCATCCTCATGCTGCCTACATTCTGGCTGGCTGCGAA TACTTGGCCAAGTTGGTGCTCCGCTTGGAAACAGACAAGCTACTGTCCAT AATATCACGCAAGCCGGGCGGAGGAGTTACAAACAGACGCTTCTCATGCC AGGTCAGCAAAACCCAGTTCCTGGTGACGCCGGTGGACGGAGGACTCCCG GCAGGTGTCTCTCCCAAGCAGCCCTCGCCAGAGGCAGAGCAAACCCCAGA ACCGGCCAGCAGCACCTTTAAGATCGAGCTCGACGAGGATGAAGTGGTTG CTCGCAATGCACTTACCCTGCCATACGAACGCACAAGCGAGCCGTCCGAG GGAAACATTATATACACGCCCGATGCCGACGACGACTTTGATGAGGAGGA TCCTGACGAGGATCTGTGCATC---------------------------- -------------------- >C1 MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYANoooNNTGSoooooooooTTDSNSTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCE YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP AGASPKQPSPEAEQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSE GNIIYTPDADDDFDEEDPDEDLCI >C2 MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYANoooNNTGSoooooooooTTDSNFTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE YLAELVLRLETDKLLSLISRKPGGGVTNRRYSCEVSKTQFKVTPLDGGRP AGASSKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE GNIIYTPDADDDFDEEDPDEDLCI >C3 MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYANoooNNTGSoooooooooTTDPNFTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP AGASPKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE GNIIYTPDADDDFDEEDPDEDLCI >C4 MLSNLVVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV SLKHVATFEALITECANTKNNNTASoooooooooSPRSKSTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHADYILAGCE YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCQVSKTSFQVTPLDGGLP AGASPKQPSPESEQTPEPASSTFKIELDEDEVVARNALTLPYERTCEPSE GNIIYTPDADDDFDEEDPDEDLCI >C5 MLSNLLVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV SLKHVATFEALIGECANHKNNNTGSoooooooooIPGSKATGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHAEYILAGCE YLAELVLRLESDKLLSLISRKPGGAVSNKRYSCQVSKTFFQVTPLDGGLP AGGSPKQPSPETEQTPEPASSTFKIELDEDEVMARNALTLPYERTCEPSE GNIIYTPDADDDFDEEDPDEDLCI >C6 MLSNLLVTKQKLVLVIDKLNRERIAPKFIGSLLHEQGQGTETIKALPTGV SLKLVATFEALLSECANQNNNNNTAGTPGoooooSGAGKPAGFNVILPTL ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPQHLQHPHAEYILAGCE YLAELVLRLETDKQLSLISRKPGGGVTNRRFACQISKTEFQVTPLDEGQP AGASPKQSSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPTE GNIIYTPDADDDFDEEDPDEDLCI >C7 MLSNLLVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGTETIKTLPTGI SLKHVATFEALIAECANQNNooooooooooooooooTGKPSGFNVILPTL ADLLCYQSPAFIFSFLNRLRRSEHVRRVFLWASPQHLQHPHADYILAGCE YLAELVLRLETDKLLSLISRKPGGGVSNRRFACQVSKTQFQVTPLDEGLP TGVSPKQPTPEAEQTPEPASSTFKIELDEDEMVARNALTLPYERTSEPTE GNIIYTPDADDDFDEEDPDEDLCI >C8 MLSNLVVTNQKVVLIIDELNRERIAPKFIGSLLHEQGQGTDTIKALPTGV SLKHVATFESLIDECANHNNNNTPAGEVGDVDAVTPGSKSTGFNVILPTL ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPHHLQHPHAAYILAGCE YLAKLVLRLETDKLLSIISRKPGGGVTNRRFSCQVSKTQFLVTPVDGGLP AGVSPKQPSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPSE GNIIYTPDADDDFDEEDPDEDLCI MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 8 taxa and 870 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Taxon 8 -> C8 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1479400883 Setting output file names to "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 140741199 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 3981457565 Seed = 469448605 Swapseed = 1479400883 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 56 unique site patterns Division 2 has 36 unique site patterns Division 3 has 104 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3268.577141 -- -24.349928 Chain 2 -- -3446.439625 -- -24.349928 Chain 3 -- -3415.570185 -- -24.349928 Chain 4 -- -3458.823588 -- -24.349928 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3336.231911 -- -24.349928 Chain 2 -- -3344.521840 -- -24.349928 Chain 3 -- -3426.310172 -- -24.349928 Chain 4 -- -3403.005038 -- -24.349928 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3268.577] (-3446.440) (-3415.570) (-3458.824) * [-3336.232] (-3344.522) (-3426.310) (-3403.005) 500 -- (-2711.413) (-2725.525) (-2702.928) [-2699.636] * [-2702.823] (-2710.149) (-2720.761) (-2693.588) -- 0:33:19 1000 -- (-2709.595) (-2681.145) (-2695.013) [-2653.516] * [-2660.907] (-2687.263) (-2713.936) (-2691.264) -- 0:16:39 1500 -- (-2685.243) (-2674.219) (-2650.685) [-2625.041] * (-2662.296) (-2656.766) (-2685.064) [-2651.478] -- 0:11:05 2000 -- (-2660.240) (-2633.873) [-2632.266] (-2622.156) * (-2646.251) [-2633.481] (-2662.964) (-2626.633) -- 0:08:19 2500 -- (-2640.847) [-2626.459] (-2627.800) (-2626.520) * (-2630.031) (-2625.737) (-2646.187) [-2628.327] -- 0:06:39 3000 -- (-2631.281) [-2620.596] (-2626.742) (-2621.942) * (-2633.874) (-2623.124) (-2639.768) [-2628.117] -- 0:11:04 3500 -- (-2626.333) [-2617.496] (-2621.602) (-2627.733) * (-2633.853) [-2627.597] (-2639.181) (-2622.930) -- 0:09:29 4000 -- (-2622.517) (-2628.070) (-2625.537) [-2624.533] * (-2635.113) [-2633.048] (-2629.145) (-2626.411) -- 0:08:18 4500 -- (-2627.055) (-2631.977) [-2626.157] (-2630.351) * (-2632.744) (-2624.915) (-2620.493) [-2625.110] -- 0:07:22 5000 -- (-2621.735) (-2629.095) (-2628.373) [-2627.849] * (-2631.562) (-2623.836) [-2628.007] (-2625.570) -- 0:06:38 Average standard deviation of split frequencies: 0.000000 5500 -- (-2632.341) (-2626.985) [-2631.808] (-2627.853) * [-2623.554] (-2628.407) (-2630.795) (-2627.886) -- 0:09:02 6000 -- (-2622.438) [-2621.269] (-2629.987) (-2624.944) * (-2623.765) [-2628.387] (-2623.361) (-2628.207) -- 0:08:17 6500 -- (-2626.153) (-2628.652) [-2624.524] (-2619.880) * (-2632.290) [-2631.143] (-2624.353) (-2632.764) -- 0:07:38 7000 -- (-2641.543) [-2626.524] (-2631.538) (-2622.515) * (-2623.856) [-2628.695] (-2620.660) (-2625.532) -- 0:07:05 7500 -- [-2623.891] (-2626.378) (-2629.266) (-2634.512) * (-2630.093) (-2625.204) [-2627.534] (-2630.277) -- 0:06:37 8000 -- (-2626.623) (-2631.576) [-2636.297] (-2633.994) * [-2628.492] (-2637.145) (-2629.427) (-2632.336) -- 0:08:16 8500 -- (-2621.575) [-2625.556] (-2635.990) (-2626.899) * (-2623.462) [-2630.860] (-2628.060) (-2623.226) -- 0:07:46 9000 -- (-2629.879) (-2622.636) (-2631.312) [-2627.990] * (-2626.604) [-2620.152] (-2635.297) (-2624.151) -- 0:07:20 9500 -- (-2627.416) (-2627.346) (-2629.049) [-2626.946] * (-2628.803) (-2626.186) (-2631.054) [-2625.732] -- 0:06:57 10000 -- (-2630.287) [-2622.469] (-2628.504) (-2636.649) * (-2631.946) (-2631.178) (-2622.882) [-2627.223] -- 0:06:36 Average standard deviation of split frequencies: 0.000000 10500 -- [-2628.440] (-2623.874) (-2631.024) (-2636.113) * (-2626.567) (-2631.637) (-2626.891) [-2629.538] -- 0:07:51 11000 -- (-2626.481) (-2635.430) [-2625.963] (-2622.236) * (-2631.798) (-2628.297) (-2627.105) [-2629.452] -- 0:07:29 11500 -- (-2625.095) (-2626.234) (-2622.650) [-2627.298] * (-2629.671) [-2623.725] (-2626.239) (-2623.144) -- 0:07:09 12000 -- (-2632.492) (-2620.783) [-2626.369] (-2621.633) * (-2623.147) (-2630.979) [-2630.182] (-2631.391) -- 0:06:51 12500 -- (-2633.060) (-2625.786) [-2622.293] (-2626.125) * [-2626.547] (-2633.103) (-2632.824) (-2628.827) -- 0:06:35 13000 -- (-2625.536) [-2623.422] (-2631.161) (-2630.737) * [-2620.614] (-2623.435) (-2626.328) (-2626.571) -- 0:07:35 13500 -- [-2624.451] (-2624.264) (-2623.056) (-2630.900) * (-2626.504) [-2620.731] (-2633.394) (-2627.749) -- 0:07:18 14000 -- (-2624.512) [-2631.021] (-2621.148) (-2626.565) * (-2632.002) [-2627.228] (-2639.815) (-2631.073) -- 0:07:02 14500 -- [-2622.553] (-2620.765) (-2620.629) (-2633.258) * (-2622.726) (-2623.591) [-2627.282] (-2638.261) -- 0:06:47 15000 -- (-2631.012) (-2641.535) (-2622.047) [-2630.074] * (-2627.057) (-2624.574) (-2626.568) [-2622.453] -- 0:06:34 Average standard deviation of split frequencies: 0.000000 15500 -- [-2623.984] (-2624.888) (-2623.653) (-2625.487) * (-2623.358) (-2631.118) (-2628.377) [-2622.294] -- 0:07:24 16000 -- (-2627.927) (-2623.311) (-2626.625) [-2622.674] * (-2620.366) (-2630.730) (-2627.000) [-2626.921] -- 0:07:10 16500 -- (-2625.245) (-2629.604) (-2629.358) [-2624.318] * [-2621.891] (-2619.336) (-2631.736) (-2625.509) -- 0:06:57 17000 -- [-2623.616] (-2632.826) (-2628.744) (-2629.959) * (-2630.499) (-2627.017) [-2622.111] (-2626.490) -- 0:06:44 17500 -- [-2621.967] (-2622.069) (-2627.539) (-2622.461) * (-2626.780) (-2625.956) (-2633.252) [-2625.865] -- 0:06:33 18000 -- [-2625.944] (-2623.545) (-2630.198) (-2630.490) * [-2629.657] (-2631.897) (-2628.227) (-2629.239) -- 0:07:16 18500 -- (-2629.013) (-2623.604) [-2622.719] (-2626.431) * [-2627.013] (-2628.958) (-2634.266) (-2623.325) -- 0:07:04 19000 -- (-2627.102) [-2621.443] (-2620.940) (-2628.051) * (-2625.197) (-2628.514) (-2632.182) [-2624.534] -- 0:06:53 19500 -- (-2622.256) (-2635.396) [-2625.674] (-2630.359) * (-2629.018) (-2628.015) (-2635.002) [-2625.255] -- 0:06:42 20000 -- (-2627.507) (-2634.022) [-2623.602] (-2623.964) * (-2627.419) (-2631.619) [-2625.071] (-2622.446) -- 0:06:32 Average standard deviation of split frequencies: 0.000000 20500 -- (-2629.741) (-2634.952) [-2623.585] (-2630.986) * (-2628.697) (-2623.392) (-2624.143) [-2621.110] -- 0:07:10 21000 -- (-2624.893) (-2625.574) [-2622.102] (-2618.354) * (-2627.331) (-2625.924) [-2618.890] (-2625.085) -- 0:06:59 21500 -- (-2625.332) (-2637.076) [-2625.467] (-2622.023) * (-2624.206) (-2620.826) [-2626.777] (-2624.845) -- 0:06:49 22000 -- (-2628.963) [-2625.793] (-2624.994) (-2623.687) * (-2629.370) (-2626.463) (-2620.976) [-2624.265] -- 0:06:40 22500 -- (-2620.866) (-2633.428) [-2623.697] (-2621.108) * (-2635.706) (-2624.866) (-2630.945) [-2622.500] -- 0:06:31 23000 -- (-2627.737) (-2628.553) (-2625.755) [-2633.364] * (-2635.466) [-2624.258] (-2627.191) (-2626.720) -- 0:07:04 23500 -- (-2627.524) [-2626.299] (-2623.552) (-2624.948) * [-2621.167] (-2626.906) (-2621.917) (-2630.839) -- 0:06:55 24000 -- (-2626.264) [-2623.634] (-2624.094) (-2624.558) * (-2625.000) [-2622.496] (-2620.971) (-2632.989) -- 0:06:46 24500 -- (-2627.112) (-2626.800) [-2619.186] (-2628.498) * [-2626.400] (-2621.496) (-2620.521) (-2628.519) -- 0:06:38 25000 -- (-2627.480) (-2644.099) [-2621.292] (-2621.651) * [-2631.459] (-2617.731) (-2628.250) (-2624.739) -- 0:06:30 Average standard deviation of split frequencies: 0.000000 25500 -- (-2626.582) [-2621.930] (-2625.843) (-2626.197) * [-2624.731] (-2621.868) (-2630.037) (-2635.629) -- 0:07:00 26000 -- (-2630.490) [-2622.621] (-2622.692) (-2627.663) * (-2627.886) (-2636.521) (-2634.123) [-2630.397] -- 0:06:52 26500 -- (-2630.699) [-2622.241] (-2624.625) (-2624.315) * (-2630.762) [-2621.914] (-2633.115) (-2623.509) -- 0:06:44 27000 -- (-2628.826) (-2632.273) (-2623.301) [-2624.028] * (-2628.614) [-2619.852] (-2639.773) (-2621.259) -- 0:06:36 27500 -- [-2624.552] (-2626.972) (-2625.426) (-2628.556) * [-2621.467] (-2630.000) (-2631.232) (-2631.955) -- 0:06:29 28000 -- (-2626.339) (-2634.271) (-2632.058) [-2619.885] * [-2624.561] (-2625.343) (-2624.498) (-2621.120) -- 0:06:56 28500 -- [-2628.218] (-2629.410) (-2632.825) (-2624.826) * (-2626.253) [-2635.055] (-2633.702) (-2633.167) -- 0:06:49 29000 -- (-2628.095) (-2625.275) (-2629.123) [-2624.191] * (-2635.252) (-2623.433) (-2625.449) [-2621.802] -- 0:06:41 29500 -- (-2630.206) (-2628.480) [-2623.502] (-2627.688) * [-2625.629] (-2625.548) (-2629.686) (-2627.077) -- 0:06:34 30000 -- [-2626.627] (-2625.481) (-2627.418) (-2620.392) * [-2623.729] (-2622.875) (-2633.247) (-2621.277) -- 0:06:28 Average standard deviation of split frequencies: 0.000000 30500 -- (-2629.457) (-2626.810) (-2620.601) [-2618.286] * (-2634.616) (-2633.584) [-2623.558] (-2623.898) -- 0:06:53 31000 -- (-2625.328) [-2627.675] (-2629.402) (-2624.540) * (-2635.350) [-2619.348] (-2621.267) (-2621.739) -- 0:06:46 31500 -- [-2624.458] (-2629.012) (-2629.557) (-2629.581) * (-2628.389) (-2631.131) (-2628.181) [-2627.482] -- 0:06:39 32000 -- (-2629.037) (-2627.923) (-2621.666) [-2628.653] * [-2630.950] (-2627.823) (-2625.667) (-2629.393) -- 0:06:33 32500 -- (-2623.552) (-2634.657) [-2621.575] (-2625.470) * (-2622.068) [-2624.475] (-2627.735) (-2641.457) -- 0:06:27 33000 -- (-2624.122) (-2632.125) (-2620.683) [-2626.437] * (-2623.887) (-2632.510) (-2631.391) [-2626.915] -- 0:06:50 33500 -- (-2622.153) (-2624.939) (-2629.803) [-2628.424] * (-2627.990) [-2623.043] (-2633.905) (-2629.931) -- 0:06:43 34000 -- (-2620.831) [-2623.575] (-2620.670) (-2632.850) * (-2622.329) (-2623.877) (-2629.714) [-2626.857] -- 0:06:37 34500 -- (-2628.803) [-2622.800] (-2625.361) (-2633.540) * (-2627.829) [-2627.239] (-2622.377) (-2627.363) -- 0:06:31 35000 -- (-2626.505) (-2625.259) (-2627.243) [-2625.689] * (-2627.401) (-2623.923) (-2631.185) [-2620.812] -- 0:06:26 Average standard deviation of split frequencies: 0.000000 35500 -- (-2633.033) (-2627.832) [-2624.801] (-2631.853) * (-2626.484) [-2618.963] (-2631.322) (-2629.826) -- 0:06:47 36000 -- (-2626.512) (-2635.248) [-2621.828] (-2626.149) * [-2622.479] (-2620.714) (-2624.271) (-2628.722) -- 0:06:41 36500 -- [-2624.200] (-2636.433) (-2629.753) (-2625.544) * (-2633.659) (-2623.995) (-2628.123) [-2624.644] -- 0:06:35 37000 -- (-2626.082) [-2631.599] (-2624.697) (-2625.258) * (-2629.758) [-2624.799] (-2625.449) (-2626.284) -- 0:06:30 37500 -- (-2622.559) (-2641.702) (-2633.793) [-2625.924] * (-2627.712) [-2621.311] (-2628.921) (-2622.055) -- 0:06:25 38000 -- (-2623.505) (-2641.673) [-2627.958] (-2624.415) * (-2628.183) (-2623.629) [-2622.552] (-2625.476) -- 0:06:45 38500 -- (-2625.078) (-2628.103) [-2627.750] (-2623.751) * (-2633.853) (-2632.204) (-2631.554) [-2620.512] -- 0:06:39 39000 -- (-2626.259) [-2629.808] (-2632.575) (-2624.386) * (-2630.905) (-2627.212) [-2624.983] (-2622.732) -- 0:06:34 39500 -- (-2628.501) (-2625.339) (-2627.162) [-2630.319] * (-2628.122) (-2625.135) [-2627.925] (-2625.527) -- 0:06:29 40000 -- [-2619.626] (-2629.176) (-2627.803) (-2623.975) * (-2637.957) (-2625.010) [-2629.809] (-2628.641) -- 0:06:24 Average standard deviation of split frequencies: 0.000000 40500 -- (-2623.313) [-2625.365] (-2621.894) (-2637.446) * [-2624.309] (-2623.960) (-2629.219) (-2624.095) -- 0:06:42 41000 -- [-2622.975] (-2626.589) (-2624.048) (-2625.613) * (-2626.375) (-2622.682) (-2633.102) [-2628.912] -- 0:06:37 41500 -- (-2633.046) [-2624.667] (-2630.833) (-2626.452) * (-2619.143) (-2628.199) (-2626.280) [-2625.450] -- 0:06:32 42000 -- (-2620.764) [-2617.378] (-2632.573) (-2625.547) * (-2633.435) (-2632.298) [-2621.093] (-2628.828) -- 0:06:27 42500 -- [-2626.992] (-2627.612) (-2627.572) (-2634.076) * (-2626.305) (-2631.438) (-2626.311) [-2629.652] -- 0:06:23 43000 -- (-2626.654) (-2630.614) (-2625.740) [-2625.603] * [-2622.817] (-2628.391) (-2625.489) (-2622.266) -- 0:06:40 43500 -- (-2625.277) (-2626.113) [-2623.369] (-2627.238) * (-2632.882) (-2633.816) (-2628.430) [-2622.997] -- 0:06:35 44000 -- [-2624.610] (-2629.785) (-2627.605) (-2626.004) * (-2638.081) (-2626.764) [-2628.341] (-2621.525) -- 0:06:31 44500 -- (-2626.545) [-2621.535] (-2629.751) (-2628.572) * [-2629.134] (-2625.997) (-2620.738) (-2623.564) -- 0:06:26 45000 -- (-2622.669) [-2626.676] (-2623.862) (-2621.291) * (-2627.060) [-2627.128] (-2630.219) (-2625.472) -- 0:06:22 Average standard deviation of split frequencies: 0.000000 45500 -- (-2626.415) [-2628.988] (-2622.214) (-2637.705) * (-2626.782) (-2633.343) (-2628.686) [-2622.623] -- 0:06:38 46000 -- (-2623.745) (-2626.626) [-2623.210] (-2621.091) * [-2622.652] (-2626.360) (-2637.806) (-2626.773) -- 0:06:34 46500 -- (-2624.150) (-2630.348) [-2627.811] (-2620.218) * [-2620.818] (-2626.548) (-2625.386) (-2626.231) -- 0:06:29 47000 -- (-2622.610) (-2627.112) [-2618.854] (-2622.938) * (-2623.705) [-2625.292] (-2629.908) (-2632.204) -- 0:06:25 47500 -- (-2626.191) [-2631.586] (-2626.404) (-2627.273) * [-2623.245] (-2631.700) (-2638.708) (-2629.079) -- 0:06:21 48000 -- (-2623.575) (-2632.303) [-2626.371] (-2627.662) * (-2628.818) (-2627.518) (-2626.278) [-2621.270] -- 0:06:36 48500 -- (-2625.152) [-2626.040] (-2625.576) (-2628.416) * (-2621.251) (-2632.152) [-2636.466] (-2624.542) -- 0:06:32 49000 -- (-2631.820) (-2621.931) [-2621.899] (-2624.028) * (-2626.059) (-2625.444) [-2623.881] (-2628.219) -- 0:06:28 49500 -- (-2632.754) (-2628.033) [-2624.862] (-2626.447) * (-2633.417) (-2620.411) [-2623.882] (-2628.363) -- 0:06:24 50000 -- (-2624.723) [-2623.699] (-2636.096) (-2625.062) * [-2624.007] (-2623.344) (-2626.866) (-2620.844) -- 0:06:20 Average standard deviation of split frequencies: 0.000000 50500 -- (-2630.061) (-2626.737) [-2633.835] (-2623.896) * (-2632.823) (-2638.616) (-2629.366) [-2623.036] -- 0:06:34 51000 -- (-2632.196) (-2628.817) (-2626.797) [-2628.693] * [-2626.950] (-2628.015) (-2638.553) (-2629.159) -- 0:06:30 51500 -- [-2623.305] (-2622.890) (-2630.728) (-2628.907) * (-2626.638) (-2624.443) [-2627.113] (-2632.136) -- 0:06:26 52000 -- (-2624.238) (-2624.318) (-2633.488) [-2620.404] * [-2624.763] (-2637.421) (-2622.874) (-2629.106) -- 0:06:22 52500 -- [-2629.137] (-2620.861) (-2631.632) (-2628.324) * (-2633.789) (-2631.680) [-2630.044] (-2636.143) -- 0:06:19 53000 -- (-2624.808) (-2628.658) [-2633.894] (-2628.024) * (-2628.431) [-2632.018] (-2623.918) (-2623.154) -- 0:06:33 53500 -- (-2621.389) (-2630.023) [-2632.126] (-2628.676) * (-2627.468) (-2625.015) (-2628.689) [-2622.487] -- 0:06:29 54000 -- (-2627.254) (-2630.092) [-2627.458] (-2632.565) * (-2638.424) [-2620.705] (-2622.361) (-2624.194) -- 0:06:25 54500 -- [-2632.224] (-2632.812) (-2634.363) (-2630.434) * (-2632.140) (-2629.492) (-2634.390) [-2621.514] -- 0:06:21 55000 -- [-2623.407] (-2635.966) (-2628.968) (-2623.393) * (-2627.352) [-2622.372] (-2625.332) (-2626.830) -- 0:06:35 Average standard deviation of split frequencies: 0.000000 55500 -- (-2634.793) [-2629.937] (-2632.522) (-2622.523) * (-2633.883) (-2626.441) [-2623.587] (-2631.989) -- 0:06:31 56000 -- [-2633.479] (-2625.466) (-2626.678) (-2624.917) * (-2627.566) (-2626.868) [-2628.025] (-2623.310) -- 0:06:27 56500 -- (-2630.541) (-2631.530) (-2632.887) [-2623.930] * (-2630.480) (-2629.538) [-2633.438] (-2628.467) -- 0:06:24 57000 -- (-2624.484) (-2627.771) (-2635.869) [-2624.890] * (-2632.561) (-2632.686) [-2624.776] (-2624.524) -- 0:06:20 57500 -- (-2629.659) (-2634.191) (-2625.358) [-2624.136] * (-2629.592) (-2626.897) (-2627.100) [-2624.137] -- 0:06:33 58000 -- (-2629.028) (-2626.564) (-2624.669) [-2622.007] * (-2632.452) (-2630.427) (-2623.087) [-2629.943] -- 0:06:29 58500 -- (-2629.092) (-2623.527) (-2628.274) [-2625.271] * (-2629.186) (-2624.051) [-2622.154] (-2620.896) -- 0:06:26 59000 -- (-2632.579) (-2629.858) (-2626.049) [-2629.450] * [-2618.221] (-2620.576) (-2621.092) (-2624.959) -- 0:06:22 59500 -- [-2624.670] (-2624.553) (-2627.096) (-2628.374) * [-2619.335] (-2626.946) (-2633.705) (-2629.357) -- 0:06:19 60000 -- [-2623.971] (-2633.878) (-2630.325) (-2630.953) * (-2635.816) [-2631.680] (-2631.119) (-2625.961) -- 0:06:31 Average standard deviation of split frequencies: 0.000000 60500 -- (-2629.224) (-2628.746) [-2627.091] (-2628.135) * (-2629.851) (-2637.317) (-2628.452) [-2625.377] -- 0:06:28 61000 -- (-2629.822) (-2624.498) [-2623.496] (-2634.733) * [-2627.023] (-2630.244) (-2635.756) (-2624.040) -- 0:06:24 61500 -- (-2627.993) (-2629.332) (-2627.548) [-2626.381] * (-2620.678) [-2627.328] (-2630.163) (-2632.522) -- 0:06:21 62000 -- [-2624.197] (-2621.371) (-2631.394) (-2625.625) * (-2623.202) (-2626.934) [-2622.792] (-2636.867) -- 0:06:18 62500 -- [-2622.249] (-2627.005) (-2628.032) (-2627.681) * [-2627.008] (-2631.367) (-2627.942) (-2636.052) -- 0:06:30 63000 -- (-2631.306) [-2622.413] (-2632.957) (-2627.251) * [-2629.635] (-2631.142) (-2626.732) (-2632.349) -- 0:06:26 63500 -- [-2630.878] (-2631.693) (-2629.848) (-2628.647) * (-2619.927) (-2636.853) (-2628.677) [-2627.531] -- 0:06:23 64000 -- (-2623.509) [-2632.840] (-2625.935) (-2633.835) * [-2620.112] (-2627.658) (-2628.543) (-2629.536) -- 0:06:20 64500 -- (-2626.743) (-2626.511) [-2623.000] (-2626.341) * [-2621.772] (-2638.519) (-2636.149) (-2631.750) -- 0:06:17 65000 -- (-2622.396) (-2632.141) (-2622.436) [-2627.445] * (-2623.154) (-2627.912) [-2631.319] (-2631.373) -- 0:06:28 Average standard deviation of split frequencies: 0.000000 65500 -- (-2629.434) (-2629.881) (-2625.708) [-2631.136] * [-2626.532] (-2634.112) (-2631.468) (-2632.946) -- 0:06:25 66000 -- (-2625.582) (-2625.844) [-2632.306] (-2632.323) * [-2627.161] (-2623.619) (-2623.012) (-2630.009) -- 0:06:22 66500 -- (-2620.018) [-2623.954] (-2632.441) (-2631.079) * [-2624.002] (-2624.286) (-2622.224) (-2626.475) -- 0:06:19 67000 -- (-2625.039) (-2623.623) (-2625.861) [-2629.485] * (-2625.641) (-2624.327) [-2618.974] (-2634.692) -- 0:06:15 67500 -- [-2622.008] (-2624.761) (-2617.730) (-2620.519) * (-2623.993) (-2626.088) [-2618.197] (-2630.317) -- 0:06:26 68000 -- (-2623.453) (-2629.454) [-2620.894] (-2622.501) * (-2624.119) [-2618.562] (-2626.196) (-2623.585) -- 0:06:23 68500 -- (-2624.852) (-2631.477) [-2623.113] (-2633.243) * (-2623.154) (-2620.712) (-2628.546) [-2626.550] -- 0:06:20 69000 -- [-2622.386] (-2636.563) (-2631.651) (-2625.364) * (-2622.180) [-2623.312] (-2625.355) (-2624.914) -- 0:06:17 69500 -- (-2626.679) (-2641.504) (-2621.520) [-2624.037] * (-2626.768) (-2629.009) (-2627.688) [-2622.738] -- 0:06:14 70000 -- [-2623.143] (-2636.068) (-2622.670) (-2621.003) * (-2624.333) (-2628.348) [-2626.134] (-2627.486) -- 0:06:25 Average standard deviation of split frequencies: 0.000000 70500 -- (-2625.378) (-2632.398) (-2631.924) [-2628.795] * [-2625.961] (-2624.271) (-2625.976) (-2630.552) -- 0:06:22 71000 -- (-2624.311) (-2623.896) [-2628.157] (-2621.974) * (-2628.355) (-2630.754) (-2621.370) [-2625.048] -- 0:06:19 71500 -- (-2624.581) (-2631.000) (-2632.966) [-2624.563] * [-2626.097] (-2620.997) (-2626.975) (-2625.930) -- 0:06:16 72000 -- (-2627.647) [-2625.454] (-2624.361) (-2628.155) * (-2631.400) (-2635.214) [-2624.505] (-2627.699) -- 0:06:13 72500 -- (-2626.051) (-2623.163) (-2632.223) [-2625.155] * (-2626.485) [-2621.508] (-2626.283) (-2627.049) -- 0:06:23 73000 -- (-2629.946) (-2629.315) [-2620.674] (-2630.762) * (-2627.285) (-2623.361) [-2626.966] (-2625.129) -- 0:06:20 73500 -- (-2625.654) (-2628.366) (-2630.915) [-2625.692] * (-2627.611) (-2631.176) (-2632.196) [-2623.705] -- 0:06:18 74000 -- (-2619.619) (-2627.185) (-2629.255) [-2625.640] * (-2659.668) (-2634.151) (-2623.230) [-2626.188] -- 0:06:15 74500 -- [-2626.734] (-2624.819) (-2631.698) (-2620.140) * (-2625.821) [-2628.782] (-2626.116) (-2628.188) -- 0:06:12 75000 -- [-2628.504] (-2628.032) (-2629.192) (-2632.109) * (-2627.761) (-2627.762) [-2621.503] (-2630.554) -- 0:06:22 Average standard deviation of split frequencies: 0.000000 75500 -- [-2625.828] (-2632.178) (-2628.286) (-2627.897) * (-2630.122) [-2626.231] (-2630.663) (-2635.798) -- 0:06:19 76000 -- [-2627.598] (-2626.895) (-2619.406) (-2627.222) * (-2630.271) (-2633.785) (-2623.963) [-2628.294] -- 0:06:16 76500 -- (-2626.320) (-2625.156) (-2626.408) [-2625.545] * (-2628.240) (-2628.970) (-2628.817) [-2622.494] -- 0:06:14 77000 -- (-2634.128) (-2625.420) (-2629.047) [-2630.494] * (-2624.906) [-2627.785] (-2626.131) (-2626.423) -- 0:06:11 77500 -- (-2622.683) (-2625.341) [-2623.909] (-2625.745) * (-2625.522) (-2628.988) (-2628.152) [-2627.352] -- 0:06:20 78000 -- (-2638.754) (-2632.592) [-2630.403] (-2626.852) * [-2628.410] (-2631.808) (-2628.619) (-2627.441) -- 0:06:18 78500 -- [-2624.522] (-2623.952) (-2634.326) (-2629.176) * (-2626.571) (-2624.629) (-2623.971) [-2627.346] -- 0:06:15 79000 -- (-2621.611) (-2623.778) (-2628.117) [-2621.540] * (-2622.272) (-2620.241) [-2624.018] (-2626.098) -- 0:06:13 79500 -- (-2630.943) (-2623.982) (-2643.520) [-2625.707] * (-2621.765) [-2624.624] (-2619.965) (-2625.626) -- 0:06:10 80000 -- (-2631.602) [-2625.880] (-2632.025) (-2628.500) * (-2629.870) (-2634.056) (-2622.320) [-2627.525] -- 0:06:19 Average standard deviation of split frequencies: 0.000000 80500 -- (-2633.466) (-2631.188) [-2624.456] (-2629.190) * [-2624.381] (-2627.960) (-2625.837) (-2631.231) -- 0:06:16 81000 -- [-2626.180] (-2633.517) (-2625.965) (-2631.774) * (-2626.757) [-2635.277] (-2636.314) (-2622.503) -- 0:06:14 81500 -- (-2626.225) (-2627.941) (-2628.657) [-2627.723] * (-2631.355) [-2629.345] (-2624.833) (-2626.979) -- 0:06:11 82000 -- (-2630.883) (-2618.910) (-2623.954) [-2627.435] * (-2631.652) (-2633.256) [-2624.460] (-2621.490) -- 0:06:09 82500 -- (-2626.475) (-2633.683) [-2625.302] (-2623.471) * (-2633.425) (-2629.776) [-2623.244] (-2622.997) -- 0:06:18 83000 -- (-2619.716) [-2628.337] (-2626.292) (-2624.052) * (-2628.405) [-2624.813] (-2632.012) (-2627.438) -- 0:06:15 83500 -- (-2622.107) [-2623.819] (-2629.137) (-2632.148) * (-2621.877) [-2629.041] (-2625.472) (-2626.189) -- 0:06:13 84000 -- (-2626.304) (-2623.160) (-2628.524) [-2624.605] * (-2622.404) (-2627.907) [-2619.704] (-2631.971) -- 0:06:10 84500 -- (-2632.583) (-2630.677) (-2624.832) [-2625.783] * (-2634.710) [-2626.509] (-2626.716) (-2628.921) -- 0:06:08 85000 -- (-2625.174) (-2622.794) [-2628.183] (-2623.561) * (-2629.925) (-2634.244) (-2631.371) [-2630.766] -- 0:06:16 Average standard deviation of split frequencies: 0.000000 85500 -- (-2627.615) [-2624.867] (-2633.879) (-2625.239) * (-2629.036) [-2625.079] (-2631.478) (-2623.398) -- 0:06:14 86000 -- [-2625.353] (-2625.320) (-2636.345) (-2623.568) * (-2624.999) (-2621.913) (-2623.766) [-2619.888] -- 0:06:11 86500 -- [-2623.894] (-2622.575) (-2625.238) (-2622.429) * [-2627.378] (-2627.091) (-2637.396) (-2634.211) -- 0:06:09 87000 -- (-2628.856) [-2619.937] (-2626.625) (-2631.354) * (-2629.154) [-2623.340] (-2628.690) (-2638.267) -- 0:06:07 87500 -- (-2627.396) (-2628.489) (-2630.125) [-2629.757] * (-2633.135) (-2627.764) [-2630.115] (-2637.091) -- 0:06:15 88000 -- (-2626.959) (-2627.260) [-2621.924] (-2627.040) * (-2625.039) [-2627.691] (-2627.244) (-2630.973) -- 0:06:13 88500 -- (-2628.220) (-2631.471) [-2625.346] (-2633.175) * (-2626.658) (-2631.817) (-2627.688) [-2620.694] -- 0:06:10 89000 -- (-2634.158) (-2629.192) [-2624.355] (-2626.881) * [-2626.513] (-2622.954) (-2629.846) (-2627.800) -- 0:06:08 89500 -- (-2628.664) (-2623.831) [-2621.874] (-2636.938) * (-2623.668) [-2623.203] (-2631.139) (-2631.160) -- 0:06:06 90000 -- (-2625.843) (-2627.536) (-2628.486) [-2623.616] * (-2629.179) (-2624.883) [-2623.785] (-2632.018) -- 0:06:14 Average standard deviation of split frequencies: 0.000000 90500 -- (-2627.283) (-2630.740) [-2624.647] (-2619.596) * (-2624.007) [-2626.475] (-2630.307) (-2627.934) -- 0:06:11 91000 -- (-2625.042) (-2630.057) (-2628.221) [-2621.704] * (-2620.171) [-2623.946] (-2624.901) (-2635.086) -- 0:06:09 91500 -- (-2633.523) (-2628.364) (-2621.667) [-2623.245] * [-2625.295] (-2632.551) (-2629.830) (-2624.608) -- 0:06:07 92000 -- [-2625.156] (-2629.700) (-2630.655) (-2631.162) * [-2622.159] (-2625.516) (-2622.362) (-2625.584) -- 0:06:05 92500 -- [-2627.815] (-2634.213) (-2626.329) (-2627.143) * (-2624.153) (-2623.472) [-2624.917] (-2630.898) -- 0:06:12 93000 -- [-2629.411] (-2622.232) (-2635.255) (-2628.197) * [-2622.710] (-2623.972) (-2624.123) (-2625.428) -- 0:06:10 93500 -- (-2621.308) (-2629.305) (-2632.733) [-2624.720] * (-2626.040) [-2624.570] (-2631.167) (-2627.908) -- 0:06:08 94000 -- [-2623.688] (-2634.460) (-2627.458) (-2626.063) * (-2621.268) (-2634.034) [-2627.291] (-2635.841) -- 0:06:06 94500 -- [-2628.883] (-2625.047) (-2625.327) (-2625.230) * [-2628.064] (-2630.403) (-2625.177) (-2621.970) -- 0:06:04 95000 -- [-2633.434] (-2625.315) (-2625.375) (-2629.303) * (-2631.458) (-2630.309) (-2623.713) [-2624.085] -- 0:06:11 Average standard deviation of split frequencies: 0.000000 95500 -- [-2625.168] (-2630.926) (-2625.765) (-2633.095) * (-2631.598) (-2634.598) [-2621.804] (-2628.619) -- 0:06:09 96000 -- (-2628.312) [-2624.819] (-2625.793) (-2626.157) * [-2622.871] (-2627.124) (-2624.675) (-2626.812) -- 0:06:07 96500 -- [-2628.791] (-2632.757) (-2631.284) (-2644.219) * (-2626.783) (-2626.800) (-2630.619) [-2626.979] -- 0:06:05 97000 -- (-2623.520) [-2631.074] (-2629.756) (-2626.569) * (-2632.257) (-2625.287) [-2627.221] (-2627.193) -- 0:06:03 97500 -- [-2623.040] (-2626.421) (-2630.433) (-2633.597) * (-2637.383) [-2625.629] (-2620.757) (-2627.236) -- 0:06:10 98000 -- [-2626.770] (-2630.036) (-2629.737) (-2628.924) * (-2638.557) (-2621.899) [-2619.099] (-2621.415) -- 0:06:08 98500 -- [-2624.006] (-2622.324) (-2625.332) (-2628.070) * (-2632.424) (-2626.856) [-2623.292] (-2626.530) -- 0:06:06 99000 -- [-2623.373] (-2625.311) (-2623.253) (-2623.486) * (-2622.990) (-2630.755) (-2625.595) [-2624.804] -- 0:06:04 99500 -- (-2619.497) (-2621.959) (-2620.126) [-2620.583] * (-2624.104) (-2628.256) (-2629.335) [-2632.639] -- 0:06:02 100000 -- (-2628.502) (-2621.462) [-2617.612] (-2618.723) * [-2624.477] (-2631.293) (-2624.585) (-2622.544) -- 0:06:09 Average standard deviation of split frequencies: 0.000000 100500 -- (-2626.967) [-2628.309] (-2631.055) (-2625.974) * (-2627.082) (-2638.219) [-2623.071] (-2626.382) -- 0:06:06 101000 -- (-2624.177) (-2627.549) (-2626.345) [-2625.381] * [-2628.224] (-2640.088) (-2630.496) (-2635.342) -- 0:06:04 101500 -- (-2629.708) [-2623.532] (-2632.810) (-2625.471) * (-2631.592) [-2626.794] (-2628.925) (-2631.076) -- 0:06:02 102000 -- (-2626.037) [-2624.579] (-2628.161) (-2628.221) * (-2624.803) (-2630.425) [-2625.337] (-2628.056) -- 0:06:00 102500 -- (-2629.329) (-2630.340) [-2626.033] (-2630.195) * (-2627.564) (-2624.566) [-2623.828] (-2629.162) -- 0:06:07 103000 -- (-2626.912) (-2631.771) [-2621.954] (-2631.231) * (-2625.402) (-2627.687) (-2622.835) [-2630.936] -- 0:06:05 103500 -- (-2623.661) [-2627.944] (-2619.551) (-2633.896) * (-2624.800) [-2622.834] (-2624.802) (-2627.696) -- 0:06:03 104000 -- (-2637.571) (-2634.200) [-2623.279] (-2622.451) * [-2620.363] (-2626.025) (-2629.947) (-2629.180) -- 0:06:01 104500 -- (-2625.012) (-2624.265) (-2624.526) [-2628.237] * [-2628.787] (-2630.220) (-2633.218) (-2631.158) -- 0:05:59 105000 -- (-2628.092) [-2625.227] (-2623.559) (-2631.785) * (-2625.672) (-2630.916) (-2626.429) [-2628.275] -- 0:06:06 Average standard deviation of split frequencies: 0.000000 105500 -- (-2628.240) (-2626.841) [-2619.803] (-2621.241) * (-2620.466) (-2629.132) (-2621.882) [-2624.640] -- 0:06:04 106000 -- (-2622.562) (-2628.942) [-2620.873] (-2630.320) * (-2623.277) [-2624.769] (-2632.045) (-2627.504) -- 0:06:02 106500 -- [-2627.418] (-2628.543) (-2627.753) (-2628.932) * (-2635.402) [-2632.892] (-2626.797) (-2631.945) -- 0:06:00 107000 -- [-2620.582] (-2632.246) (-2640.287) (-2621.813) * (-2634.622) (-2624.641) (-2627.010) [-2633.278] -- 0:05:58 107500 -- (-2630.144) (-2634.973) (-2629.943) [-2625.670] * (-2630.690) [-2622.588] (-2637.934) (-2630.711) -- 0:06:05 108000 -- (-2627.611) (-2620.160) (-2623.859) [-2623.703] * [-2620.505] (-2623.598) (-2628.404) (-2628.492) -- 0:06:03 108500 -- (-2626.866) [-2621.514] (-2627.714) (-2626.203) * [-2620.132] (-2628.538) (-2623.873) (-2630.451) -- 0:06:01 109000 -- (-2625.937) (-2627.710) [-2624.481] (-2619.648) * (-2621.964) (-2626.820) (-2630.917) [-2634.901] -- 0:05:59 109500 -- (-2627.432) [-2624.191] (-2632.308) (-2628.242) * (-2625.883) [-2623.911] (-2626.862) (-2622.512) -- 0:06:05 110000 -- (-2626.675) (-2641.928) (-2625.796) [-2628.294] * (-2625.183) (-2628.498) [-2628.956] (-2623.797) -- 0:06:04 Average standard deviation of split frequencies: 0.000000 110500 -- [-2629.180] (-2622.353) (-2629.656) (-2624.151) * (-2632.039) (-2626.249) [-2628.906] (-2625.287) -- 0:06:02 111000 -- (-2628.376) (-2636.877) (-2622.511) [-2623.090] * (-2626.929) (-2629.382) [-2622.996] (-2623.904) -- 0:06:00 111500 -- (-2627.452) (-2633.446) (-2630.705) [-2630.493] * [-2625.475] (-2627.985) (-2626.669) (-2621.279) -- 0:05:58 112000 -- (-2626.412) (-2636.283) (-2625.797) [-2624.407] * [-2624.017] (-2625.647) (-2622.115) (-2628.220) -- 0:06:04 112500 -- (-2622.294) (-2628.764) (-2629.334) [-2624.000] * [-2628.653] (-2639.331) (-2631.111) (-2631.913) -- 0:06:02 113000 -- (-2622.449) (-2637.325) [-2622.259] (-2629.422) * [-2630.926] (-2636.889) (-2622.319) (-2625.398) -- 0:06:01 113500 -- (-2626.080) [-2631.190] (-2618.059) (-2635.334) * (-2628.192) (-2633.917) (-2628.332) [-2627.682] -- 0:05:59 114000 -- (-2624.445) (-2630.139) (-2623.733) [-2619.712] * [-2631.950] (-2624.896) (-2626.024) (-2636.799) -- 0:05:57 114500 -- (-2627.929) [-2619.903] (-2626.282) (-2623.643) * (-2629.024) (-2627.612) [-2624.044] (-2629.728) -- 0:06:03 115000 -- (-2627.225) (-2624.831) (-2639.770) [-2625.371] * [-2627.711] (-2628.631) (-2628.555) (-2628.711) -- 0:06:01 Average standard deviation of split frequencies: 0.000000 115500 -- (-2623.320) (-2626.809) (-2626.744) [-2626.448] * (-2635.104) [-2633.047] (-2623.898) (-2628.075) -- 0:05:59 116000 -- (-2622.278) (-2626.851) (-2636.141) [-2623.717] * (-2634.101) [-2626.738] (-2620.866) (-2625.772) -- 0:05:58 116500 -- [-2623.621] (-2635.569) (-2643.579) (-2628.708) * (-2625.204) [-2624.997] (-2621.990) (-2630.083) -- 0:05:56 117000 -- (-2625.818) (-2623.510) (-2639.740) [-2624.205] * (-2627.789) (-2625.052) (-2629.094) [-2627.623] -- 0:06:02 117500 -- [-2619.371] (-2632.460) (-2633.257) (-2628.895) * [-2624.355] (-2623.230) (-2625.874) (-2626.154) -- 0:06:00 118000 -- (-2618.994) (-2631.231) (-2629.865) [-2624.740] * (-2623.655) (-2629.312) [-2636.007] (-2629.898) -- 0:05:58 118500 -- (-2627.894) [-2631.150] (-2636.373) (-2625.650) * [-2619.372] (-2625.301) (-2624.675) (-2641.183) -- 0:05:57 119000 -- [-2625.650] (-2633.695) (-2629.159) (-2642.429) * (-2632.216) [-2625.077] (-2619.521) (-2625.532) -- 0:05:55 119500 -- (-2622.840) (-2627.036) (-2629.104) [-2628.327] * (-2632.246) [-2623.192] (-2626.043) (-2625.177) -- 0:06:01 120000 -- (-2623.401) (-2623.869) [-2628.576] (-2623.632) * (-2624.512) [-2630.850] (-2625.123) (-2625.879) -- 0:05:59 Average standard deviation of split frequencies: 0.000000 120500 -- (-2626.956) [-2622.437] (-2626.715) (-2628.179) * [-2626.055] (-2629.331) (-2631.363) (-2625.264) -- 0:05:57 121000 -- [-2627.653] (-2622.479) (-2627.087) (-2632.808) * (-2638.842) (-2633.530) (-2625.434) [-2630.826] -- 0:05:55 121500 -- (-2625.778) [-2622.755] (-2629.662) (-2625.966) * [-2629.723] (-2626.840) (-2630.908) (-2630.789) -- 0:05:54 122000 -- (-2625.652) [-2634.145] (-2620.868) (-2622.324) * (-2622.736) (-2626.495) [-2623.820] (-2625.517) -- 0:05:59 122500 -- [-2619.508] (-2623.767) (-2631.159) (-2621.338) * (-2639.053) (-2626.101) [-2631.774] (-2624.599) -- 0:05:58 123000 -- (-2618.536) (-2624.161) (-2626.587) [-2620.723] * (-2621.488) (-2626.765) [-2627.477] (-2628.092) -- 0:05:56 123500 -- (-2627.973) (-2625.101) [-2622.332] (-2621.063) * (-2629.342) (-2627.879) [-2623.371] (-2622.170) -- 0:05:54 124000 -- (-2623.102) (-2626.487) [-2626.624] (-2622.606) * (-2628.834) (-2622.442) [-2620.675] (-2628.188) -- 0:05:53 124500 -- (-2635.193) (-2632.460) [-2623.358] (-2623.467) * (-2625.493) (-2628.802) (-2623.048) [-2626.900] -- 0:05:58 125000 -- (-2621.517) (-2630.762) (-2622.438) [-2625.046] * (-2639.003) (-2622.345) [-2625.680] (-2636.741) -- 0:05:57 Average standard deviation of split frequencies: 0.000000 125500 -- [-2629.021] (-2626.428) (-2628.689) (-2631.971) * (-2623.322) [-2625.316] (-2625.189) (-2631.723) -- 0:05:55 126000 -- (-2628.368) (-2622.722) (-2635.492) [-2619.863] * [-2620.619] (-2634.830) (-2625.148) (-2627.812) -- 0:05:53 126500 -- (-2636.889) (-2631.603) (-2628.131) [-2626.359] * (-2623.805) (-2627.683) (-2625.809) [-2622.742] -- 0:05:52 127000 -- [-2624.041] (-2634.051) (-2627.497) (-2623.729) * (-2624.488) (-2638.374) [-2625.064] (-2631.482) -- 0:05:57 127500 -- (-2628.118) [-2620.833] (-2627.874) (-2633.857) * [-2622.279] (-2631.803) (-2624.389) (-2632.881) -- 0:05:55 128000 -- (-2626.680) (-2627.843) (-2628.028) [-2631.747] * (-2621.077) (-2626.224) (-2625.889) [-2628.473] -- 0:05:54 128500 -- (-2622.750) [-2622.510] (-2638.517) (-2637.360) * (-2622.058) [-2624.853] (-2626.517) (-2638.234) -- 0:05:52 129000 -- (-2624.167) [-2630.762] (-2635.150) (-2632.264) * [-2625.723] (-2623.566) (-2630.230) (-2621.621) -- 0:05:51 129500 -- (-2634.224) [-2622.319] (-2625.554) (-2628.680) * (-2627.012) (-2623.956) [-2622.325] (-2620.011) -- 0:05:56 130000 -- (-2627.407) (-2626.000) [-2624.027] (-2621.803) * [-2629.905] (-2630.130) (-2628.070) (-2626.278) -- 0:05:54 Average standard deviation of split frequencies: 0.000000 130500 -- [-2626.321] (-2631.957) (-2622.367) (-2624.245) * (-2631.123) (-2621.949) [-2624.204] (-2641.880) -- 0:05:53 131000 -- (-2625.849) (-2625.170) [-2623.012] (-2629.046) * (-2625.349) [-2621.022] (-2625.623) (-2622.207) -- 0:05:51 131500 -- (-2626.276) [-2626.227] (-2621.508) (-2620.613) * (-2625.444) [-2624.081] (-2628.560) (-2628.286) -- 0:05:50 132000 -- (-2626.552) (-2623.026) (-2623.227) [-2629.492] * (-2628.604) [-2630.863] (-2629.234) (-2633.053) -- 0:05:55 132500 -- [-2625.151] (-2622.233) (-2623.547) (-2630.959) * [-2624.598] (-2626.109) (-2632.684) (-2629.668) -- 0:05:53 133000 -- [-2624.547] (-2623.032) (-2624.300) (-2631.616) * (-2636.014) [-2621.905] (-2631.927) (-2630.685) -- 0:05:52 133500 -- (-2636.307) (-2624.777) [-2624.753] (-2621.789) * [-2624.711] (-2623.932) (-2623.062) (-2629.070) -- 0:05:50 134000 -- (-2633.017) [-2623.036] (-2624.508) (-2632.386) * [-2628.200] (-2620.736) (-2620.799) (-2627.325) -- 0:05:48 134500 -- (-2642.092) (-2625.510) [-2624.042] (-2623.631) * (-2628.478) (-2625.775) [-2629.834] (-2631.751) -- 0:05:53 135000 -- [-2626.028] (-2623.136) (-2626.026) (-2620.580) * [-2625.424] (-2631.712) (-2628.645) (-2623.402) -- 0:05:52 Average standard deviation of split frequencies: 0.000000 135500 -- [-2623.376] (-2629.326) (-2620.054) (-2625.204) * (-2620.886) [-2624.290] (-2622.229) (-2629.028) -- 0:05:50 136000 -- (-2622.960) (-2627.129) [-2622.864] (-2626.086) * (-2625.927) (-2624.790) (-2626.196) [-2623.889] -- 0:05:49 136500 -- (-2623.987) (-2634.150) [-2616.927] (-2624.055) * [-2628.655] (-2622.580) (-2630.085) (-2633.293) -- 0:05:47 137000 -- (-2627.000) (-2630.255) (-2626.059) [-2625.327] * [-2625.932] (-2636.025) (-2627.081) (-2625.747) -- 0:05:52 137500 -- (-2626.348) [-2623.000] (-2626.130) (-2628.083) * (-2625.835) (-2623.907) (-2622.566) [-2624.262] -- 0:05:51 138000 -- [-2623.104] (-2628.903) (-2626.100) (-2624.070) * [-2623.488] (-2632.766) (-2624.657) (-2624.032) -- 0:05:49 138500 -- (-2630.718) (-2629.269) (-2626.610) [-2625.801] * (-2631.157) [-2625.535] (-2627.148) (-2624.010) -- 0:05:48 139000 -- (-2630.488) (-2630.243) (-2631.054) [-2623.639] * (-2621.792) (-2633.686) (-2625.797) [-2620.861] -- 0:05:46 139500 -- (-2626.416) [-2629.878] (-2628.355) (-2625.694) * (-2623.708) (-2624.435) [-2626.500] (-2624.747) -- 0:05:51 140000 -- (-2628.834) (-2630.459) [-2634.681] (-2633.885) * [-2630.762] (-2626.397) (-2627.961) (-2622.549) -- 0:05:50 Average standard deviation of split frequencies: 0.000000 140500 -- (-2630.562) (-2628.020) [-2623.270] (-2634.837) * (-2629.710) [-2627.729] (-2621.500) (-2622.309) -- 0:05:48 141000 -- [-2621.209] (-2633.394) (-2622.080) (-2632.654) * [-2621.274] (-2623.934) (-2630.422) (-2625.165) -- 0:05:47 141500 -- (-2627.550) [-2623.596] (-2628.085) (-2630.278) * (-2622.479) [-2636.090] (-2627.960) (-2629.883) -- 0:05:45 142000 -- (-2625.638) (-2638.077) (-2627.842) [-2627.251] * (-2623.204) [-2623.330] (-2629.259) (-2621.061) -- 0:05:50 142500 -- [-2629.479] (-2626.995) (-2622.887) (-2638.352) * (-2625.447) (-2622.223) [-2625.691] (-2626.287) -- 0:05:49 143000 -- (-2623.324) (-2630.878) [-2622.603] (-2634.512) * (-2630.438) (-2636.018) [-2621.827] (-2626.775) -- 0:05:47 143500 -- (-2628.946) (-2621.991) (-2633.460) [-2627.111] * [-2626.314] (-2623.074) (-2626.283) (-2629.367) -- 0:05:46 144000 -- (-2629.515) (-2630.124) [-2625.394] (-2624.914) * (-2627.460) (-2623.925) [-2622.343] (-2625.565) -- 0:05:44 144500 -- (-2624.668) (-2632.154) [-2631.091] (-2621.540) * (-2621.085) [-2623.354] (-2623.479) (-2623.143) -- 0:05:49 145000 -- [-2625.367] (-2630.825) (-2627.051) (-2624.717) * (-2621.552) (-2621.141) [-2626.910] (-2623.493) -- 0:05:47 Average standard deviation of split frequencies: 0.000000 145500 -- (-2621.206) (-2632.114) (-2628.884) [-2632.149] * (-2623.867) (-2633.360) (-2620.735) [-2630.010] -- 0:05:46 146000 -- (-2623.115) (-2641.715) (-2622.684) [-2623.175] * (-2631.927) (-2632.551) (-2622.856) [-2629.795] -- 0:05:45 146500 -- (-2632.362) [-2631.586] (-2624.980) (-2627.561) * [-2622.113] (-2629.862) (-2626.857) (-2629.611) -- 0:05:43 147000 -- (-2633.585) (-2627.968) [-2626.359] (-2628.666) * (-2629.626) [-2627.337] (-2623.833) (-2629.892) -- 0:05:48 147500 -- (-2639.856) (-2623.598) [-2626.552] (-2636.471) * (-2624.495) [-2634.811] (-2627.608) (-2631.734) -- 0:05:46 148000 -- [-2625.590] (-2629.345) (-2623.391) (-2630.106) * (-2630.906) (-2624.557) [-2619.859] (-2627.293) -- 0:05:45 148500 -- (-2626.702) [-2628.740] (-2630.638) (-2630.644) * [-2632.678] (-2631.517) (-2623.967) (-2625.083) -- 0:05:44 149000 -- (-2625.264) [-2629.522] (-2628.555) (-2626.380) * [-2622.094] (-2632.650) (-2631.812) (-2623.504) -- 0:05:42 149500 -- (-2628.247) [-2622.248] (-2632.370) (-2622.155) * (-2623.868) (-2627.948) [-2629.020] (-2624.118) -- 0:05:47 150000 -- (-2632.720) [-2631.282] (-2627.789) (-2621.054) * (-2620.286) (-2623.106) (-2623.114) [-2621.236] -- 0:05:45 Average standard deviation of split frequencies: 0.000000 150500 -- (-2618.718) (-2620.738) [-2624.992] (-2622.634) * [-2620.988] (-2626.755) (-2631.798) (-2629.279) -- 0:05:44 151000 -- (-2619.621) [-2625.335] (-2635.444) (-2629.804) * (-2621.035) [-2625.101] (-2630.505) (-2624.569) -- 0:05:42 151500 -- (-2625.420) (-2617.790) (-2637.751) [-2625.674] * [-2624.077] (-2621.340) (-2635.635) (-2623.956) -- 0:05:41 152000 -- (-2629.555) (-2627.241) (-2629.408) [-2628.600] * (-2628.307) (-2626.484) (-2628.143) [-2624.808] -- 0:05:45 152500 -- [-2628.015] (-2626.352) (-2634.058) (-2633.279) * (-2624.829) [-2626.852] (-2622.272) (-2626.404) -- 0:05:44 153000 -- (-2627.615) (-2623.894) (-2633.406) [-2632.730] * (-2630.303) [-2622.164] (-2625.099) (-2622.125) -- 0:05:43 153500 -- [-2632.870] (-2634.632) (-2631.312) (-2628.611) * (-2622.716) [-2627.477] (-2622.322) (-2634.792) -- 0:05:41 154000 -- [-2633.644] (-2626.901) (-2625.311) (-2632.209) * [-2623.669] (-2625.764) (-2626.058) (-2627.934) -- 0:05:46 154500 -- (-2626.333) [-2622.606] (-2623.292) (-2631.309) * [-2626.624] (-2631.740) (-2626.330) (-2623.366) -- 0:05:44 155000 -- (-2633.525) (-2623.168) [-2623.871] (-2630.855) * (-2635.536) [-2620.205] (-2627.798) (-2624.238) -- 0:05:43 Average standard deviation of split frequencies: 0.000000 155500 -- (-2631.807) [-2622.632] (-2630.754) (-2628.592) * [-2631.035] (-2629.870) (-2632.348) (-2622.085) -- 0:05:42 156000 -- (-2628.794) [-2625.396] (-2628.536) (-2627.184) * (-2634.845) (-2629.170) (-2636.060) [-2629.993] -- 0:05:40 156500 -- [-2627.390] (-2637.441) (-2631.739) (-2621.115) * (-2622.628) (-2622.279) (-2628.246) [-2626.546] -- 0:05:44 157000 -- (-2632.111) (-2631.858) [-2623.357] (-2629.825) * (-2628.559) (-2629.417) [-2620.605] (-2621.861) -- 0:05:43 157500 -- (-2626.353) (-2625.959) [-2623.809] (-2629.259) * [-2629.746] (-2625.140) (-2625.489) (-2627.733) -- 0:05:42 158000 -- [-2626.190] (-2622.343) (-2629.046) (-2619.664) * (-2625.834) (-2625.048) [-2625.828] (-2627.669) -- 0:05:41 158500 -- (-2626.889) [-2618.447] (-2623.753) (-2630.917) * (-2624.157) (-2625.390) [-2624.957] (-2626.428) -- 0:05:39 159000 -- [-2619.367] (-2630.544) (-2627.333) (-2626.251) * [-2623.200] (-2628.602) (-2628.329) (-2633.663) -- 0:05:43 159500 -- [-2626.118] (-2635.868) (-2626.208) (-2631.027) * (-2620.115) (-2632.366) (-2619.842) [-2627.790] -- 0:05:42 160000 -- (-2632.409) (-2622.667) [-2634.810] (-2627.023) * (-2626.465) (-2629.744) [-2624.157] (-2627.734) -- 0:05:41 Average standard deviation of split frequencies: 0.000000 160500 -- [-2626.675] (-2622.212) (-2640.889) (-2626.862) * [-2624.328] (-2628.401) (-2629.055) (-2627.709) -- 0:05:39 161000 -- (-2623.995) [-2630.722] (-2630.183) (-2629.682) * (-2626.036) [-2630.924] (-2619.673) (-2627.606) -- 0:05:38 161500 -- [-2623.725] (-2630.420) (-2632.850) (-2633.468) * (-2624.272) (-2624.674) [-2626.666] (-2623.791) -- 0:05:42 162000 -- (-2627.012) [-2622.050] (-2624.151) (-2634.104) * [-2629.459] (-2626.021) (-2621.882) (-2627.414) -- 0:05:41 162500 -- [-2627.135] (-2633.454) (-2620.221) (-2624.690) * (-2624.695) (-2622.348) (-2624.221) [-2629.813] -- 0:05:40 163000 -- (-2626.289) (-2630.661) (-2621.658) [-2622.285] * (-2622.635) (-2621.668) (-2626.554) [-2627.407] -- 0:05:38 163500 -- (-2631.394) (-2620.062) (-2624.836) [-2619.000] * [-2623.053] (-2622.736) (-2627.310) (-2624.572) -- 0:05:37 164000 -- (-2625.841) (-2624.681) (-2624.685) [-2626.327] * (-2626.588) (-2629.047) (-2624.725) [-2624.516] -- 0:05:41 164500 -- (-2636.313) (-2622.847) (-2628.603) [-2623.997] * (-2625.451) (-2631.759) (-2627.621) [-2621.548] -- 0:05:40 165000 -- (-2623.095) [-2630.313] (-2636.613) (-2628.773) * [-2629.375] (-2632.966) (-2634.987) (-2633.509) -- 0:05:39 Average standard deviation of split frequencies: 0.000000 165500 -- [-2628.114] (-2632.703) (-2626.094) (-2627.265) * (-2635.587) [-2623.165] (-2636.115) (-2633.528) -- 0:05:37 166000 -- (-2626.338) (-2625.765) (-2621.638) [-2623.525] * (-2626.577) (-2623.710) [-2628.509] (-2632.419) -- 0:05:36 166500 -- (-2619.900) [-2625.600] (-2630.007) (-2625.164) * (-2634.380) (-2625.916) [-2624.317] (-2636.304) -- 0:05:40 167000 -- (-2624.746) (-2618.322) [-2622.899] (-2623.472) * [-2630.120] (-2631.911) (-2629.810) (-2632.367) -- 0:05:39 167500 -- [-2622.053] (-2631.048) (-2620.594) (-2630.291) * (-2630.917) [-2624.589] (-2625.806) (-2629.480) -- 0:05:37 168000 -- (-2628.473) [-2626.004] (-2631.157) (-2628.831) * (-2623.172) [-2622.881] (-2625.549) (-2630.467) -- 0:05:36 168500 -- (-2621.461) [-2624.287] (-2637.295) (-2621.463) * (-2625.513) (-2625.480) (-2636.774) [-2626.889] -- 0:05:35 169000 -- (-2631.345) (-2628.835) (-2630.545) [-2622.540] * [-2622.452] (-2629.827) (-2633.682) (-2637.020) -- 0:05:39 169500 -- (-2624.060) (-2632.279) (-2631.513) [-2631.234] * (-2626.542) [-2627.730] (-2635.806) (-2626.912) -- 0:05:38 170000 -- [-2624.884] (-2624.481) (-2631.365) (-2625.314) * (-2627.048) [-2621.843] (-2630.656) (-2627.094) -- 0:05:36 Average standard deviation of split frequencies: 0.000000 170500 -- [-2619.212] (-2625.431) (-2623.328) (-2629.426) * [-2624.696] (-2626.595) (-2623.758) (-2627.215) -- 0:05:35 171000 -- [-2631.721] (-2627.274) (-2628.349) (-2628.269) * [-2624.888] (-2621.866) (-2634.627) (-2630.955) -- 0:05:34 171500 -- [-2630.628] (-2622.366) (-2628.610) (-2624.319) * (-2624.979) (-2630.159) [-2626.575] (-2626.929) -- 0:05:38 172000 -- [-2619.135] (-2628.736) (-2627.458) (-2626.733) * (-2623.335) (-2632.880) [-2624.404] (-2629.557) -- 0:05:36 172500 -- (-2624.697) (-2621.464) (-2627.847) [-2626.589] * (-2628.771) (-2631.707) [-2625.696] (-2637.498) -- 0:05:35 173000 -- (-2627.512) (-2624.465) [-2622.798] (-2625.378) * (-2629.593) (-2624.621) (-2626.093) [-2632.211] -- 0:05:34 173500 -- (-2627.205) (-2622.236) [-2626.997] (-2628.112) * (-2623.540) [-2626.684] (-2623.107) (-2633.779) -- 0:05:33 174000 -- (-2630.866) (-2621.203) (-2624.640) [-2619.338] * (-2626.340) [-2624.731] (-2631.126) (-2631.223) -- 0:05:37 174500 -- [-2625.068] (-2628.338) (-2628.213) (-2622.284) * (-2623.456) (-2622.614) [-2625.610] (-2635.547) -- 0:05:35 175000 -- (-2626.656) [-2621.453] (-2630.182) (-2624.479) * [-2621.981] (-2625.646) (-2624.608) (-2630.782) -- 0:05:34 Average standard deviation of split frequencies: 0.000000 175500 -- (-2633.259) (-2626.385) (-2623.647) [-2620.458] * (-2626.826) (-2624.524) (-2624.069) [-2623.516] -- 0:05:33 176000 -- [-2621.566] (-2624.254) (-2629.705) (-2628.843) * [-2623.001] (-2622.764) (-2623.520) (-2620.871) -- 0:05:32 176500 -- [-2622.450] (-2630.768) (-2628.687) (-2626.612) * (-2632.287) (-2625.701) (-2630.014) [-2624.019] -- 0:05:35 177000 -- (-2629.131) [-2623.301] (-2635.232) (-2626.183) * [-2628.757] (-2626.535) (-2638.166) (-2626.616) -- 0:05:34 177500 -- [-2623.112] (-2621.646) (-2633.619) (-2623.605) * [-2624.905] (-2623.263) (-2631.214) (-2628.405) -- 0:05:33 178000 -- (-2624.946) [-2624.275] (-2634.023) (-2629.525) * (-2628.149) (-2634.392) (-2626.286) [-2625.161] -- 0:05:32 178500 -- (-2620.741) (-2627.114) [-2635.992] (-2622.755) * (-2625.914) (-2629.296) [-2624.093] (-2630.873) -- 0:05:31 179000 -- (-2621.950) (-2625.450) (-2634.118) [-2624.002] * (-2627.135) (-2621.885) [-2629.130] (-2622.488) -- 0:05:34 179500 -- (-2625.725) (-2627.422) [-2627.516] (-2630.663) * (-2626.713) (-2619.841) (-2630.935) [-2630.907] -- 0:05:33 180000 -- (-2630.449) [-2625.087] (-2623.661) (-2622.125) * [-2630.640] (-2630.548) (-2624.332) (-2627.157) -- 0:05:32 Average standard deviation of split frequencies: 0.000000 180500 -- (-2632.599) [-2626.945] (-2628.583) (-2627.846) * (-2628.772) (-2626.692) (-2628.751) [-2620.166] -- 0:05:31 181000 -- (-2627.738) [-2627.884] (-2631.930) (-2625.633) * (-2634.744) [-2630.992] (-2626.923) (-2631.576) -- 0:05:30 181500 -- (-2627.196) (-2628.144) (-2627.152) [-2625.503] * (-2639.923) [-2627.088] (-2627.351) (-2632.220) -- 0:05:33 182000 -- (-2625.615) [-2624.294] (-2628.869) (-2628.635) * (-2630.399) [-2628.504] (-2630.244) (-2637.767) -- 0:05:32 182500 -- (-2627.972) (-2632.243) (-2627.612) [-2619.453] * (-2622.770) (-2626.543) [-2622.592] (-2642.370) -- 0:05:31 183000 -- (-2624.510) (-2623.970) [-2626.625] (-2632.615) * (-2627.090) (-2634.215) (-2619.873) [-2635.356] -- 0:05:30 183500 -- (-2628.916) [-2618.506] (-2625.559) (-2628.459) * (-2624.771) [-2626.334] (-2631.626) (-2639.350) -- 0:05:29 184000 -- (-2621.425) (-2625.455) (-2630.173) [-2630.948] * (-2623.653) [-2625.411] (-2626.817) (-2624.015) -- 0:05:32 184500 -- (-2621.005) (-2622.860) [-2624.154] (-2621.571) * [-2623.738] (-2626.146) (-2636.730) (-2635.522) -- 0:05:31 185000 -- (-2631.410) (-2624.886) (-2627.020) [-2623.235] * [-2616.665] (-2621.503) (-2621.142) (-2623.799) -- 0:05:30 Average standard deviation of split frequencies: 0.000000 185500 -- (-2624.557) (-2621.884) [-2619.666] (-2624.758) * [-2621.662] (-2627.443) (-2633.693) (-2626.645) -- 0:05:29 186000 -- [-2621.485] (-2625.170) (-2626.668) (-2626.755) * (-2624.144) [-2626.730] (-2632.964) (-2626.574) -- 0:05:28 186500 -- [-2626.054] (-2621.119) (-2633.273) (-2625.896) * [-2618.773] (-2624.142) (-2629.472) (-2634.314) -- 0:05:31 187000 -- (-2634.037) (-2627.492) [-2624.307] (-2631.795) * (-2626.115) [-2625.177] (-2625.715) (-2626.934) -- 0:05:30 187500 -- (-2632.803) [-2622.441] (-2624.386) (-2628.932) * (-2627.516) (-2627.032) (-2623.303) [-2629.680] -- 0:05:29 188000 -- (-2637.605) (-2627.607) (-2630.031) [-2630.123] * [-2627.625] (-2625.438) (-2636.602) (-2625.869) -- 0:05:28 188500 -- (-2629.691) (-2623.658) (-2626.744) [-2622.688] * (-2621.595) [-2629.659] (-2625.752) (-2632.239) -- 0:05:27 189000 -- (-2627.448) (-2632.614) [-2624.532] (-2624.334) * (-2628.241) (-2624.679) (-2623.892) [-2628.762] -- 0:05:30 189500 -- (-2621.966) [-2633.784] (-2626.107) (-2621.543) * (-2637.391) [-2620.447] (-2626.508) (-2622.644) -- 0:05:29 190000 -- (-2626.025) (-2632.109) (-2630.633) [-2631.861] * (-2623.280) (-2625.812) [-2627.414] (-2630.589) -- 0:05:28 Average standard deviation of split frequencies: 0.000000 190500 -- (-2625.506) (-2628.104) (-2629.496) [-2633.496] * [-2630.071] (-2622.423) (-2632.283) (-2627.551) -- 0:05:27 191000 -- (-2631.566) (-2625.125) (-2628.869) [-2619.997] * (-2628.610) [-2629.051] (-2638.340) (-2623.558) -- 0:05:26 191500 -- (-2625.156) (-2627.473) (-2634.125) [-2626.932] * (-2625.168) [-2629.440] (-2625.834) (-2632.610) -- 0:05:29 192000 -- [-2625.948] (-2626.103) (-2624.716) (-2622.702) * (-2625.357) (-2620.693) (-2623.058) [-2625.210] -- 0:05:28 192500 -- (-2625.659) (-2629.080) (-2626.050) [-2630.598] * (-2625.983) [-2623.434] (-2624.962) (-2630.444) -- 0:05:27 193000 -- (-2627.347) (-2623.375) (-2634.778) [-2629.521] * (-2625.821) [-2621.482] (-2631.438) (-2628.167) -- 0:05:26 193500 -- (-2623.931) (-2631.787) (-2629.338) [-2632.817] * (-2629.017) [-2630.386] (-2624.325) (-2623.381) -- 0:05:25 194000 -- [-2626.385] (-2623.554) (-2631.849) (-2630.075) * (-2631.901) (-2627.033) (-2626.375) [-2628.341] -- 0:05:28 194500 -- [-2630.238] (-2629.487) (-2634.891) (-2631.550) * (-2631.847) (-2626.090) [-2624.879] (-2626.553) -- 0:05:27 195000 -- [-2627.353] (-2625.262) (-2633.329) (-2631.367) * (-2626.526) (-2624.316) (-2620.741) [-2627.923] -- 0:05:26 Average standard deviation of split frequencies: 0.000000 195500 -- [-2626.719] (-2623.900) (-2637.192) (-2634.066) * (-2625.997) (-2631.165) (-2623.077) [-2631.806] -- 0:05:25 196000 -- (-2625.843) [-2624.538] (-2636.993) (-2632.458) * [-2626.560] (-2622.843) (-2629.106) (-2626.085) -- 0:05:24 196500 -- (-2623.689) (-2630.990) [-2629.849] (-2627.321) * (-2629.731) [-2621.985] (-2620.774) (-2620.069) -- 0:05:27 197000 -- (-2628.891) (-2625.679) [-2627.434] (-2631.634) * [-2632.024] (-2619.314) (-2621.832) (-2627.933) -- 0:05:26 197500 -- (-2625.695) [-2623.064] (-2628.783) (-2629.229) * (-2624.597) [-2626.962] (-2618.312) (-2623.709) -- 0:05:25 198000 -- (-2629.320) (-2625.698) (-2622.317) [-2628.402] * (-2633.618) [-2622.032] (-2622.069) (-2633.153) -- 0:05:24 198500 -- (-2639.169) (-2626.680) (-2631.803) [-2623.537] * (-2628.868) [-2630.088] (-2625.738) (-2622.354) -- 0:05:23 199000 -- (-2622.862) (-2635.047) [-2623.023] (-2622.307) * (-2625.606) [-2623.783] (-2628.041) (-2623.708) -- 0:05:26 199500 -- (-2629.114) [-2623.290] (-2625.634) (-2619.255) * (-2626.045) (-2628.111) [-2625.406] (-2627.384) -- 0:05:25 200000 -- (-2626.357) (-2632.368) (-2626.679) [-2630.193] * (-2627.108) (-2631.203) [-2623.004] (-2623.684) -- 0:05:24 Average standard deviation of split frequencies: 0.000000 200500 -- [-2623.821] (-2636.816) (-2632.332) (-2628.667) * (-2626.582) (-2627.028) [-2628.895] (-2625.785) -- 0:05:22 201000 -- [-2627.530] (-2637.906) (-2623.803) (-2629.579) * [-2626.355] (-2621.310) (-2634.399) (-2623.161) -- 0:05:21 201500 -- (-2633.832) (-2634.199) [-2627.998] (-2622.129) * (-2618.258) (-2627.248) (-2631.715) [-2628.554] -- 0:05:24 202000 -- (-2632.976) (-2627.042) [-2628.455] (-2630.583) * (-2623.817) (-2628.714) (-2628.945) [-2629.400] -- 0:05:23 202500 -- (-2624.098) (-2630.901) [-2624.478] (-2623.601) * [-2625.751] (-2632.597) (-2633.557) (-2631.256) -- 0:05:22 203000 -- (-2622.275) [-2630.792] (-2628.727) (-2627.435) * (-2624.541) [-2628.504] (-2625.565) (-2633.373) -- 0:05:21 203500 -- (-2631.076) (-2624.940) (-2627.315) [-2626.812] * [-2621.434] (-2628.873) (-2627.475) (-2624.097) -- 0:05:20 204000 -- (-2625.371) [-2619.632] (-2631.155) (-2624.810) * (-2628.573) (-2625.640) (-2628.059) [-2627.905] -- 0:05:23 204500 -- [-2624.859] (-2630.810) (-2635.349) (-2629.804) * (-2626.075) (-2627.234) (-2623.665) [-2628.420] -- 0:05:22 205000 -- (-2631.794) (-2627.793) (-2623.435) [-2623.416] * (-2627.693) [-2631.371] (-2629.158) (-2628.111) -- 0:05:21 Average standard deviation of split frequencies: 0.000000 205500 -- (-2633.824) [-2622.654] (-2622.572) (-2625.955) * [-2624.620] (-2627.916) (-2625.513) (-2627.821) -- 0:05:20 206000 -- (-2628.467) [-2619.773] (-2635.797) (-2626.295) * (-2624.760) (-2626.575) (-2622.490) [-2623.833] -- 0:05:19 206500 -- (-2628.069) [-2624.255] (-2631.385) (-2629.859) * (-2622.339) (-2627.411) (-2623.689) [-2630.002] -- 0:05:22 207000 -- (-2623.720) (-2631.183) (-2633.533) [-2624.571] * (-2628.905) (-2627.552) [-2628.076] (-2623.404) -- 0:05:21 207500 -- [-2623.882] (-2630.949) (-2629.836) (-2623.055) * (-2627.048) [-2628.803] (-2632.626) (-2626.939) -- 0:05:20 208000 -- [-2625.297] (-2633.088) (-2627.785) (-2632.164) * [-2624.987] (-2631.315) (-2631.312) (-2629.890) -- 0:05:19 208500 -- [-2624.659] (-2631.465) (-2626.703) (-2626.210) * (-2624.535) (-2624.513) (-2628.907) [-2624.899] -- 0:05:18 209000 -- (-2629.474) (-2624.518) [-2619.639] (-2628.538) * (-2631.814) (-2625.814) (-2630.923) [-2618.675] -- 0:05:21 209500 -- (-2629.732) (-2622.074) [-2619.063] (-2624.103) * (-2627.937) (-2630.513) (-2628.141) [-2628.650] -- 0:05:20 210000 -- (-2623.572) (-2624.962) [-2626.589] (-2631.733) * (-2634.258) [-2624.078] (-2628.623) (-2634.547) -- 0:05:19 Average standard deviation of split frequencies: 0.000000 210500 -- (-2622.722) (-2630.046) [-2633.610] (-2632.844) * (-2629.013) (-2629.641) (-2628.592) [-2630.740] -- 0:05:18 211000 -- [-2624.638] (-2630.101) (-2625.608) (-2627.935) * [-2627.487] (-2623.694) (-2627.728) (-2631.646) -- 0:05:17 211500 -- [-2625.480] (-2626.627) (-2627.083) (-2626.003) * (-2626.419) (-2623.014) (-2625.550) [-2621.842] -- 0:05:20 212000 -- (-2624.692) (-2625.757) [-2626.660] (-2628.743) * (-2629.807) (-2623.620) (-2633.457) [-2623.337] -- 0:05:19 212500 -- (-2632.078) [-2623.430] (-2638.169) (-2621.069) * [-2620.338] (-2628.314) (-2631.144) (-2624.283) -- 0:05:18 213000 -- [-2628.428] (-2622.405) (-2623.465) (-2627.238) * [-2623.271] (-2626.310) (-2622.620) (-2623.598) -- 0:05:17 213500 -- (-2622.272) [-2631.465] (-2627.708) (-2623.530) * (-2629.544) [-2624.434] (-2627.667) (-2631.674) -- 0:05:16 214000 -- (-2623.074) [-2621.529] (-2629.883) (-2630.511) * (-2628.316) [-2623.303] (-2630.170) (-2627.473) -- 0:05:19 214500 -- (-2623.550) (-2626.928) [-2625.631] (-2628.639) * [-2632.517] (-2624.725) (-2636.027) (-2630.213) -- 0:05:18 215000 -- (-2623.792) [-2623.636] (-2625.710) (-2623.955) * (-2630.372) [-2622.740] (-2624.017) (-2627.580) -- 0:05:17 Average standard deviation of split frequencies: 0.000000 215500 -- (-2626.998) (-2635.561) [-2618.534] (-2628.580) * [-2623.444] (-2626.968) (-2622.552) (-2621.281) -- 0:05:16 216000 -- (-2627.949) (-2627.416) [-2621.196] (-2624.905) * (-2631.036) (-2625.749) (-2625.752) [-2627.002] -- 0:05:15 216500 -- (-2626.977) (-2625.767) [-2620.005] (-2631.888) * (-2620.921) (-2623.605) (-2630.682) [-2628.292] -- 0:05:18 217000 -- (-2631.367) (-2625.802) [-2624.057] (-2629.083) * [-2630.392] (-2627.906) (-2626.697) (-2632.098) -- 0:05:17 217500 -- [-2621.496] (-2631.047) (-2623.411) (-2623.836) * (-2637.938) (-2626.146) (-2621.260) [-2627.318] -- 0:05:16 218000 -- (-2622.266) [-2622.079] (-2630.238) (-2634.001) * (-2634.336) (-2624.032) (-2635.024) [-2627.088] -- 0:05:15 218500 -- (-2627.537) (-2617.819) (-2629.609) [-2629.158] * (-2629.890) [-2621.897] (-2628.955) (-2627.179) -- 0:05:14 219000 -- [-2624.687] (-2622.802) (-2625.117) (-2620.198) * (-2625.217) (-2634.509) [-2625.380] (-2630.604) -- 0:05:17 219500 -- (-2631.502) (-2624.669) [-2625.336] (-2621.620) * [-2626.119] (-2623.413) (-2622.695) (-2624.878) -- 0:05:16 220000 -- [-2627.132] (-2630.124) (-2629.694) (-2620.363) * (-2623.547) [-2626.017] (-2633.784) (-2622.636) -- 0:05:15 Average standard deviation of split frequencies: 0.000000 220500 -- (-2625.060) (-2622.499) [-2622.119] (-2624.521) * (-2624.059) (-2622.655) (-2643.292) [-2628.420] -- 0:05:14 221000 -- (-2631.581) [-2623.169] (-2618.571) (-2628.373) * (-2635.114) (-2630.010) (-2625.212) [-2626.673] -- 0:05:13 221500 -- (-2622.145) (-2622.252) (-2624.900) [-2623.421] * (-2625.983) (-2624.503) (-2623.196) [-2625.782] -- 0:05:16 222000 -- (-2619.571) (-2621.962) (-2622.669) [-2620.116] * [-2626.682] (-2628.131) (-2626.449) (-2642.604) -- 0:05:15 222500 -- (-2631.052) (-2626.699) [-2622.504] (-2628.442) * (-2625.839) [-2629.649] (-2629.678) (-2621.934) -- 0:05:14 223000 -- [-2622.174] (-2631.695) (-2626.247) (-2625.866) * (-2627.082) (-2629.016) (-2628.381) [-2621.365] -- 0:05:13 223500 -- [-2620.416] (-2631.800) (-2619.999) (-2635.459) * (-2633.716) (-2630.514) [-2623.984] (-2625.065) -- 0:05:12 224000 -- (-2623.409) (-2624.869) (-2626.005) [-2629.141] * [-2625.814] (-2623.763) (-2623.484) (-2622.952) -- 0:05:15 224500 -- (-2630.425) (-2627.901) [-2634.728] (-2630.639) * (-2632.085) [-2621.508] (-2628.550) (-2630.034) -- 0:05:14 225000 -- (-2628.297) [-2619.561] (-2631.204) (-2629.183) * [-2626.225] (-2624.860) (-2625.474) (-2624.863) -- 0:05:13 Average standard deviation of split frequencies: 0.000000 225500 -- (-2639.229) [-2627.121] (-2624.964) (-2627.265) * (-2635.834) [-2625.603] (-2631.252) (-2629.678) -- 0:05:12 226000 -- (-2630.050) (-2625.313) [-2623.219] (-2629.273) * (-2633.043) (-2625.625) (-2633.276) [-2629.367] -- 0:05:11 226500 -- (-2631.276) [-2624.823] (-2623.713) (-2626.195) * (-2625.787) [-2622.492] (-2627.334) (-2621.817) -- 0:05:14 227000 -- (-2631.908) (-2619.187) [-2623.831] (-2635.143) * (-2637.332) (-2634.969) (-2632.516) [-2628.901] -- 0:05:13 227500 -- [-2622.740] (-2623.094) (-2626.984) (-2629.919) * (-2628.679) [-2621.290] (-2625.028) (-2627.394) -- 0:05:12 228000 -- (-2623.367) (-2626.616) (-2624.504) [-2632.175] * (-2627.180) (-2628.761) (-2627.354) [-2628.107] -- 0:05:11 228500 -- (-2632.276) (-2628.769) [-2625.098] (-2628.938) * (-2622.904) (-2626.607) [-2624.638] (-2620.594) -- 0:05:10 229000 -- (-2633.413) [-2623.600] (-2624.171) (-2627.097) * (-2621.544) (-2626.380) (-2625.396) [-2623.326] -- 0:05:13 229500 -- (-2625.747) [-2622.920] (-2631.043) (-2630.558) * (-2629.118) [-2622.637] (-2621.982) (-2623.405) -- 0:05:12 230000 -- (-2628.342) (-2626.779) [-2621.570] (-2626.335) * [-2629.449] (-2621.475) (-2629.104) (-2624.195) -- 0:05:11 Average standard deviation of split frequencies: 0.000000 230500 -- (-2627.570) [-2626.309] (-2620.548) (-2628.261) * (-2626.186) (-2631.576) [-2621.955] (-2621.610) -- 0:05:10 231000 -- (-2624.933) [-2622.465] (-2633.286) (-2633.711) * (-2627.354) (-2635.622) (-2624.128) [-2623.489] -- 0:05:09 231500 -- (-2633.694) (-2632.013) [-2629.651] (-2629.835) * (-2624.221) (-2626.731) [-2622.833] (-2620.072) -- 0:05:12 232000 -- (-2623.263) (-2636.531) (-2626.797) [-2626.705] * (-2622.764) (-2632.247) (-2628.707) [-2629.006] -- 0:05:11 232500 -- (-2626.283) (-2631.216) (-2621.120) [-2622.503] * (-2624.439) [-2627.284] (-2630.321) (-2637.360) -- 0:05:10 233000 -- (-2625.689) [-2627.096] (-2631.973) (-2626.261) * (-2626.920) (-2625.465) [-2624.588] (-2628.611) -- 0:05:09 233500 -- (-2628.362) (-2632.583) (-2632.298) [-2624.448] * (-2625.494) (-2624.768) [-2627.889] (-2624.233) -- 0:05:11 234000 -- (-2632.313) [-2629.688] (-2626.470) (-2624.459) * (-2625.745) (-2632.604) [-2627.019] (-2624.508) -- 0:05:10 234500 -- (-2623.116) (-2627.301) (-2631.145) [-2625.386] * (-2624.026) (-2627.955) [-2618.735] (-2619.523) -- 0:05:10 235000 -- (-2620.635) (-2632.816) [-2630.287] (-2627.451) * (-2624.371) [-2622.304] (-2619.905) (-2630.852) -- 0:05:09 Average standard deviation of split frequencies: 0.000000 235500 -- (-2623.542) (-2626.617) (-2626.592) [-2624.269] * (-2625.033) (-2632.206) (-2623.994) [-2629.765] -- 0:05:08 236000 -- (-2627.338) [-2625.509] (-2630.315) (-2623.827) * (-2626.062) (-2628.393) [-2621.027] (-2637.314) -- 0:05:10 236500 -- [-2622.562] (-2627.243) (-2629.036) (-2639.156) * (-2633.107) (-2625.044) (-2632.008) [-2628.996] -- 0:05:09 237000 -- [-2624.939] (-2625.832) (-2633.150) (-2625.999) * (-2625.071) (-2626.502) (-2627.191) [-2623.312] -- 0:05:09 237500 -- [-2622.176] (-2627.504) (-2636.018) (-2625.982) * [-2625.116] (-2627.268) (-2633.308) (-2629.819) -- 0:05:08 238000 -- [-2624.033] (-2625.943) (-2635.854) (-2624.795) * (-2629.659) [-2624.562] (-2622.908) (-2630.298) -- 0:05:07 238500 -- [-2620.326] (-2625.955) (-2629.001) (-2626.849) * [-2623.078] (-2621.915) (-2627.752) (-2627.157) -- 0:05:09 239000 -- (-2625.735) (-2634.021) [-2620.960] (-2625.874) * (-2625.112) (-2625.052) (-2636.611) [-2625.476] -- 0:05:08 239500 -- (-2626.024) (-2631.975) [-2625.265] (-2624.490) * (-2635.619) (-2632.426) [-2620.694] (-2620.142) -- 0:05:08 240000 -- (-2636.913) (-2626.887) (-2631.849) [-2631.011] * (-2625.579) (-2624.976) [-2619.864] (-2631.734) -- 0:05:07 Average standard deviation of split frequencies: 0.000000 240500 -- [-2624.970] (-2625.986) (-2635.268) (-2622.560) * (-2625.397) (-2623.411) [-2621.106] (-2625.999) -- 0:05:09 241000 -- (-2634.779) [-2629.017] (-2626.169) (-2630.960) * (-2622.123) (-2622.442) (-2626.301) [-2625.537] -- 0:05:08 241500 -- (-2631.393) (-2628.157) (-2628.540) [-2622.525] * (-2627.464) (-2623.019) [-2623.116] (-2633.319) -- 0:05:07 242000 -- (-2639.795) [-2625.408] (-2626.976) (-2624.334) * [-2619.459] (-2622.670) (-2626.850) (-2624.554) -- 0:05:06 242500 -- (-2625.065) [-2632.538] (-2623.804) (-2623.770) * (-2627.639) (-2623.806) [-2627.694] (-2628.060) -- 0:05:06 243000 -- [-2622.119] (-2629.818) (-2624.806) (-2623.732) * (-2629.693) [-2623.342] (-2624.160) (-2622.816) -- 0:05:08 243500 -- (-2624.666) (-2630.381) (-2621.785) [-2621.961] * [-2624.721] (-2625.532) (-2637.379) (-2628.769) -- 0:05:07 244000 -- (-2622.933) [-2619.532] (-2621.683) (-2627.827) * (-2626.030) (-2633.894) (-2631.975) [-2620.298] -- 0:05:06 244500 -- [-2627.813] (-2622.556) (-2625.390) (-2620.810) * (-2624.983) [-2625.404] (-2622.707) (-2629.192) -- 0:05:05 245000 -- (-2630.524) (-2626.418) (-2630.438) [-2623.674] * (-2625.626) (-2620.894) [-2628.711] (-2623.300) -- 0:05:05 Average standard deviation of split frequencies: 0.000000 245500 -- (-2630.280) (-2625.407) [-2625.775] (-2627.892) * [-2624.675] (-2627.504) (-2633.089) (-2625.151) -- 0:05:07 246000 -- (-2633.252) [-2620.387] (-2635.986) (-2624.585) * [-2632.986] (-2621.590) (-2623.043) (-2633.748) -- 0:05:06 246500 -- (-2630.475) [-2626.432] (-2628.525) (-2626.617) * [-2633.275] (-2629.831) (-2630.014) (-2634.948) -- 0:05:05 247000 -- (-2623.828) [-2624.542] (-2624.910) (-2626.183) * (-2632.267) (-2630.300) [-2629.625] (-2625.000) -- 0:05:04 247500 -- (-2627.368) [-2625.001] (-2625.556) (-2624.492) * (-2629.001) (-2627.679) (-2624.237) [-2625.564] -- 0:05:04 248000 -- [-2629.201] (-2625.960) (-2628.159) (-2632.834) * (-2622.232) [-2632.522] (-2619.548) (-2624.859) -- 0:05:06 248500 -- (-2628.332) [-2635.044] (-2624.731) (-2628.635) * (-2627.133) (-2625.605) [-2620.724] (-2623.425) -- 0:05:05 249000 -- (-2625.732) (-2622.298) (-2624.260) [-2621.684] * [-2623.017] (-2633.483) (-2623.146) (-2624.716) -- 0:05:04 249500 -- (-2624.416) [-2621.787] (-2629.618) (-2626.276) * (-2621.890) (-2627.509) [-2626.093] (-2631.067) -- 0:05:03 250000 -- [-2627.077] (-2622.415) (-2623.216) (-2629.175) * (-2618.465) [-2628.961] (-2624.519) (-2626.938) -- 0:05:03 Average standard deviation of split frequencies: 0.000000 250500 -- (-2621.225) (-2630.429) [-2622.628] (-2635.538) * (-2625.476) (-2632.456) [-2626.870] (-2629.695) -- 0:05:05 251000 -- (-2629.520) (-2631.479) [-2632.621] (-2626.373) * (-2624.291) (-2624.260) [-2625.882] (-2631.853) -- 0:05:04 251500 -- (-2622.325) (-2627.264) [-2625.313] (-2627.352) * (-2625.296) (-2622.931) (-2626.234) [-2622.926] -- 0:05:03 252000 -- (-2629.340) [-2635.147] (-2625.357) (-2629.645) * [-2626.980] (-2620.680) (-2627.465) (-2625.048) -- 0:05:02 252500 -- (-2638.544) (-2626.780) [-2622.092] (-2627.974) * (-2627.007) (-2631.811) (-2621.390) [-2626.838] -- 0:05:01 253000 -- (-2628.435) (-2622.483) [-2618.723] (-2628.813) * (-2632.557) (-2628.673) [-2620.019] (-2627.131) -- 0:05:04 253500 -- (-2621.549) (-2624.554) (-2629.830) [-2625.444] * [-2635.025] (-2630.390) (-2624.300) (-2631.809) -- 0:05:03 254000 -- (-2626.902) (-2623.754) (-2629.466) [-2622.706] * (-2636.102) (-2625.501) [-2620.376] (-2635.545) -- 0:05:02 254500 -- (-2622.287) (-2627.977) [-2630.149] (-2624.539) * (-2634.203) [-2621.563] (-2628.012) (-2631.484) -- 0:05:01 255000 -- (-2624.622) (-2628.634) [-2627.875] (-2622.894) * [-2622.156] (-2622.251) (-2630.380) (-2624.662) -- 0:05:00 Average standard deviation of split frequencies: 0.000000 255500 -- [-2620.198] (-2627.274) (-2625.372) (-2626.050) * (-2627.284) (-2622.780) [-2624.497] (-2626.647) -- 0:05:03 256000 -- (-2621.779) (-2633.083) [-2623.945] (-2621.269) * (-2626.438) (-2620.820) [-2625.526] (-2636.433) -- 0:05:02 256500 -- [-2625.362] (-2624.862) (-2630.944) (-2626.013) * (-2625.599) (-2626.357) [-2620.802] (-2631.427) -- 0:05:01 257000 -- (-2632.485) (-2623.161) [-2627.954] (-2628.422) * (-2626.647) (-2624.650) (-2622.962) [-2626.423] -- 0:05:00 257500 -- (-2624.263) (-2632.195) (-2629.848) [-2622.426] * (-2627.672) (-2631.438) [-2625.682] (-2631.836) -- 0:04:59 258000 -- (-2630.470) (-2629.292) [-2629.870] (-2623.659) * [-2624.430] (-2634.185) (-2635.632) (-2636.362) -- 0:05:01 258500 -- (-2620.319) (-2630.307) [-2625.693] (-2624.512) * (-2621.988) (-2627.857) [-2624.555] (-2638.685) -- 0:05:01 259000 -- (-2628.364) (-2641.855) [-2620.437] (-2620.899) * (-2629.555) (-2635.657) (-2624.245) [-2625.131] -- 0:05:00 259500 -- (-2623.852) (-2625.413) [-2628.958] (-2626.000) * (-2628.351) [-2621.296] (-2620.044) (-2634.052) -- 0:04:59 260000 -- (-2624.902) [-2622.698] (-2632.060) (-2630.883) * (-2631.618) [-2623.790] (-2624.177) (-2626.352) -- 0:04:58 Average standard deviation of split frequencies: 0.000000 260500 -- (-2635.969) (-2626.850) [-2619.044] (-2627.313) * [-2627.318] (-2631.977) (-2621.589) (-2623.653) -- 0:05:00 261000 -- [-2625.253] (-2628.266) (-2622.373) (-2628.339) * (-2622.557) [-2627.136] (-2628.739) (-2640.527) -- 0:05:00 261500 -- (-2625.165) (-2619.008) [-2618.438] (-2620.398) * (-2629.738) (-2622.027) [-2627.125] (-2624.587) -- 0:04:59 262000 -- [-2631.138] (-2626.515) (-2627.855) (-2629.169) * [-2625.684] (-2623.689) (-2624.726) (-2632.763) -- 0:04:58 262500 -- (-2625.461) (-2623.777) (-2619.224) [-2631.515] * (-2637.770) (-2627.397) [-2625.909] (-2623.625) -- 0:04:57 263000 -- (-2626.257) (-2623.887) (-2625.044) [-2630.318] * (-2631.620) (-2629.763) (-2627.895) [-2628.065] -- 0:04:59 263500 -- (-2629.602) [-2624.924] (-2628.578) (-2630.686) * [-2626.358] (-2629.497) (-2631.219) (-2628.912) -- 0:04:59 264000 -- (-2629.873) [-2621.337] (-2621.507) (-2627.387) * (-2619.083) (-2631.281) (-2625.902) [-2619.941] -- 0:04:58 264500 -- [-2628.647] (-2623.567) (-2626.058) (-2625.986) * (-2622.424) (-2624.887) (-2629.856) [-2622.530] -- 0:04:57 265000 -- (-2627.313) [-2632.750] (-2628.415) (-2622.339) * (-2628.212) (-2623.157) (-2620.406) [-2623.864] -- 0:04:56 Average standard deviation of split frequencies: 0.000000 265500 -- [-2623.961] (-2632.067) (-2623.468) (-2627.875) * (-2631.804) [-2625.453] (-2625.140) (-2623.747) -- 0:04:58 266000 -- (-2622.870) (-2626.928) [-2632.486] (-2621.399) * (-2627.330) (-2630.875) (-2626.821) [-2626.045] -- 0:04:58 266500 -- (-2633.107) [-2632.164] (-2629.835) (-2625.272) * (-2628.492) [-2631.507] (-2631.337) (-2628.183) -- 0:04:57 267000 -- (-2625.955) (-2631.113) [-2626.743] (-2626.611) * [-2628.026] (-2623.033) (-2629.609) (-2634.267) -- 0:04:56 267500 -- (-2621.243) (-2626.608) (-2628.938) [-2634.463] * [-2629.218] (-2625.252) (-2638.315) (-2622.780) -- 0:04:55 268000 -- (-2630.605) [-2627.521] (-2623.704) (-2627.602) * [-2629.140] (-2622.286) (-2632.785) (-2626.980) -- 0:04:57 268500 -- (-2627.071) [-2624.460] (-2626.811) (-2636.458) * [-2625.550] (-2627.077) (-2628.323) (-2622.687) -- 0:04:56 269000 -- [-2628.548] (-2625.060) (-2624.932) (-2637.381) * (-2625.331) (-2627.911) (-2626.706) [-2623.200] -- 0:04:56 269500 -- [-2626.939] (-2622.980) (-2630.586) (-2626.410) * (-2623.125) [-2622.237] (-2629.359) (-2625.136) -- 0:04:55 270000 -- (-2632.732) (-2623.640) [-2623.233] (-2626.529) * (-2632.192) (-2631.613) (-2626.526) [-2625.467] -- 0:04:54 Average standard deviation of split frequencies: 0.000000 270500 -- (-2631.781) (-2626.882) [-2623.474] (-2624.265) * (-2621.803) (-2621.276) [-2625.394] (-2629.110) -- 0:04:56 271000 -- (-2635.177) (-2630.171) (-2625.551) [-2628.376] * [-2632.080] (-2629.007) (-2628.260) (-2630.535) -- 0:04:55 271500 -- (-2632.720) [-2624.298] (-2624.125) (-2625.893) * (-2629.537) (-2621.880) (-2633.382) [-2619.713] -- 0:04:55 272000 -- (-2622.251) [-2628.440] (-2628.811) (-2626.760) * [-2626.460] (-2628.745) (-2626.119) (-2630.191) -- 0:04:54 272500 -- (-2630.279) (-2635.622) [-2627.010] (-2622.049) * (-2627.083) (-2627.599) [-2629.173] (-2626.785) -- 0:04:53 273000 -- [-2627.346] (-2622.117) (-2631.484) (-2629.880) * (-2624.547) (-2622.167) [-2619.519] (-2626.120) -- 0:04:55 273500 -- (-2632.670) (-2630.852) (-2628.024) [-2632.296] * (-2629.712) (-2627.453) (-2627.453) [-2624.123] -- 0:04:54 274000 -- (-2629.989) (-2625.896) (-2629.337) [-2623.808] * (-2626.302) (-2636.362) [-2622.364] (-2635.306) -- 0:04:54 274500 -- (-2626.097) (-2627.430) [-2624.347] (-2624.712) * (-2636.093) (-2622.979) (-2626.317) [-2624.522] -- 0:04:53 275000 -- (-2627.845) (-2625.185) (-2627.064) [-2625.730] * (-2625.695) [-2628.176] (-2634.755) (-2624.386) -- 0:04:52 Average standard deviation of split frequencies: 0.000000 275500 -- (-2625.020) (-2624.583) (-2626.238) [-2629.594] * (-2626.801) (-2624.945) [-2626.182] (-2626.570) -- 0:04:54 276000 -- (-2627.257) (-2626.290) [-2625.888] (-2623.977) * (-2628.419) (-2635.288) [-2623.961] (-2630.497) -- 0:04:53 276500 -- [-2626.131] (-2630.344) (-2625.835) (-2631.168) * (-2626.294) [-2629.024] (-2623.913) (-2639.378) -- 0:04:53 277000 -- (-2626.617) (-2633.584) [-2626.019] (-2627.474) * (-2629.510) (-2625.410) [-2622.329] (-2630.440) -- 0:04:52 277500 -- [-2626.143] (-2628.943) (-2630.133) (-2630.104) * (-2624.705) [-2622.617] (-2627.236) (-2624.740) -- 0:04:51 278000 -- [-2620.537] (-2622.049) (-2628.592) (-2629.914) * (-2624.484) [-2622.707] (-2625.041) (-2634.117) -- 0:04:53 278500 -- (-2628.903) (-2623.924) [-2629.085] (-2630.778) * (-2620.962) (-2632.068) (-2637.506) [-2626.033] -- 0:04:52 279000 -- (-2626.402) (-2634.258) (-2631.869) [-2619.972] * (-2625.740) (-2627.293) [-2623.232] (-2627.537) -- 0:04:52 279500 -- [-2630.205] (-2625.336) (-2623.974) (-2627.231) * (-2628.216) (-2625.217) [-2619.209] (-2629.196) -- 0:04:51 280000 -- (-2631.782) (-2631.437) [-2628.254] (-2631.751) * (-2629.983) (-2627.066) [-2624.540] (-2631.629) -- 0:04:50 Average standard deviation of split frequencies: 0.000000 280500 -- (-2624.422) (-2624.218) (-2628.729) [-2621.063] * [-2631.568] (-2621.330) (-2636.606) (-2625.350) -- 0:04:52 281000 -- (-2624.024) (-2628.219) [-2622.146] (-2624.358) * (-2633.693) (-2626.748) [-2626.509] (-2622.962) -- 0:04:51 281500 -- (-2627.630) (-2622.490) [-2623.919] (-2627.706) * (-2624.373) [-2629.282] (-2625.951) (-2624.314) -- 0:04:50 282000 -- (-2625.803) (-2626.541) (-2628.086) [-2625.003] * (-2625.121) (-2624.110) [-2624.277] (-2631.245) -- 0:04:50 282500 -- (-2626.323) (-2621.381) (-2630.506) [-2634.773] * (-2623.471) [-2623.868] (-2628.146) (-2623.659) -- 0:04:49 283000 -- (-2625.096) [-2629.295] (-2628.115) (-2621.428) * (-2631.675) (-2625.258) [-2625.992] (-2626.326) -- 0:04:51 283500 -- (-2628.887) (-2627.762) [-2629.985] (-2625.525) * [-2627.644] (-2622.860) (-2629.113) (-2628.789) -- 0:04:50 284000 -- (-2623.601) (-2630.842) (-2623.226) [-2626.493] * (-2626.284) (-2629.943) (-2625.622) [-2621.823] -- 0:04:49 284500 -- (-2625.258) (-2629.735) [-2624.381] (-2628.584) * (-2622.290) [-2620.806] (-2640.120) (-2624.869) -- 0:04:49 285000 -- (-2632.796) (-2625.308) [-2624.234] (-2623.295) * (-2623.309) [-2620.289] (-2633.600) (-2623.359) -- 0:04:48 Average standard deviation of split frequencies: 0.000000 285500 -- (-2635.226) (-2620.912) [-2624.236] (-2628.578) * [-2622.109] (-2624.468) (-2629.911) (-2629.459) -- 0:04:50 286000 -- (-2626.039) (-2623.772) [-2623.914] (-2625.763) * (-2626.326) (-2628.104) [-2628.971] (-2628.871) -- 0:04:49 286500 -- (-2624.849) (-2628.044) (-2634.708) [-2622.718] * (-2621.642) [-2621.369] (-2630.583) (-2621.420) -- 0:04:48 287000 -- (-2628.026) (-2622.487) [-2625.887] (-2626.127) * (-2621.613) (-2625.068) (-2626.837) [-2622.855] -- 0:04:48 287500 -- (-2626.990) (-2627.609) (-2631.474) [-2624.770] * (-2634.240) [-2620.345] (-2623.503) (-2622.861) -- 0:04:47 288000 -- [-2628.776] (-2627.436) (-2628.524) (-2623.907) * (-2631.409) (-2620.100) (-2626.094) [-2628.501] -- 0:04:49 288500 -- [-2622.383] (-2627.530) (-2631.068) (-2628.552) * (-2628.972) (-2621.179) (-2633.506) [-2623.935] -- 0:04:48 289000 -- [-2624.534] (-2631.397) (-2626.404) (-2627.723) * (-2636.249) (-2629.892) (-2624.240) [-2625.828] -- 0:04:47 289500 -- (-2618.466) (-2626.909) [-2629.217] (-2624.311) * (-2635.580) [-2625.775] (-2622.728) (-2625.814) -- 0:04:47 290000 -- (-2631.196) [-2622.490] (-2626.382) (-2624.414) * [-2626.411] (-2617.651) (-2626.078) (-2623.924) -- 0:04:46 Average standard deviation of split frequencies: 0.000000 290500 -- (-2633.584) [-2621.549] (-2621.954) (-2630.735) * (-2629.787) (-2622.810) [-2625.614] (-2616.151) -- 0:04:48 291000 -- (-2621.350) (-2634.626) [-2621.391] (-2628.543) * [-2628.391] (-2623.815) (-2621.670) (-2633.367) -- 0:04:47 291500 -- (-2634.379) (-2626.857) [-2624.168] (-2633.507) * (-2621.671) (-2625.459) [-2622.795] (-2620.902) -- 0:04:46 292000 -- (-2629.795) [-2623.755] (-2629.465) (-2637.682) * (-2623.123) (-2624.998) (-2628.335) [-2622.540] -- 0:04:46 292500 -- (-2628.807) [-2626.924] (-2627.905) (-2625.401) * (-2624.745) (-2621.031) (-2622.032) [-2621.012] -- 0:04:45 293000 -- (-2630.248) [-2623.683] (-2630.014) (-2628.169) * [-2620.581] (-2633.136) (-2624.661) (-2623.422) -- 0:04:47 293500 -- [-2624.117] (-2618.233) (-2630.317) (-2635.088) * (-2626.820) (-2622.616) (-2626.705) [-2627.251] -- 0:04:46 294000 -- (-2622.184) [-2624.640] (-2632.269) (-2629.182) * (-2625.997) (-2623.600) [-2626.298] (-2623.962) -- 0:04:45 294500 -- [-2630.616] (-2624.807) (-2625.794) (-2621.335) * (-2624.447) (-2625.522) (-2622.983) [-2631.524] -- 0:04:45 295000 -- (-2622.097) (-2621.590) (-2622.931) [-2633.246] * (-2633.609) (-2621.801) [-2622.588] (-2628.147) -- 0:04:44 Average standard deviation of split frequencies: 0.000000 295500 -- (-2629.507) [-2622.001] (-2628.982) (-2629.866) * (-2630.046) [-2620.408] (-2622.122) (-2622.636) -- 0:04:46 296000 -- [-2626.891] (-2631.977) (-2633.653) (-2625.540) * (-2623.368) (-2621.933) [-2626.820] (-2634.979) -- 0:04:45 296500 -- (-2631.003) [-2623.632] (-2628.347) (-2625.990) * (-2632.716) [-2617.698] (-2627.418) (-2621.928) -- 0:04:44 297000 -- (-2623.281) [-2626.590] (-2628.358) (-2629.784) * (-2625.996) [-2620.927] (-2632.369) (-2625.635) -- 0:04:44 297500 -- (-2630.704) (-2627.003) [-2625.958] (-2630.240) * (-2630.452) [-2622.454] (-2629.518) (-2625.857) -- 0:04:43 298000 -- (-2627.585) (-2621.137) [-2627.127] (-2625.354) * (-2623.533) (-2631.679) (-2624.497) [-2623.305] -- 0:04:45 298500 -- (-2627.283) (-2621.119) [-2627.494] (-2622.135) * (-2625.596) (-2632.088) (-2631.738) [-2624.221] -- 0:04:44 299000 -- (-2625.931) [-2626.045] (-2627.015) (-2631.173) * (-2623.090) (-2639.095) [-2633.300] (-2624.377) -- 0:04:43 299500 -- (-2626.641) (-2621.942) [-2632.303] (-2634.377) * [-2619.734] (-2635.015) (-2625.501) (-2629.590) -- 0:04:43 300000 -- [-2623.709] (-2626.010) (-2633.622) (-2636.973) * [-2619.249] (-2642.103) (-2629.056) (-2622.006) -- 0:04:42 Average standard deviation of split frequencies: 0.000000 300500 -- (-2628.361) [-2629.789] (-2630.282) (-2624.390) * (-2625.245) (-2638.550) (-2624.178) [-2623.437] -- 0:04:43 301000 -- [-2627.873] (-2629.405) (-2625.407) (-2628.338) * (-2623.234) (-2630.934) (-2628.459) [-2626.005] -- 0:04:43 301500 -- (-2621.131) (-2632.636) [-2624.420] (-2631.430) * (-2638.533) (-2625.368) (-2624.851) [-2623.812] -- 0:04:42 302000 -- (-2622.807) [-2625.363] (-2622.685) (-2625.779) * (-2633.264) [-2622.655] (-2628.672) (-2625.994) -- 0:04:41 302500 -- (-2630.822) [-2628.283] (-2633.894) (-2629.996) * (-2627.589) (-2624.974) [-2628.687] (-2620.751) -- 0:04:41 303000 -- (-2632.647) (-2621.609) [-2624.613] (-2634.738) * [-2629.364] (-2623.855) (-2629.601) (-2619.963) -- 0:04:42 303500 -- (-2625.106) [-2629.235] (-2628.955) (-2628.174) * (-2626.626) [-2622.767] (-2627.779) (-2624.456) -- 0:04:42 304000 -- (-2623.902) [-2627.087] (-2636.080) (-2637.064) * (-2636.434) (-2622.923) [-2620.197] (-2630.556) -- 0:04:41 304500 -- (-2628.347) (-2624.999) [-2630.321] (-2627.559) * (-2622.443) (-2628.078) (-2624.729) [-2622.130] -- 0:04:40 305000 -- [-2622.719] (-2622.132) (-2622.204) (-2630.572) * (-2624.684) (-2624.732) (-2627.910) [-2621.695] -- 0:04:40 Average standard deviation of split frequencies: 0.000000 305500 -- [-2632.019] (-2630.261) (-2623.595) (-2619.267) * (-2622.255) (-2622.910) [-2620.775] (-2629.354) -- 0:04:41 306000 -- (-2636.483) [-2624.929] (-2624.776) (-2625.623) * (-2622.849) (-2630.148) (-2631.558) [-2623.423] -- 0:04:41 306500 -- (-2622.342) (-2626.723) (-2626.469) [-2626.740] * (-2621.521) [-2627.742] (-2625.330) (-2628.124) -- 0:04:40 307000 -- (-2624.221) (-2630.825) [-2621.545] (-2618.979) * (-2634.564) (-2624.114) (-2632.203) [-2621.836] -- 0:04:39 307500 -- [-2620.817] (-2629.266) (-2624.997) (-2627.171) * (-2631.856) (-2624.060) [-2630.893] (-2630.479) -- 0:04:39 308000 -- [-2621.583] (-2624.467) (-2624.599) (-2631.049) * (-2630.964) [-2624.782] (-2624.296) (-2626.997) -- 0:04:40 308500 -- (-2620.164) [-2629.866] (-2635.185) (-2629.802) * (-2625.310) (-2632.081) [-2622.916] (-2630.595) -- 0:04:40 309000 -- (-2625.411) (-2628.036) (-2631.622) [-2622.293] * (-2624.789) (-2626.343) (-2626.659) [-2624.067] -- 0:04:39 309500 -- (-2624.190) (-2629.609) (-2625.403) [-2618.904] * [-2628.381] (-2622.362) (-2624.198) (-2623.022) -- 0:04:38 310000 -- (-2623.877) (-2637.345) [-2629.254] (-2620.878) * (-2626.280) (-2626.146) (-2620.461) [-2624.730] -- 0:04:38 Average standard deviation of split frequencies: 0.000000 310500 -- (-2625.330) (-2632.852) [-2631.107] (-2628.151) * [-2623.296] (-2628.264) (-2629.795) (-2624.203) -- 0:04:39 311000 -- (-2625.618) (-2633.961) (-2626.024) [-2621.503] * (-2627.166) (-2628.914) [-2628.496] (-2626.113) -- 0:04:39 311500 -- (-2634.080) [-2627.329] (-2632.954) (-2629.137) * (-2623.869) (-2624.390) [-2633.509] (-2631.201) -- 0:04:38 312000 -- (-2630.880) (-2624.846) (-2626.389) [-2620.010] * (-2630.655) (-2627.738) (-2623.466) [-2625.585] -- 0:04:37 312500 -- (-2630.860) (-2629.903) [-2626.402] (-2625.257) * (-2629.126) (-2625.793) (-2629.102) [-2622.478] -- 0:04:37 313000 -- (-2630.441) [-2627.428] (-2625.826) (-2630.498) * (-2621.902) (-2624.753) (-2620.299) [-2629.992] -- 0:04:38 313500 -- (-2625.156) [-2623.571] (-2623.111) (-2623.440) * (-2627.465) (-2627.342) [-2622.837] (-2626.029) -- 0:04:38 314000 -- [-2623.685] (-2624.910) (-2635.792) (-2623.769) * (-2624.161) [-2630.361] (-2624.214) (-2626.269) -- 0:04:37 314500 -- (-2629.404) (-2629.242) (-2633.935) [-2622.558] * (-2626.804) [-2624.581] (-2634.524) (-2630.060) -- 0:04:38 315000 -- (-2630.017) [-2621.617] (-2630.640) (-2626.667) * [-2621.807] (-2624.710) (-2627.281) (-2622.613) -- 0:04:38 Average standard deviation of split frequencies: 0.000000 315500 -- [-2623.234] (-2631.837) (-2627.397) (-2637.396) * [-2628.524] (-2623.290) (-2634.968) (-2625.472) -- 0:04:37 316000 -- [-2617.335] (-2628.491) (-2629.846) (-2630.225) * (-2626.127) (-2621.860) [-2623.866] (-2626.767) -- 0:04:37 316500 -- [-2625.001] (-2632.040) (-2624.308) (-2626.692) * (-2628.076) (-2633.152) (-2623.890) [-2630.969] -- 0:04:36 317000 -- (-2626.484) (-2627.716) (-2625.258) [-2622.639] * [-2626.944] (-2635.560) (-2633.838) (-2625.992) -- 0:04:37 317500 -- (-2630.786) (-2624.668) [-2626.531] (-2625.334) * [-2629.106] (-2635.837) (-2628.952) (-2623.302) -- 0:04:37 318000 -- (-2626.774) (-2622.699) [-2630.546] (-2629.770) * [-2626.079] (-2625.310) (-2630.932) (-2627.709) -- 0:04:36 318500 -- [-2629.879] (-2630.525) (-2624.501) (-2627.653) * [-2626.349] (-2628.086) (-2628.758) (-2623.932) -- 0:04:36 319000 -- (-2629.961) (-2628.142) (-2622.289) [-2627.393] * [-2631.157] (-2634.067) (-2626.816) (-2626.280) -- 0:04:35 319500 -- (-2621.952) (-2625.406) (-2622.220) [-2630.640] * (-2626.821) (-2625.274) (-2631.646) [-2624.706] -- 0:04:36 320000 -- (-2623.098) (-2626.438) [-2622.005] (-2627.669) * [-2627.626] (-2620.875) (-2631.826) (-2626.443) -- 0:04:36 Average standard deviation of split frequencies: 0.000000 320500 -- [-2619.002] (-2618.952) (-2629.294) (-2623.036) * (-2622.709) [-2627.189] (-2623.670) (-2620.685) -- 0:04:35 321000 -- (-2633.615) (-2625.680) (-2621.986) [-2626.142] * (-2625.853) (-2629.600) (-2625.614) [-2628.496] -- 0:04:34 321500 -- (-2621.651) (-2629.083) [-2629.364] (-2626.097) * (-2631.050) (-2625.141) (-2627.568) [-2624.318] -- 0:04:34 322000 -- (-2623.685) [-2636.271] (-2632.749) (-2629.737) * (-2626.419) [-2623.773] (-2631.681) (-2618.774) -- 0:04:35 322500 -- [-2621.158] (-2630.061) (-2633.069) (-2621.938) * (-2629.426) (-2639.856) (-2626.401) [-2623.101] -- 0:04:35 323000 -- (-2630.301) (-2628.728) [-2621.335] (-2624.524) * (-2621.912) (-2627.396) (-2626.068) [-2622.827] -- 0:04:34 323500 -- (-2630.415) [-2623.415] (-2623.777) (-2626.431) * (-2627.153) (-2622.354) [-2623.147] (-2629.325) -- 0:04:33 324000 -- (-2630.938) (-2627.589) (-2627.351) [-2624.112] * [-2627.527] (-2628.171) (-2619.882) (-2627.784) -- 0:04:33 324500 -- [-2617.863] (-2626.042) (-2627.404) (-2626.560) * (-2622.604) (-2630.016) [-2622.197] (-2627.105) -- 0:04:34 325000 -- [-2628.103] (-2626.773) (-2636.567) (-2627.828) * (-2623.922) [-2624.029] (-2631.933) (-2627.901) -- 0:04:34 Average standard deviation of split frequencies: 0.000289 325500 -- (-2622.004) (-2623.186) [-2627.580] (-2627.542) * [-2629.121] (-2624.908) (-2624.654) (-2621.317) -- 0:04:33 326000 -- (-2628.801) (-2628.349) (-2627.254) [-2624.647] * [-2624.187] (-2625.055) (-2632.723) (-2624.083) -- 0:04:32 326500 -- (-2630.764) (-2621.468) [-2630.018] (-2633.089) * [-2622.621] (-2631.574) (-2627.799) (-2624.852) -- 0:04:32 327000 -- (-2633.307) (-2627.367) [-2630.779] (-2627.150) * (-2626.300) (-2626.916) [-2626.740] (-2624.471) -- 0:04:33 327500 -- [-2627.447] (-2625.119) (-2630.523) (-2623.195) * (-2624.220) (-2621.775) [-2632.038] (-2626.380) -- 0:04:33 328000 -- (-2630.185) (-2631.848) (-2633.448) [-2623.162] * (-2620.819) (-2637.483) (-2629.180) [-2623.353] -- 0:04:32 328500 -- (-2626.478) (-2623.455) (-2625.337) [-2626.689] * (-2624.584) [-2629.520] (-2624.807) (-2625.696) -- 0:04:31 329000 -- (-2624.337) (-2620.931) [-2626.580] (-2627.272) * [-2625.037] (-2628.806) (-2622.558) (-2632.698) -- 0:04:33 329500 -- (-2633.684) (-2625.242) [-2631.676] (-2625.254) * [-2622.909] (-2629.917) (-2627.121) (-2631.370) -- 0:04:32 330000 -- (-2625.891) [-2628.357] (-2624.838) (-2628.117) * (-2632.538) [-2628.974] (-2623.379) (-2632.725) -- 0:04:32 Average standard deviation of split frequencies: 0.000285 330500 -- (-2626.233) [-2626.495] (-2626.677) (-2623.444) * [-2624.186] (-2625.860) (-2626.549) (-2624.762) -- 0:04:31 331000 -- (-2628.129) (-2633.190) [-2624.937] (-2625.934) * (-2635.533) (-2628.451) [-2621.683] (-2621.067) -- 0:04:30 331500 -- (-2627.137) (-2621.756) (-2622.930) [-2626.416] * [-2621.231] (-2624.201) (-2626.558) (-2621.180) -- 0:04:32 332000 -- (-2630.247) [-2626.130] (-2628.983) (-2626.737) * (-2631.226) (-2626.461) (-2624.065) [-2623.259] -- 0:04:31 332500 -- [-2629.056] (-2620.516) (-2624.477) (-2627.404) * (-2623.889) [-2631.326] (-2624.775) (-2634.149) -- 0:04:31 333000 -- (-2626.448) (-2625.800) (-2626.437) [-2624.219] * (-2632.247) [-2626.030] (-2627.388) (-2626.672) -- 0:04:30 333500 -- [-2625.200] (-2623.908) (-2625.022) (-2631.048) * (-2625.889) (-2622.575) (-2628.924) [-2625.843] -- 0:04:29 334000 -- (-2629.773) (-2627.408) (-2627.174) [-2619.746] * (-2629.499) [-2622.710] (-2623.196) (-2630.358) -- 0:04:31 334500 -- [-2630.295] (-2629.066) (-2623.551) (-2622.185) * (-2625.974) [-2622.329] (-2621.290) (-2638.391) -- 0:04:30 335000 -- (-2633.150) (-2626.662) (-2625.686) [-2622.392] * (-2623.763) (-2624.978) (-2627.869) [-2626.194] -- 0:04:29 Average standard deviation of split frequencies: 0.000281 335500 -- (-2628.478) (-2630.096) (-2625.802) [-2622.862] * [-2628.913] (-2624.555) (-2633.307) (-2629.716) -- 0:04:29 336000 -- (-2625.013) [-2629.551] (-2623.955) (-2627.362) * (-2626.814) (-2624.254) [-2623.880] (-2619.990) -- 0:04:28 336500 -- [-2619.615] (-2621.500) (-2626.722) (-2622.966) * (-2627.766) (-2633.296) [-2623.058] (-2627.635) -- 0:04:30 337000 -- (-2621.324) (-2626.179) (-2626.464) [-2626.730] * (-2625.833) [-2627.605] (-2628.875) (-2627.207) -- 0:04:29 337500 -- [-2624.138] (-2634.295) (-2627.238) (-2626.089) * [-2622.182] (-2622.018) (-2622.197) (-2625.030) -- 0:04:28 338000 -- [-2621.986] (-2627.867) (-2628.963) (-2627.277) * (-2624.936) [-2622.298] (-2626.376) (-2626.027) -- 0:04:28 338500 -- (-2621.940) (-2632.689) (-2622.678) [-2623.792] * [-2620.893] (-2628.092) (-2624.266) (-2631.105) -- 0:04:27 339000 -- (-2628.837) (-2624.567) (-2623.685) [-2622.023] * (-2626.308) [-2623.719] (-2624.841) (-2625.458) -- 0:04:29 339500 -- (-2632.715) (-2632.749) (-2621.421) [-2623.380] * (-2630.279) (-2623.832) [-2627.765] (-2622.908) -- 0:04:28 340000 -- (-2621.168) (-2636.553) [-2624.889] (-2625.528) * (-2628.209) (-2624.884) (-2626.972) [-2629.786] -- 0:04:27 Average standard deviation of split frequencies: 0.000277 340500 -- (-2624.825) [-2622.619] (-2630.784) (-2638.251) * (-2626.085) [-2625.985] (-2636.868) (-2622.879) -- 0:04:27 341000 -- (-2631.961) (-2625.043) [-2624.560] (-2628.784) * (-2625.227) (-2633.925) (-2628.566) [-2627.286] -- 0:04:26 341500 -- (-2624.445) (-2623.605) [-2624.935] (-2624.832) * [-2623.054] (-2636.951) (-2633.229) (-2624.151) -- 0:04:28 342000 -- (-2624.174) [-2628.364] (-2626.030) (-2627.045) * [-2622.818] (-2625.854) (-2636.379) (-2628.396) -- 0:04:27 342500 -- (-2622.952) (-2625.422) (-2622.984) [-2623.666] * (-2621.648) (-2621.955) (-2624.283) [-2626.276] -- 0:04:26 343000 -- (-2629.834) [-2619.015] (-2620.180) (-2629.394) * (-2621.209) [-2625.985] (-2626.168) (-2631.124) -- 0:04:26 343500 -- (-2624.095) (-2628.940) [-2625.380] (-2628.044) * (-2629.679) (-2631.389) [-2625.505] (-2626.860) -- 0:04:25 344000 -- (-2624.031) (-2623.646) [-2619.411] (-2624.832) * (-2632.372) (-2630.229) (-2626.147) [-2623.642] -- 0:04:26 344500 -- (-2624.215) (-2624.069) (-2626.702) [-2626.277] * (-2624.644) (-2633.507) (-2624.480) [-2624.043] -- 0:04:26 345000 -- (-2626.464) (-2632.394) [-2624.135] (-2624.909) * [-2626.155] (-2623.448) (-2622.225) (-2627.702) -- 0:04:25 Average standard deviation of split frequencies: 0.000272 345500 -- (-2628.600) (-2626.925) [-2629.803] (-2634.091) * (-2631.421) (-2632.810) [-2625.056] (-2624.894) -- 0:04:25 346000 -- (-2635.348) [-2619.671] (-2627.388) (-2627.642) * (-2624.418) (-2629.401) [-2629.084] (-2634.933) -- 0:04:24 346500 -- [-2628.478] (-2620.610) (-2623.063) (-2628.298) * [-2627.594] (-2629.938) (-2621.288) (-2640.965) -- 0:04:25 347000 -- (-2621.460) [-2623.372] (-2623.489) (-2628.803) * [-2626.985] (-2632.094) (-2626.337) (-2626.034) -- 0:04:25 347500 -- (-2642.387) (-2629.786) (-2633.218) [-2624.795] * (-2626.571) [-2623.950] (-2622.412) (-2636.789) -- 0:04:24 348000 -- (-2637.057) (-2620.946) [-2621.189] (-2621.526) * [-2624.707] (-2623.898) (-2626.765) (-2627.875) -- 0:04:24 348500 -- (-2633.107) (-2626.639) (-2628.296) [-2627.291] * [-2622.248] (-2627.228) (-2621.143) (-2625.885) -- 0:04:23 349000 -- (-2639.160) [-2620.776] (-2629.255) (-2621.502) * (-2621.649) (-2630.466) (-2631.921) [-2623.965] -- 0:04:24 349500 -- [-2625.617] (-2625.131) (-2621.896) (-2623.715) * (-2624.544) (-2636.178) (-2627.688) [-2627.160] -- 0:04:24 350000 -- (-2627.707) [-2621.134] (-2626.025) (-2624.882) * (-2634.436) (-2627.267) (-2623.068) [-2624.123] -- 0:04:23 Average standard deviation of split frequencies: 0.000269 350500 -- (-2628.611) [-2622.373] (-2630.202) (-2617.958) * [-2624.645] (-2629.831) (-2626.666) (-2623.540) -- 0:04:23 351000 -- (-2625.094) (-2633.791) (-2629.718) [-2622.390] * (-2626.962) (-2630.158) [-2627.833] (-2625.429) -- 0:04:22 351500 -- [-2632.941] (-2623.215) (-2625.006) (-2627.089) * (-2631.151) (-2625.389) [-2625.626] (-2628.374) -- 0:04:23 352000 -- [-2620.143] (-2619.448) (-2626.537) (-2628.491) * (-2633.682) (-2635.870) (-2624.691) [-2625.101] -- 0:04:23 352500 -- (-2628.949) (-2634.195) (-2628.786) [-2625.275] * [-2618.906] (-2623.499) (-2634.289) (-2624.606) -- 0:04:22 353000 -- (-2624.048) [-2622.065] (-2625.392) (-2631.589) * (-2626.086) [-2627.175] (-2635.027) (-2628.489) -- 0:04:22 353500 -- (-2628.884) (-2627.083) (-2627.678) [-2628.043] * [-2625.771] (-2625.982) (-2627.132) (-2633.100) -- 0:04:21 354000 -- (-2621.943) [-2623.492] (-2622.163) (-2638.014) * (-2626.656) (-2625.717) (-2625.906) [-2627.552] -- 0:04:22 354500 -- (-2631.971) [-2620.015] (-2627.780) (-2626.993) * (-2621.102) [-2625.476] (-2623.578) (-2623.284) -- 0:04:22 355000 -- (-2630.284) (-2621.441) (-2622.696) [-2626.737] * (-2625.591) (-2626.785) (-2619.656) [-2629.620] -- 0:04:21 Average standard deviation of split frequencies: 0.000265 355500 -- [-2629.012] (-2622.294) (-2620.904) (-2623.356) * (-2637.764) (-2621.184) [-2627.188] (-2632.354) -- 0:04:21 356000 -- (-2624.474) (-2625.270) [-2625.478] (-2621.593) * (-2634.066) (-2624.573) [-2620.680] (-2629.505) -- 0:04:20 356500 -- (-2620.907) (-2627.568) (-2634.414) [-2630.055] * (-2631.362) (-2626.760) (-2624.941) [-2621.733] -- 0:04:21 357000 -- [-2631.123] (-2637.088) (-2625.996) (-2638.507) * (-2641.235) (-2627.674) [-2621.866] (-2624.128) -- 0:04:21 357500 -- (-2622.740) (-2624.109) [-2627.207] (-2631.334) * (-2632.600) (-2627.702) (-2626.714) [-2624.119] -- 0:04:20 358000 -- (-2627.369) (-2626.260) (-2628.938) [-2631.809] * (-2634.194) (-2626.463) (-2629.094) [-2615.934] -- 0:04:20 358500 -- (-2643.111) [-2619.810] (-2624.401) (-2625.997) * (-2633.310) (-2628.160) (-2625.710) [-2619.217] -- 0:04:21 359000 -- (-2627.540) [-2622.470] (-2629.129) (-2625.474) * (-2623.071) (-2629.699) [-2627.991] (-2627.120) -- 0:04:20 359500 -- (-2619.510) (-2627.057) [-2623.327] (-2627.837) * (-2627.763) (-2652.464) (-2627.861) [-2626.796] -- 0:04:20 360000 -- (-2627.369) (-2632.183) (-2631.305) [-2624.669] * (-2631.864) [-2622.261] (-2626.156) (-2631.535) -- 0:04:19 Average standard deviation of split frequencies: 0.000523 360500 -- (-2624.105) (-2634.342) (-2629.223) [-2625.117] * [-2634.593] (-2623.039) (-2628.158) (-2623.922) -- 0:04:18 361000 -- [-2620.960] (-2631.164) (-2627.710) (-2626.968) * (-2632.689) (-2630.301) (-2626.212) [-2629.682] -- 0:04:20 361500 -- (-2623.901) (-2625.867) [-2626.280] (-2634.558) * (-2623.647) (-2627.560) [-2628.599] (-2626.895) -- 0:04:19 362000 -- (-2630.541) [-2621.985] (-2629.992) (-2629.876) * (-2627.389) (-2636.911) [-2629.038] (-2629.459) -- 0:04:19 362500 -- (-2637.146) [-2623.354] (-2631.007) (-2625.630) * [-2627.697] (-2625.186) (-2637.683) (-2628.367) -- 0:04:18 363000 -- (-2636.833) (-2628.857) [-2627.088] (-2631.703) * [-2619.362] (-2629.256) (-2623.760) (-2631.481) -- 0:04:17 363500 -- [-2629.473] (-2626.293) (-2629.056) (-2622.929) * [-2623.058] (-2622.088) (-2624.954) (-2626.179) -- 0:04:19 364000 -- (-2628.335) (-2627.351) [-2624.473] (-2622.752) * (-2632.402) [-2621.636] (-2630.542) (-2624.733) -- 0:04:18 364500 -- [-2631.061] (-2627.581) (-2627.364) (-2618.063) * (-2630.140) [-2628.951] (-2626.105) (-2624.831) -- 0:04:18 365000 -- (-2630.143) (-2628.218) [-2628.768] (-2639.819) * (-2627.579) [-2624.960] (-2625.944) (-2629.159) -- 0:04:17 Average standard deviation of split frequencies: 0.000515 365500 -- [-2626.667] (-2629.520) (-2628.996) (-2622.339) * (-2620.840) (-2630.446) (-2626.547) [-2624.651] -- 0:04:16 366000 -- (-2624.594) (-2630.508) [-2628.396] (-2642.228) * [-2620.308] (-2625.892) (-2625.972) (-2635.776) -- 0:04:18 366500 -- (-2628.208) (-2627.605) [-2624.877] (-2631.816) * [-2631.350] (-2623.139) (-2628.599) (-2628.386) -- 0:04:17 367000 -- (-2627.172) (-2627.310) (-2626.731) [-2627.338] * [-2622.206] (-2628.292) (-2627.679) (-2631.178) -- 0:04:16 367500 -- (-2632.819) (-2627.145) (-2627.574) [-2627.525] * (-2625.336) (-2626.908) (-2626.822) [-2626.233] -- 0:04:16 368000 -- (-2620.527) (-2638.103) [-2624.902] (-2632.683) * (-2624.444) [-2620.675] (-2627.867) (-2626.233) -- 0:04:15 368500 -- (-2623.080) (-2627.272) [-2623.856] (-2623.896) * (-2625.526) (-2636.704) [-2627.888] (-2630.997) -- 0:04:17 369000 -- (-2633.024) (-2626.351) [-2630.445] (-2620.949) * (-2620.783) (-2629.310) [-2626.681] (-2627.357) -- 0:04:16 369500 -- (-2621.128) (-2631.344) (-2625.652) [-2625.071] * (-2625.251) (-2621.749) (-2627.577) [-2625.064] -- 0:04:15 370000 -- (-2628.898) [-2627.664] (-2622.140) (-2631.830) * (-2635.899) (-2623.568) (-2628.162) [-2632.798] -- 0:04:15 Average standard deviation of split frequencies: 0.000509 370500 -- [-2627.298] (-2630.266) (-2632.526) (-2621.184) * (-2634.521) [-2624.700] (-2635.515) (-2637.266) -- 0:04:14 371000 -- (-2628.092) (-2631.789) (-2633.837) [-2622.501] * (-2639.016) [-2629.433] (-2628.244) (-2623.449) -- 0:04:16 371500 -- (-2630.087) (-2632.771) (-2642.221) [-2622.682] * (-2630.250) (-2626.741) [-2630.843] (-2629.501) -- 0:04:15 372000 -- [-2629.879] (-2630.205) (-2633.030) (-2619.376) * (-2624.466) (-2628.482) (-2631.346) [-2629.935] -- 0:04:14 372500 -- (-2627.348) (-2622.069) [-2625.158] (-2626.551) * (-2636.802) [-2621.921] (-2631.689) (-2624.037) -- 0:04:14 373000 -- [-2625.632] (-2621.373) (-2622.791) (-2624.865) * (-2628.101) [-2621.806] (-2629.749) (-2624.710) -- 0:04:13 373500 -- (-2622.293) [-2629.717] (-2626.114) (-2622.861) * [-2630.183] (-2624.401) (-2624.561) (-2630.410) -- 0:04:14 374000 -- [-2624.841] (-2619.099) (-2627.168) (-2629.951) * (-2628.747) [-2626.989] (-2623.659) (-2641.363) -- 0:04:14 374500 -- (-2620.546) [-2626.728] (-2629.526) (-2626.837) * (-2635.958) (-2637.035) [-2620.604] (-2630.930) -- 0:04:13 375000 -- (-2640.514) (-2627.556) [-2624.808] (-2624.626) * [-2623.967] (-2627.112) (-2637.113) (-2625.210) -- 0:04:13 Average standard deviation of split frequencies: 0.000501 375500 -- (-2633.183) (-2625.441) (-2624.126) [-2622.864] * (-2639.775) [-2628.109] (-2627.965) (-2627.070) -- 0:04:12 376000 -- (-2634.746) (-2624.139) [-2628.790] (-2629.003) * (-2630.178) [-2627.641] (-2624.290) (-2625.472) -- 0:04:13 376500 -- (-2624.071) (-2630.132) [-2620.453] (-2625.623) * (-2624.273) [-2624.098] (-2624.169) (-2627.318) -- 0:04:13 377000 -- (-2631.800) (-2628.253) (-2623.900) [-2626.368] * [-2630.962] (-2626.451) (-2625.936) (-2623.838) -- 0:04:12 377500 -- (-2631.243) (-2620.449) (-2631.580) [-2621.322] * (-2626.659) (-2627.843) [-2626.038] (-2629.949) -- 0:04:12 378000 -- (-2628.681) [-2626.952] (-2624.314) (-2628.097) * [-2625.153] (-2626.195) (-2627.694) (-2622.453) -- 0:04:13 378500 -- (-2629.790) [-2626.485] (-2622.388) (-2626.647) * [-2625.062] (-2622.450) (-2627.310) (-2622.734) -- 0:04:12 379000 -- (-2626.144) (-2631.772) (-2630.210) [-2622.271] * (-2620.460) [-2624.266] (-2626.950) (-2627.723) -- 0:04:12 379500 -- (-2626.887) [-2629.377] (-2620.471) (-2626.641) * [-2625.637] (-2625.664) (-2639.951) (-2627.443) -- 0:04:11 380000 -- (-2623.958) (-2621.750) (-2620.882) [-2626.190] * (-2627.159) (-2628.949) (-2629.424) [-2625.511] -- 0:04:11 Average standard deviation of split frequencies: 0.000495 380500 -- (-2620.634) (-2626.442) [-2624.505] (-2628.844) * [-2633.780] (-2633.406) (-2625.257) (-2633.088) -- 0:04:12 381000 -- (-2623.698) (-2631.244) [-2622.937] (-2629.191) * (-2635.356) (-2633.514) (-2624.354) [-2633.147] -- 0:04:11 381500 -- (-2624.480) (-2628.625) [-2620.959] (-2633.335) * (-2623.853) [-2623.636] (-2626.462) (-2626.424) -- 0:04:11 382000 -- [-2628.223] (-2627.504) (-2622.900) (-2625.315) * [-2630.810] (-2626.984) (-2626.835) (-2623.256) -- 0:04:10 382500 -- (-2622.890) (-2621.125) (-2623.426) [-2624.662] * [-2626.638] (-2626.800) (-2632.073) (-2627.709) -- 0:04:10 383000 -- (-2631.592) (-2635.529) (-2630.321) [-2627.112] * [-2627.156] (-2625.196) (-2624.713) (-2627.951) -- 0:04:11 383500 -- (-2631.553) (-2623.014) (-2638.236) [-2626.701] * (-2625.630) (-2624.155) [-2625.113] (-2624.647) -- 0:04:10 384000 -- (-2627.943) (-2628.326) (-2631.059) [-2621.036] * (-2630.399) (-2627.341) [-2627.126] (-2621.648) -- 0:04:10 384500 -- (-2636.231) (-2628.599) [-2627.869] (-2623.614) * (-2628.553) (-2629.814) [-2620.303] (-2623.675) -- 0:04:09 385000 -- (-2645.477) (-2622.828) [-2623.536] (-2620.515) * (-2627.690) (-2634.760) (-2623.887) [-2629.452] -- 0:04:09 Average standard deviation of split frequencies: 0.000489 385500 -- (-2630.448) (-2625.788) [-2622.606] (-2628.591) * (-2631.237) (-2631.624) (-2624.387) [-2624.486] -- 0:04:10 386000 -- [-2623.561] (-2624.603) (-2626.944) (-2625.334) * (-2623.005) [-2621.290] (-2625.038) (-2624.645) -- 0:04:09 386500 -- (-2624.152) (-2630.511) [-2636.787] (-2624.192) * (-2624.918) (-2624.391) [-2633.477] (-2628.078) -- 0:04:09 387000 -- (-2624.113) (-2624.819) (-2631.653) [-2624.492] * (-2633.036) [-2621.959] (-2623.314) (-2635.043) -- 0:04:08 387500 -- [-2627.213] (-2624.787) (-2621.286) (-2624.666) * (-2624.680) (-2628.444) [-2623.501] (-2626.417) -- 0:04:08 388000 -- (-2629.101) [-2621.899] (-2634.384) (-2627.875) * (-2626.674) (-2630.133) [-2625.169] (-2621.928) -- 0:04:09 388500 -- (-2622.609) (-2625.708) [-2628.377] (-2628.127) * (-2634.240) [-2628.693] (-2635.126) (-2628.527) -- 0:04:08 389000 -- (-2629.835) (-2629.856) [-2626.271] (-2629.069) * (-2627.666) (-2626.608) (-2628.961) [-2631.479] -- 0:04:08 389500 -- (-2632.947) (-2627.299) (-2634.370) [-2631.804] * [-2623.670] (-2622.979) (-2625.442) (-2625.453) -- 0:04:07 390000 -- (-2630.392) (-2637.906) (-2634.456) [-2624.852] * (-2626.991) (-2628.943) (-2632.735) [-2623.762] -- 0:04:07 Average standard deviation of split frequencies: 0.000483 390500 -- (-2625.364) [-2622.465] (-2627.539) (-2623.580) * (-2630.966) [-2622.919] (-2634.052) (-2625.351) -- 0:04:08 391000 -- (-2624.858) (-2620.742) [-2625.782] (-2630.686) * (-2622.277) (-2621.769) (-2632.282) [-2626.048] -- 0:04:07 391500 -- (-2627.422) [-2621.118] (-2632.461) (-2625.255) * (-2623.950) [-2625.099] (-2626.056) (-2626.208) -- 0:04:07 392000 -- (-2633.883) (-2626.353) (-2628.505) [-2633.363] * (-2623.985) [-2619.699] (-2624.965) (-2630.477) -- 0:04:06 392500 -- [-2621.550] (-2629.759) (-2629.072) (-2625.417) * (-2622.527) (-2628.853) [-2623.428] (-2632.278) -- 0:04:06 393000 -- (-2631.438) (-2627.808) (-2625.647) [-2620.455] * [-2626.961] (-2628.636) (-2630.544) (-2623.440) -- 0:04:07 393500 -- (-2632.128) [-2621.597] (-2628.330) (-2624.955) * (-2636.442) [-2619.823] (-2624.171) (-2627.369) -- 0:04:06 394000 -- (-2625.425) [-2623.763] (-2631.283) (-2628.727) * (-2626.610) (-2636.445) (-2625.460) [-2628.519] -- 0:04:06 394500 -- (-2631.788) (-2624.071) [-2623.980] (-2628.581) * (-2620.687) (-2639.814) (-2627.163) [-2631.646] -- 0:04:05 395000 -- (-2625.808) (-2626.143) [-2625.991] (-2624.858) * (-2624.594) (-2626.787) [-2623.581] (-2622.347) -- 0:04:05 Average standard deviation of split frequencies: 0.000476 395500 -- (-2627.521) (-2623.955) (-2631.292) [-2627.628] * (-2622.646) (-2631.205) [-2630.700] (-2621.806) -- 0:04:06 396000 -- (-2626.991) (-2625.083) [-2623.034] (-2620.578) * (-2629.642) [-2631.102] (-2627.498) (-2621.166) -- 0:04:05 396500 -- (-2632.198) [-2625.040] (-2628.026) (-2628.630) * (-2623.154) (-2624.378) (-2631.616) [-2630.780] -- 0:04:05 397000 -- (-2622.873) (-2625.954) (-2627.593) [-2628.093] * [-2632.954] (-2624.632) (-2624.638) (-2630.236) -- 0:04:04 397500 -- (-2628.060) [-2624.462] (-2643.012) (-2634.513) * (-2629.701) (-2630.906) [-2623.997] (-2625.262) -- 0:04:04 398000 -- [-2624.129] (-2623.368) (-2626.383) (-2625.330) * (-2621.252) (-2626.128) [-2622.201] (-2619.703) -- 0:04:05 398500 -- (-2627.662) [-2625.507] (-2633.019) (-2628.244) * [-2626.080] (-2623.562) (-2632.835) (-2631.462) -- 0:04:04 399000 -- (-2633.332) [-2623.641] (-2623.209) (-2633.411) * (-2625.834) [-2622.625] (-2630.615) (-2629.362) -- 0:04:04 399500 -- (-2631.065) [-2623.248] (-2622.539) (-2623.760) * (-2630.477) (-2622.400) (-2629.309) [-2627.034] -- 0:04:03 400000 -- (-2620.856) (-2627.810) [-2632.642] (-2623.674) * (-2622.510) (-2626.638) (-2625.070) [-2622.121] -- 0:04:03 Average standard deviation of split frequencies: 0.000471 400500 -- [-2620.968] (-2627.675) (-2623.729) (-2634.261) * (-2644.394) [-2624.418] (-2622.803) (-2619.291) -- 0:04:03 401000 -- (-2625.231) (-2625.663) [-2625.946] (-2625.030) * (-2627.781) (-2624.895) (-2624.041) [-2626.688] -- 0:04:03 401500 -- (-2630.314) [-2631.121] (-2625.211) (-2624.246) * (-2625.504) (-2628.324) (-2630.589) [-2628.907] -- 0:04:02 402000 -- (-2629.617) (-2635.842) [-2629.315] (-2621.751) * (-2637.795) [-2623.345] (-2623.486) (-2627.590) -- 0:04:02 402500 -- [-2628.748] (-2628.362) (-2627.917) (-2623.111) * (-2627.836) [-2617.470] (-2624.270) (-2630.969) -- 0:04:01 403000 -- [-2626.628] (-2639.057) (-2630.166) (-2621.844) * (-2623.569) (-2623.941) [-2621.444] (-2634.125) -- 0:04:02 403500 -- (-2626.404) (-2630.448) (-2628.110) [-2624.607] * [-2625.125] (-2631.882) (-2628.289) (-2628.120) -- 0:04:02 404000 -- [-2623.003] (-2623.236) (-2624.344) (-2623.037) * (-2623.176) (-2628.246) (-2624.960) [-2625.814] -- 0:04:01 404500 -- [-2627.928] (-2630.930) (-2623.800) (-2630.134) * (-2627.373) (-2623.341) (-2627.221) [-2621.947] -- 0:04:01 405000 -- [-2627.161] (-2628.542) (-2626.903) (-2619.116) * (-2636.378) (-2629.202) [-2624.655] (-2630.023) -- 0:04:00 Average standard deviation of split frequencies: 0.000464 405500 -- (-2634.443) (-2626.814) [-2633.916] (-2625.571) * (-2627.462) [-2623.670] (-2629.176) (-2625.148) -- 0:04:01 406000 -- (-2624.465) (-2633.208) [-2618.394] (-2625.936) * (-2630.767) (-2621.727) [-2624.349] (-2620.220) -- 0:04:01 406500 -- (-2625.157) [-2620.538] (-2626.534) (-2635.361) * (-2632.656) (-2618.775) [-2627.094] (-2626.959) -- 0:04:00 407000 -- (-2629.322) (-2627.320) (-2621.417) [-2626.506] * (-2629.781) (-2626.111) (-2628.894) [-2630.776] -- 0:04:00 407500 -- [-2616.261] (-2623.858) (-2625.211) (-2625.844) * (-2626.582) (-2627.843) [-2625.808] (-2629.633) -- 0:03:59 408000 -- (-2625.738) (-2623.902) [-2629.658] (-2621.755) * (-2622.164) [-2637.884] (-2626.680) (-2637.340) -- 0:04:00 408500 -- (-2619.384) [-2622.117] (-2637.293) (-2627.079) * (-2627.247) [-2622.351] (-2634.998) (-2627.418) -- 0:04:00 409000 -- (-2629.346) (-2637.050) (-2627.482) [-2623.931] * (-2622.619) (-2625.482) [-2621.671] (-2622.559) -- 0:03:59 409500 -- (-2628.176) (-2627.519) (-2628.397) [-2626.522] * [-2621.183] (-2630.792) (-2623.273) (-2633.164) -- 0:03:59 410000 -- [-2626.880] (-2631.485) (-2632.339) (-2628.878) * (-2629.226) [-2628.381] (-2629.982) (-2626.989) -- 0:03:58 Average standard deviation of split frequencies: 0.000459 410500 -- (-2633.882) (-2631.715) (-2627.004) [-2626.213] * [-2621.898] (-2629.523) (-2619.726) (-2634.790) -- 0:03:59 411000 -- (-2627.605) (-2635.055) (-2625.961) [-2626.967] * (-2626.127) (-2624.150) [-2621.532] (-2623.661) -- 0:03:59 411500 -- [-2633.635] (-2640.793) (-2625.380) (-2622.407) * (-2619.244) (-2624.662) (-2628.919) [-2632.084] -- 0:03:58 412000 -- (-2626.920) (-2627.613) (-2623.409) [-2628.547] * (-2627.196) (-2626.423) (-2625.406) [-2626.145] -- 0:03:58 412500 -- (-2627.799) [-2625.084] (-2627.096) (-2634.939) * (-2641.165) (-2633.553) (-2628.435) [-2626.470] -- 0:03:59 413000 -- (-2624.127) (-2625.528) [-2624.826] (-2630.497) * (-2630.928) [-2624.539] (-2636.502) (-2622.423) -- 0:03:58 413500 -- (-2627.007) [-2628.382] (-2632.791) (-2633.222) * (-2628.740) (-2625.397) [-2627.478] (-2623.803) -- 0:03:58 414000 -- [-2624.680] (-2628.912) (-2620.656) (-2630.515) * (-2625.166) [-2625.562] (-2623.237) (-2639.121) -- 0:03:57 414500 -- (-2628.802) (-2630.625) (-2625.608) [-2623.105] * [-2630.916] (-2626.857) (-2631.279) (-2628.858) -- 0:03:57 415000 -- (-2624.678) (-2628.640) (-2619.429) [-2625.533] * (-2627.220) (-2628.135) (-2630.604) [-2624.402] -- 0:03:58 Average standard deviation of split frequencies: 0.000453 415500 -- (-2624.806) (-2626.565) (-2624.202) [-2622.105] * (-2622.664) [-2628.264] (-2630.587) (-2624.819) -- 0:03:57 416000 -- (-2628.013) (-2623.217) (-2627.587) [-2634.189] * (-2641.117) (-2624.509) (-2627.082) [-2623.293] -- 0:03:57 416500 -- (-2627.454) [-2624.045] (-2639.217) (-2631.642) * (-2631.007) (-2627.910) [-2624.237] (-2630.754) -- 0:03:56 417000 -- (-2632.239) (-2636.976) [-2623.912] (-2633.238) * (-2625.610) (-2628.425) (-2632.324) [-2623.648] -- 0:03:56 417500 -- [-2625.059] (-2634.460) (-2627.622) (-2630.254) * (-2626.537) (-2633.527) [-2626.083] (-2627.539) -- 0:03:57 418000 -- [-2621.711] (-2630.615) (-2620.364) (-2629.565) * (-2628.020) (-2630.403) [-2618.945] (-2624.952) -- 0:03:56 418500 -- (-2623.593) [-2633.946] (-2627.404) (-2626.827) * [-2622.221] (-2626.393) (-2625.533) (-2620.079) -- 0:03:56 419000 -- (-2623.474) [-2632.336] (-2636.462) (-2627.468) * (-2624.899) [-2622.031] (-2617.326) (-2623.170) -- 0:03:55 419500 -- (-2624.963) (-2634.028) [-2626.334] (-2618.471) * (-2625.271) (-2625.410) (-2627.151) [-2624.893] -- 0:03:55 420000 -- [-2627.924] (-2629.838) (-2634.648) (-2630.319) * [-2627.501] (-2622.133) (-2628.934) (-2636.812) -- 0:03:56 Average standard deviation of split frequencies: 0.000448 420500 -- (-2630.827) (-2622.618) (-2625.860) [-2623.265] * [-2623.202] (-2624.820) (-2626.479) (-2630.845) -- 0:03:55 421000 -- (-2627.861) [-2629.342] (-2624.564) (-2622.085) * (-2625.488) [-2620.757] (-2636.118) (-2627.555) -- 0:03:55 421500 -- [-2629.515] (-2625.694) (-2625.135) (-2626.718) * (-2633.048) (-2628.694) (-2634.134) [-2628.181] -- 0:03:54 422000 -- (-2629.492) (-2624.033) [-2621.896] (-2635.145) * (-2624.264) [-2621.219] (-2628.583) (-2629.390) -- 0:03:54 422500 -- (-2633.396) [-2621.053] (-2625.917) (-2644.352) * [-2623.052] (-2625.275) (-2627.453) (-2632.358) -- 0:03:55 423000 -- [-2623.298] (-2622.360) (-2630.433) (-2624.381) * (-2622.549) (-2625.166) [-2626.147] (-2625.737) -- 0:03:54 423500 -- (-2626.824) [-2621.665] (-2631.940) (-2623.469) * [-2624.471] (-2624.466) (-2631.995) (-2626.887) -- 0:03:54 424000 -- (-2621.759) [-2625.156] (-2633.877) (-2625.545) * (-2627.388) (-2627.086) [-2624.756] (-2631.633) -- 0:03:53 424500 -- (-2630.779) (-2622.321) [-2623.307] (-2640.493) * [-2624.649] (-2632.210) (-2629.045) (-2632.220) -- 0:03:53 425000 -- [-2621.527] (-2624.750) (-2627.313) (-2627.392) * (-2624.488) (-2624.930) (-2631.583) [-2628.221] -- 0:03:54 Average standard deviation of split frequencies: 0.000443 425500 -- [-2622.578] (-2625.653) (-2627.681) (-2626.795) * (-2627.039) (-2625.179) [-2629.290] (-2631.558) -- 0:03:53 426000 -- [-2621.550] (-2627.910) (-2628.478) (-2622.586) * (-2631.354) (-2619.513) (-2625.119) [-2623.395] -- 0:03:53 426500 -- (-2633.066) [-2630.430] (-2630.620) (-2632.221) * (-2636.420) (-2621.726) (-2625.571) [-2624.146] -- 0:03:52 427000 -- (-2623.665) (-2619.815) (-2629.787) [-2625.720] * (-2620.264) (-2626.720) [-2625.005] (-2630.591) -- 0:03:52 427500 -- (-2639.531) (-2633.222) (-2633.707) [-2626.527] * (-2626.363) [-2618.666] (-2629.155) (-2631.203) -- 0:03:53 428000 -- (-2632.540) (-2621.484) [-2629.683] (-2631.715) * [-2624.950] (-2622.668) (-2629.745) (-2633.052) -- 0:03:52 428500 -- (-2637.831) [-2620.902] (-2629.565) (-2626.407) * (-2627.646) [-2622.849] (-2631.820) (-2632.542) -- 0:03:52 429000 -- (-2625.183) (-2626.926) [-2624.664] (-2626.584) * (-2618.773) [-2626.418] (-2627.508) (-2631.225) -- 0:03:51 429500 -- [-2623.525] (-2622.557) (-2634.016) (-2626.486) * (-2627.199) (-2632.975) (-2626.055) [-2630.281] -- 0:03:51 430000 -- (-2632.746) (-2624.258) [-2628.963] (-2632.796) * (-2629.784) [-2632.006] (-2619.239) (-2632.448) -- 0:03:51 Average standard deviation of split frequencies: 0.000438 430500 -- (-2631.929) [-2628.124] (-2631.223) (-2632.996) * (-2627.646) (-2634.426) [-2622.195] (-2633.781) -- 0:03:51 431000 -- (-2630.510) [-2633.206] (-2620.883) (-2618.428) * (-2626.815) (-2624.287) [-2629.023] (-2631.563) -- 0:03:51 431500 -- [-2619.359] (-2629.327) (-2629.914) (-2621.364) * (-2625.859) (-2624.576) (-2625.472) [-2626.355] -- 0:03:50 432000 -- (-2627.175) (-2633.176) (-2632.904) [-2621.803] * (-2627.042) (-2628.166) [-2623.825] (-2632.438) -- 0:03:50 432500 -- [-2621.535] (-2629.386) (-2634.019) (-2626.496) * (-2631.027) (-2624.843) (-2623.327) [-2630.015] -- 0:03:50 433000 -- (-2625.084) (-2631.774) [-2625.240] (-2628.645) * (-2630.898) [-2627.884] (-2635.952) (-2629.122) -- 0:03:50 433500 -- [-2623.745] (-2636.752) (-2627.196) (-2631.959) * (-2625.915) [-2622.828] (-2624.414) (-2630.078) -- 0:03:49 434000 -- [-2624.048] (-2634.277) (-2630.938) (-2631.577) * [-2621.912] (-2631.044) (-2627.183) (-2631.908) -- 0:03:49 434500 -- (-2632.079) [-2623.441] (-2625.878) (-2628.885) * (-2623.723) (-2633.500) [-2627.423] (-2623.935) -- 0:03:49 435000 -- [-2626.044] (-2618.697) (-2632.902) (-2636.626) * (-2619.996) (-2634.141) (-2629.182) [-2630.053] -- 0:03:49 Average standard deviation of split frequencies: 0.000432 435500 -- (-2630.258) [-2623.530] (-2628.615) (-2627.722) * (-2625.862) (-2641.779) (-2622.388) [-2623.670] -- 0:03:49 436000 -- (-2624.054) (-2625.603) (-2628.084) [-2625.931] * (-2620.148) (-2634.110) (-2622.740) [-2625.214] -- 0:03:48 436500 -- (-2626.898) [-2622.311] (-2630.619) (-2626.849) * [-2621.900] (-2627.323) (-2629.984) (-2629.329) -- 0:03:48 437000 -- (-2625.366) (-2624.245) (-2625.701) [-2624.706] * (-2629.890) [-2628.092] (-2629.180) (-2625.409) -- 0:03:48 437500 -- (-2629.529) (-2629.928) [-2625.191] (-2636.303) * (-2622.649) (-2629.045) [-2627.805] (-2637.344) -- 0:03:48 438000 -- [-2623.854] (-2628.719) (-2627.419) (-2626.704) * (-2637.515) [-2627.045] (-2624.116) (-2623.903) -- 0:03:48 438500 -- (-2623.676) (-2633.386) [-2626.411] (-2626.598) * [-2628.251] (-2625.215) (-2626.796) (-2627.374) -- 0:03:47 439000 -- (-2627.245) (-2630.300) (-2626.724) [-2620.895] * (-2625.378) (-2633.747) (-2625.820) [-2628.807] -- 0:03:47 439500 -- (-2622.586) (-2632.555) [-2629.896] (-2624.597) * [-2626.434] (-2623.950) (-2625.115) (-2626.144) -- 0:03:48 440000 -- (-2629.218) [-2626.369] (-2628.674) (-2627.206) * (-2629.234) (-2632.611) [-2625.362] (-2627.191) -- 0:03:47 Average standard deviation of split frequencies: 0.000428 440500 -- (-2630.912) (-2629.636) (-2625.950) [-2627.265] * [-2632.707] (-2630.879) (-2626.409) (-2620.887) -- 0:03:47 441000 -- (-2626.206) [-2623.434] (-2631.436) (-2634.290) * (-2636.914) (-2628.138) [-2632.328] (-2624.055) -- 0:03:46 441500 -- [-2623.333] (-2625.108) (-2621.784) (-2628.951) * [-2632.535] (-2623.863) (-2623.713) (-2626.266) -- 0:03:46 442000 -- [-2625.977] (-2636.107) (-2626.907) (-2630.231) * (-2629.116) [-2624.371] (-2637.002) (-2627.718) -- 0:03:47 442500 -- (-2630.143) (-2634.256) (-2633.230) [-2625.714] * (-2625.953) [-2622.270] (-2628.885) (-2626.329) -- 0:03:46 443000 -- [-2624.939] (-2628.837) (-2624.337) (-2623.237) * (-2624.530) (-2623.133) (-2629.888) [-2624.821] -- 0:03:46 443500 -- (-2626.446) [-2627.223] (-2628.264) (-2628.311) * (-2625.226) (-2630.361) [-2628.367] (-2629.772) -- 0:03:45 444000 -- (-2629.417) (-2633.488) (-2627.759) [-2622.110] * (-2622.022) (-2624.621) [-2625.378] (-2625.024) -- 0:03:45 444500 -- [-2624.426] (-2627.229) (-2633.146) (-2620.325) * [-2621.258] (-2626.136) (-2623.720) (-2622.491) -- 0:03:46 445000 -- [-2627.517] (-2622.750) (-2625.148) (-2626.571) * [-2626.497] (-2622.571) (-2624.193) (-2629.922) -- 0:03:45 Average standard deviation of split frequencies: 0.000423 445500 -- [-2620.912] (-2622.709) (-2627.782) (-2624.421) * (-2625.317) (-2632.640) (-2629.682) [-2627.009] -- 0:03:45 446000 -- [-2620.596] (-2629.907) (-2628.562) (-2631.532) * [-2628.654] (-2627.235) (-2623.323) (-2629.253) -- 0:03:44 446500 -- (-2624.015) (-2628.620) [-2621.837] (-2629.103) * (-2623.899) (-2630.467) [-2624.102] (-2629.104) -- 0:03:44 447000 -- (-2627.176) [-2622.282] (-2633.287) (-2630.206) * (-2626.394) (-2627.384) (-2627.776) [-2625.072] -- 0:03:45 447500 -- (-2624.954) [-2622.278] (-2625.090) (-2629.770) * (-2631.510) (-2628.259) [-2623.128] (-2621.194) -- 0:03:44 448000 -- (-2622.372) (-2630.702) [-2627.102] (-2633.320) * (-2626.806) [-2630.400] (-2623.146) (-2622.377) -- 0:03:44 448500 -- (-2626.287) (-2627.544) (-2626.425) [-2626.267] * (-2627.916) [-2627.141] (-2629.639) (-2620.055) -- 0:03:43 449000 -- (-2625.715) (-2632.930) (-2628.172) [-2624.070] * (-2626.826) [-2627.552] (-2623.516) (-2622.890) -- 0:03:43 449500 -- (-2628.407) (-2632.103) [-2630.047] (-2629.025) * (-2632.506) [-2626.139] (-2619.290) (-2626.111) -- 0:03:44 450000 -- [-2620.615] (-2628.004) (-2626.815) (-2633.255) * (-2631.045) (-2623.796) (-2623.665) [-2626.067] -- 0:03:43 Average standard deviation of split frequencies: 0.000418 450500 -- [-2623.899] (-2624.337) (-2624.347) (-2634.105) * (-2623.799) (-2623.623) (-2623.473) [-2625.746] -- 0:03:43 451000 -- (-2620.020) (-2630.214) [-2623.614] (-2635.984) * (-2633.591) (-2620.087) (-2626.096) [-2621.238] -- 0:03:42 451500 -- (-2630.465) (-2638.681) [-2622.223] (-2635.820) * (-2625.685) [-2624.411] (-2634.216) (-2624.853) -- 0:03:42 452000 -- [-2622.928] (-2622.378) (-2626.920) (-2625.677) * (-2630.522) [-2623.329] (-2626.250) (-2619.852) -- 0:03:43 452500 -- [-2627.406] (-2624.456) (-2625.877) (-2625.698) * (-2629.000) (-2624.612) [-2623.575] (-2633.851) -- 0:03:42 453000 -- (-2626.432) (-2626.162) [-2625.887] (-2624.086) * [-2623.754] (-2627.529) (-2626.591) (-2621.537) -- 0:03:42 453500 -- (-2629.489) (-2635.760) (-2631.362) [-2623.815] * [-2623.867] (-2627.010) (-2621.816) (-2632.261) -- 0:03:41 454000 -- [-2623.650] (-2628.050) (-2625.534) (-2628.717) * (-2635.750) (-2624.596) [-2628.006] (-2623.577) -- 0:03:41 454500 -- (-2631.363) [-2625.104] (-2626.003) (-2631.340) * (-2624.948) (-2622.567) (-2632.517) [-2628.706] -- 0:03:42 455000 -- (-2624.823) (-2624.468) (-2622.903) [-2625.307] * (-2632.576) (-2630.180) [-2627.814] (-2637.720) -- 0:03:41 Average standard deviation of split frequencies: 0.000414 455500 -- [-2627.272] (-2623.681) (-2635.893) (-2630.848) * (-2630.913) (-2629.030) (-2624.711) [-2621.525] -- 0:03:41 456000 -- (-2633.444) (-2631.650) (-2621.189) [-2627.837] * [-2633.822] (-2626.961) (-2637.582) (-2629.299) -- 0:03:40 456500 -- (-2631.095) (-2620.763) (-2623.604) [-2621.707] * (-2634.905) (-2622.898) [-2623.985] (-2627.896) -- 0:03:40 457000 -- [-2634.983] (-2627.120) (-2630.216) (-2626.557) * (-2631.557) [-2620.868] (-2628.043) (-2627.837) -- 0:03:41 457500 -- (-2634.004) [-2617.332] (-2635.948) (-2630.148) * (-2631.550) (-2631.625) [-2631.269] (-2625.972) -- 0:03:40 458000 -- [-2632.073] (-2624.581) (-2627.693) (-2632.003) * [-2628.284] (-2628.045) (-2622.929) (-2627.275) -- 0:03:40 458500 -- [-2623.643] (-2622.833) (-2624.324) (-2627.578) * (-2626.738) (-2624.390) [-2628.667] (-2628.970) -- 0:03:39 459000 -- (-2631.111) (-2620.595) (-2622.309) [-2636.896] * (-2627.373) (-2625.581) (-2627.329) [-2626.269] -- 0:03:39 459500 -- (-2631.675) (-2622.695) [-2625.928] (-2632.521) * (-2632.199) (-2624.840) [-2624.407] (-2627.938) -- 0:03:39 460000 -- (-2625.554) [-2631.110] (-2628.509) (-2638.239) * [-2623.331] (-2627.079) (-2630.731) (-2630.416) -- 0:03:39 Average standard deviation of split frequencies: 0.000409 460500 -- (-2627.030) (-2623.167) (-2628.875) [-2633.715] * (-2630.950) (-2634.038) (-2627.044) [-2625.290] -- 0:03:39 461000 -- (-2619.658) (-2627.143) [-2625.210] (-2629.325) * (-2636.333) (-2629.650) (-2625.290) [-2622.883] -- 0:03:38 461500 -- [-2623.409] (-2620.850) (-2622.044) (-2628.509) * (-2632.378) (-2624.560) [-2627.425] (-2623.604) -- 0:03:38 462000 -- (-2624.955) (-2632.708) [-2628.341] (-2637.362) * (-2633.042) (-2627.602) [-2627.683] (-2632.338) -- 0:03:38 462500 -- (-2629.430) [-2624.772] (-2631.298) (-2639.346) * [-2619.297] (-2631.813) (-2629.630) (-2622.187) -- 0:03:38 463000 -- (-2634.325) (-2621.804) (-2633.467) [-2621.354] * (-2622.684) (-2628.152) (-2632.625) [-2626.520] -- 0:03:38 463500 -- (-2625.089) (-2626.507) [-2622.623] (-2633.121) * [-2624.248] (-2635.704) (-2633.734) (-2628.991) -- 0:03:37 464000 -- (-2626.016) (-2626.831) (-2624.545) [-2622.782] * (-2632.860) (-2626.044) [-2626.611] (-2632.760) -- 0:03:37 464500 -- (-2628.894) (-2630.857) (-2624.829) [-2625.715] * (-2639.074) (-2624.685) [-2630.956] (-2627.403) -- 0:03:37 465000 -- (-2619.890) (-2621.793) (-2623.800) [-2629.760] * (-2629.850) [-2620.824] (-2631.930) (-2625.955) -- 0:03:37 Average standard deviation of split frequencies: 0.000405 465500 -- (-2626.888) [-2618.494] (-2622.753) (-2621.532) * (-2627.612) (-2619.949) (-2632.480) [-2623.645] -- 0:03:37 466000 -- (-2620.249) [-2620.658] (-2629.659) (-2637.935) * (-2627.941) (-2626.876) (-2624.832) [-2620.664] -- 0:03:36 466500 -- (-2621.669) [-2626.414] (-2626.509) (-2629.738) * (-2623.322) (-2631.031) (-2631.731) [-2625.071] -- 0:03:36 467000 -- [-2624.624] (-2624.447) (-2625.380) (-2627.033) * (-2631.804) [-2629.068] (-2626.472) (-2625.532) -- 0:03:36 467500 -- (-2629.659) (-2619.024) (-2625.261) [-2623.088] * [-2624.532] (-2622.527) (-2622.479) (-2631.259) -- 0:03:36 468000 -- (-2623.128) [-2620.463] (-2629.544) (-2625.012) * (-2630.760) (-2628.510) [-2628.682] (-2626.471) -- 0:03:35 468500 -- (-2626.887) [-2621.227] (-2630.536) (-2629.967) * (-2625.227) [-2628.557] (-2625.003) (-2638.309) -- 0:03:35 469000 -- (-2630.255) [-2626.033] (-2624.162) (-2626.157) * (-2626.490) (-2629.149) [-2624.195] (-2624.989) -- 0:03:35 469500 -- [-2619.055] (-2630.396) (-2625.046) (-2624.292) * (-2623.896) (-2633.183) (-2626.322) [-2635.241] -- 0:03:35 470000 -- [-2621.306] (-2632.403) (-2625.891) (-2621.404) * (-2632.966) (-2623.827) [-2621.220] (-2622.407) -- 0:03:35 Average standard deviation of split frequencies: 0.000401 470500 -- (-2627.938) [-2628.441] (-2632.532) (-2625.384) * (-2629.754) [-2623.377] (-2625.728) (-2626.077) -- 0:03:34 471000 -- [-2619.473] (-2627.628) (-2629.420) (-2630.881) * (-2626.399) (-2626.650) (-2626.629) [-2622.286] -- 0:03:34 471500 -- [-2623.208] (-2628.401) (-2627.958) (-2637.068) * (-2642.708) (-2623.818) [-2625.373] (-2625.268) -- 0:03:34 472000 -- (-2624.162) (-2624.358) (-2628.092) [-2633.822] * (-2630.090) (-2630.224) (-2634.547) [-2625.981] -- 0:03:34 472500 -- (-2630.685) (-2623.403) [-2624.907] (-2628.700) * (-2637.762) (-2624.937) [-2622.506] (-2626.259) -- 0:03:34 473000 -- (-2625.347) (-2635.054) (-2633.199) [-2623.360] * (-2624.447) (-2621.328) (-2627.070) [-2623.596] -- 0:03:33 473500 -- (-2632.542) (-2618.924) [-2622.474] (-2621.720) * (-2628.816) [-2624.986] (-2630.671) (-2637.159) -- 0:03:33 474000 -- (-2631.380) (-2620.765) [-2623.939] (-2627.319) * (-2623.267) (-2622.793) [-2628.096] (-2626.730) -- 0:03:33 474500 -- [-2628.490] (-2634.944) (-2624.233) (-2629.954) * [-2627.960] (-2627.792) (-2632.236) (-2627.563) -- 0:03:33 475000 -- (-2627.665) (-2628.713) [-2622.825] (-2621.299) * [-2626.109] (-2622.163) (-2630.558) (-2630.419) -- 0:03:33 Average standard deviation of split frequencies: 0.000396 475500 -- (-2637.769) [-2628.014] (-2626.760) (-2624.633) * (-2640.456) [-2622.902] (-2631.910) (-2626.484) -- 0:03:32 476000 -- (-2635.453) (-2628.580) [-2629.317] (-2627.181) * (-2629.882) (-2626.018) (-2634.693) [-2636.045] -- 0:03:32 476500 -- (-2632.001) [-2625.061] (-2633.041) (-2628.362) * (-2624.459) (-2625.495) (-2631.969) [-2622.950] -- 0:03:32 477000 -- (-2628.705) (-2623.921) (-2626.783) [-2625.144] * (-2632.925) (-2630.789) (-2630.199) [-2624.310] -- 0:03:32 477500 -- (-2635.879) (-2624.409) [-2629.014] (-2625.209) * (-2622.874) (-2639.073) (-2629.726) [-2625.564] -- 0:03:32 478000 -- (-2640.298) (-2628.554) [-2624.834] (-2627.566) * (-2623.308) [-2623.750] (-2625.747) (-2621.671) -- 0:03:31 478500 -- (-2635.060) [-2624.937] (-2628.245) (-2628.587) * (-2627.175) (-2620.986) (-2624.426) [-2627.228] -- 0:03:31 479000 -- (-2632.282) (-2633.755) (-2623.653) [-2632.889] * (-2625.392) (-2625.790) (-2625.081) [-2619.783] -- 0:03:32 479500 -- (-2621.688) (-2631.497) [-2624.665] (-2625.727) * (-2622.410) [-2626.456] (-2627.199) (-2626.014) -- 0:03:31 480000 -- (-2631.373) (-2627.866) [-2624.538] (-2625.342) * (-2627.437) (-2627.275) [-2627.095] (-2626.094) -- 0:03:31 Average standard deviation of split frequencies: 0.000392 480500 -- [-2624.866] (-2626.390) (-2633.974) (-2639.966) * [-2623.509] (-2631.842) (-2627.559) (-2638.166) -- 0:03:30 481000 -- (-2636.276) (-2627.172) [-2629.784] (-2625.731) * [-2620.430] (-2634.304) (-2617.987) (-2628.538) -- 0:03:30 481500 -- (-2629.032) (-2637.395) (-2625.622) [-2623.632] * (-2620.188) [-2629.032] (-2629.381) (-2625.304) -- 0:03:31 482000 -- (-2626.078) (-2626.279) (-2625.686) [-2621.843] * [-2622.524] (-2626.708) (-2623.193) (-2625.889) -- 0:03:30 482500 -- (-2626.975) (-2628.453) (-2627.298) [-2625.232] * (-2631.907) (-2626.253) [-2626.776] (-2631.808) -- 0:03:30 483000 -- (-2632.868) (-2631.080) (-2632.901) [-2628.924] * (-2624.217) [-2622.695] (-2627.350) (-2621.851) -- 0:03:29 483500 -- (-2632.973) (-2627.897) [-2629.388] (-2623.357) * [-2624.867] (-2630.257) (-2636.132) (-2624.483) -- 0:03:29 484000 -- [-2636.336] (-2629.497) (-2631.570) (-2632.597) * (-2627.193) (-2636.926) (-2633.210) [-2623.918] -- 0:03:30 484500 -- (-2629.363) (-2627.052) (-2626.098) [-2630.314] * [-2618.271] (-2626.698) (-2625.076) (-2629.231) -- 0:03:29 485000 -- (-2629.842) [-2624.865] (-2624.467) (-2622.493) * (-2625.033) (-2636.637) [-2623.024] (-2624.565) -- 0:03:29 Average standard deviation of split frequencies: 0.000388 485500 -- (-2631.030) [-2626.315] (-2628.551) (-2626.546) * (-2628.472) (-2630.279) [-2628.333] (-2622.512) -- 0:03:28 486000 -- (-2626.354) [-2623.403] (-2619.375) (-2626.471) * (-2627.380) (-2625.440) [-2628.809] (-2624.346) -- 0:03:28 486500 -- (-2626.544) (-2630.803) [-2630.384] (-2623.280) * (-2627.378) (-2623.799) [-2620.139] (-2627.196) -- 0:03:28 487000 -- (-2625.757) (-2621.005) [-2624.806] (-2634.526) * (-2621.818) (-2624.410) [-2626.538] (-2622.854) -- 0:03:28 487500 -- (-2623.874) (-2621.216) (-2626.132) [-2618.288] * [-2621.886] (-2623.230) (-2624.003) (-2632.023) -- 0:03:28 488000 -- (-2626.831) (-2627.432) [-2628.964] (-2626.463) * (-2628.388) (-2630.466) [-2631.350] (-2629.082) -- 0:03:27 488500 -- [-2623.536] (-2618.362) (-2624.401) (-2633.474) * [-2618.519] (-2621.984) (-2619.758) (-2623.292) -- 0:03:27 489000 -- [-2624.085] (-2626.287) (-2622.822) (-2623.864) * (-2627.919) [-2626.829] (-2620.773) (-2623.796) -- 0:03:27 489500 -- (-2623.309) (-2633.298) (-2626.081) [-2628.782] * (-2629.449) (-2625.022) (-2632.945) [-2625.200] -- 0:03:27 490000 -- (-2621.671) (-2625.569) [-2622.463] (-2626.169) * (-2625.345) (-2633.567) (-2627.287) [-2626.803] -- 0:03:27 Average standard deviation of split frequencies: 0.000384 490500 -- (-2624.594) (-2631.945) [-2630.095] (-2628.522) * [-2624.506] (-2626.254) (-2626.439) (-2622.168) -- 0:03:26 491000 -- (-2626.798) (-2627.984) [-2627.561] (-2631.213) * (-2622.233) (-2621.342) [-2625.101] (-2624.499) -- 0:03:26 491500 -- (-2623.675) (-2625.635) [-2626.994] (-2643.405) * [-2630.804] (-2624.875) (-2622.769) (-2626.746) -- 0:03:26 492000 -- [-2628.978] (-2625.464) (-2622.934) (-2635.447) * (-2636.747) (-2627.837) (-2626.457) [-2628.931] -- 0:03:26 492500 -- [-2621.049] (-2621.417) (-2626.960) (-2623.682) * (-2626.085) (-2626.515) [-2623.171] (-2634.667) -- 0:03:26 493000 -- [-2620.705] (-2626.348) (-2625.539) (-2625.631) * [-2620.294] (-2627.680) (-2631.590) (-2630.480) -- 0:03:25 493500 -- (-2622.682) (-2621.984) (-2629.648) [-2628.701] * (-2626.685) (-2628.500) [-2628.472] (-2626.964) -- 0:03:25 494000 -- (-2627.247) (-2624.732) (-2628.639) [-2625.690] * [-2628.515] (-2633.120) (-2624.817) (-2629.426) -- 0:03:25 494500 -- [-2624.171] (-2631.937) (-2624.941) (-2623.133) * (-2626.285) [-2623.400] (-2637.113) (-2634.329) -- 0:03:25 495000 -- [-2619.498] (-2623.294) (-2630.838) (-2623.576) * (-2626.075) [-2623.179] (-2629.259) (-2635.324) -- 0:03:25 Average standard deviation of split frequencies: 0.000380 495500 -- (-2623.867) [-2627.147] (-2630.436) (-2627.376) * (-2631.270) (-2624.817) [-2623.024] (-2621.104) -- 0:03:24 496000 -- (-2625.455) (-2622.913) [-2624.478] (-2626.478) * [-2621.078] (-2629.237) (-2622.975) (-2629.310) -- 0:03:24 496500 -- (-2630.136) [-2625.017] (-2626.114) (-2624.911) * (-2625.147) (-2628.500) [-2620.784] (-2636.180) -- 0:03:24 497000 -- [-2627.107] (-2626.803) (-2624.165) (-2626.004) * [-2620.696] (-2628.528) (-2627.726) (-2626.799) -- 0:03:24 497500 -- (-2622.683) (-2621.814) [-2629.278] (-2631.799) * (-2627.065) (-2622.866) (-2630.213) [-2624.939] -- 0:03:24 498000 -- (-2639.245) (-2623.400) [-2626.971] (-2636.352) * (-2629.039) [-2639.870] (-2629.010) (-2625.961) -- 0:03:23 498500 -- (-2631.352) (-2625.907) [-2624.035] (-2639.532) * (-2627.712) (-2628.398) (-2622.933) [-2625.033] -- 0:03:23 499000 -- [-2622.166] (-2630.818) (-2633.117) (-2635.771) * [-2624.959] (-2628.364) (-2620.281) (-2632.769) -- 0:03:23 499500 -- (-2622.355) [-2624.944] (-2624.777) (-2626.116) * (-2629.614) [-2622.781] (-2628.109) (-2629.631) -- 0:03:23 500000 -- (-2626.362) (-2628.344) (-2632.454) [-2620.800] * (-2622.624) (-2623.541) (-2625.280) [-2623.494] -- 0:03:23 Average standard deviation of split frequencies: 0.000377 500500 -- (-2622.793) (-2633.969) [-2624.807] (-2619.269) * [-2629.024] (-2620.265) (-2624.755) (-2625.926) -- 0:03:22 501000 -- (-2628.470) (-2629.310) (-2626.592) [-2623.588] * (-2626.172) (-2623.062) [-2624.334] (-2624.783) -- 0:03:22 501500 -- [-2630.973] (-2631.303) (-2620.713) (-2623.863) * (-2640.426) (-2623.495) [-2621.529] (-2624.783) -- 0:03:22 502000 -- (-2631.980) [-2626.165] (-2620.300) (-2629.610) * (-2634.725) (-2627.689) (-2621.521) [-2624.737] -- 0:03:22 502500 -- (-2631.540) (-2624.364) (-2634.919) [-2627.432] * (-2627.886) (-2623.397) [-2622.950] (-2624.118) -- 0:03:21 503000 -- (-2629.104) [-2620.987] (-2632.406) (-2629.770) * (-2627.935) (-2629.645) [-2625.196] (-2629.045) -- 0:03:21 503500 -- (-2635.103) (-2628.172) (-2626.380) [-2622.575] * (-2627.747) (-2629.752) (-2629.617) [-2628.104] -- 0:03:21 504000 -- [-2626.617] (-2622.414) (-2629.632) (-2631.299) * (-2627.049) (-2624.858) (-2630.644) [-2621.511] -- 0:03:21 504500 -- (-2631.234) (-2622.792) (-2619.844) [-2623.857] * (-2623.994) (-2627.788) [-2628.686] (-2626.099) -- 0:03:21 505000 -- [-2628.999] (-2633.719) (-2632.575) (-2628.066) * [-2622.709] (-2629.962) (-2626.770) (-2625.588) -- 0:03:20 Average standard deviation of split frequencies: 0.000373 505500 -- [-2624.545] (-2628.470) (-2627.806) (-2629.235) * (-2622.114) (-2635.462) [-2620.887] (-2622.049) -- 0:03:20 506000 -- (-2632.302) [-2622.196] (-2620.689) (-2631.482) * (-2623.675) (-2636.050) (-2633.245) [-2625.179] -- 0:03:20 506500 -- (-2634.907) (-2623.497) [-2622.571] (-2626.832) * (-2624.209) (-2636.228) [-2632.686] (-2631.752) -- 0:03:20 507000 -- [-2622.732] (-2625.174) (-2625.323) (-2627.815) * [-2629.188] (-2625.777) (-2630.494) (-2621.839) -- 0:03:20 507500 -- (-2627.140) (-2627.763) (-2627.659) [-2628.336] * (-2622.680) (-2628.632) [-2626.345] (-2628.037) -- 0:03:19 508000 -- [-2627.586] (-2625.058) (-2626.852) (-2624.973) * (-2627.948) (-2627.418) [-2630.460] (-2629.344) -- 0:03:19 508500 -- [-2626.616] (-2621.637) (-2622.698) (-2626.823) * (-2629.342) (-2635.950) [-2625.655] (-2626.916) -- 0:03:19 509000 -- (-2630.709) (-2619.790) [-2629.189] (-2636.058) * (-2624.964) (-2626.342) (-2626.217) [-2632.959] -- 0:03:19 509500 -- (-2630.830) (-2630.759) (-2629.161) [-2624.035] * (-2628.462) (-2630.579) (-2626.344) [-2623.865] -- 0:03:19 510000 -- (-2626.388) [-2620.876] (-2628.680) (-2623.643) * (-2625.471) (-2623.668) (-2624.832) [-2626.817] -- 0:03:18 Average standard deviation of split frequencies: 0.000369 510500 -- (-2630.331) [-2620.578] (-2628.352) (-2627.399) * (-2623.383) [-2621.728] (-2619.739) (-2628.234) -- 0:03:18 511000 -- (-2626.883) (-2623.178) (-2638.844) [-2622.001] * [-2623.220] (-2630.638) (-2629.506) (-2626.242) -- 0:03:18 511500 -- (-2634.591) (-2637.909) (-2626.968) [-2625.105] * (-2632.514) [-2625.257] (-2630.688) (-2628.076) -- 0:03:18 512000 -- (-2635.217) (-2623.975) (-2627.974) [-2630.198] * [-2624.570] (-2628.272) (-2625.858) (-2631.711) -- 0:03:18 512500 -- [-2629.562] (-2623.250) (-2628.853) (-2630.729) * (-2625.279) (-2629.853) (-2625.349) [-2625.198] -- 0:03:17 513000 -- (-2640.218) (-2622.061) (-2634.724) [-2622.826] * (-2630.800) (-2638.836) (-2624.860) [-2625.071] -- 0:03:17 513500 -- (-2624.221) (-2623.731) (-2637.736) [-2622.994] * (-2627.855) (-2631.515) [-2629.548] (-2623.875) -- 0:03:18 514000 -- [-2621.367] (-2630.509) (-2629.059) (-2624.372) * (-2639.699) (-2628.407) (-2628.487) [-2623.851] -- 0:03:17 514500 -- (-2634.900) (-2620.336) (-2630.375) [-2625.619] * (-2628.727) (-2623.392) [-2626.973] (-2626.895) -- 0:03:17 515000 -- (-2644.664) [-2628.446] (-2633.608) (-2622.867) * [-2629.167] (-2620.437) (-2630.377) (-2635.085) -- 0:03:16 Average standard deviation of split frequencies: 0.000365 515500 -- (-2630.931) [-2622.579] (-2622.204) (-2624.122) * (-2641.419) [-2629.185] (-2628.340) (-2629.218) -- 0:03:16 516000 -- [-2626.251] (-2634.622) (-2625.717) (-2632.220) * (-2639.746) (-2622.425) [-2632.280] (-2632.507) -- 0:03:16 516500 -- (-2624.306) (-2628.188) (-2627.086) [-2623.045] * [-2622.721] (-2625.319) (-2629.113) (-2625.358) -- 0:03:16 517000 -- [-2631.561] (-2621.723) (-2623.629) (-2627.889) * [-2625.923] (-2626.479) (-2627.968) (-2625.300) -- 0:03:16 517500 -- [-2626.364] (-2627.996) (-2625.078) (-2633.611) * [-2627.656] (-2636.606) (-2630.050) (-2630.985) -- 0:03:15 518000 -- (-2634.826) (-2624.857) [-2624.621] (-2630.234) * (-2628.464) [-2621.305] (-2628.735) (-2633.910) -- 0:03:15 518500 -- (-2625.428) (-2630.426) [-2625.118] (-2627.400) * (-2624.966) (-2625.215) [-2626.497] (-2624.711) -- 0:03:15 519000 -- (-2626.446) (-2626.800) (-2625.759) [-2632.583] * (-2626.752) [-2629.541] (-2623.015) (-2629.206) -- 0:03:15 519500 -- (-2628.602) (-2628.640) [-2623.488] (-2626.657) * [-2632.855] (-2619.067) (-2632.276) (-2625.434) -- 0:03:15 520000 -- [-2628.409] (-2621.502) (-2629.697) (-2628.502) * (-2622.482) (-2623.283) (-2629.446) [-2622.025] -- 0:03:14 Average standard deviation of split frequencies: 0.000362 520500 -- (-2629.594) (-2624.676) (-2624.797) [-2624.434] * [-2622.934] (-2624.795) (-2628.699) (-2625.976) -- 0:03:14 521000 -- (-2626.298) (-2625.337) (-2626.153) [-2630.640] * (-2624.842) (-2623.850) (-2625.996) [-2624.135] -- 0:03:14 521500 -- (-2632.557) [-2623.933] (-2624.148) (-2625.822) * (-2622.519) [-2627.898] (-2624.900) (-2628.013) -- 0:03:14 522000 -- (-2619.637) [-2630.342] (-2627.197) (-2625.581) * (-2629.706) (-2630.327) [-2621.982] (-2620.686) -- 0:03:14 522500 -- [-2624.297] (-2623.238) (-2625.172) (-2624.941) * (-2635.541) (-2623.871) (-2625.567) [-2627.989] -- 0:03:13 523000 -- (-2623.967) [-2623.429] (-2622.394) (-2623.379) * [-2636.872] (-2627.323) (-2635.064) (-2640.056) -- 0:03:13 523500 -- (-2623.621) [-2625.865] (-2629.019) (-2629.821) * (-2630.178) [-2620.209] (-2630.121) (-2626.807) -- 0:03:13 524000 -- (-2642.199) (-2622.292) [-2631.714] (-2621.569) * (-2626.744) [-2626.600] (-2625.255) (-2634.938) -- 0:03:13 524500 -- (-2625.070) (-2629.532) [-2632.219] (-2625.908) * (-2637.306) (-2624.978) [-2625.376] (-2627.634) -- 0:03:13 525000 -- (-2628.573) (-2623.560) (-2621.777) [-2623.185] * [-2625.213] (-2625.240) (-2632.363) (-2633.243) -- 0:03:12 Average standard deviation of split frequencies: 0.000358 525500 -- (-2620.103) (-2624.894) (-2628.320) [-2620.176] * (-2637.977) (-2625.207) (-2621.961) [-2626.522] -- 0:03:12 526000 -- (-2629.264) (-2624.419) (-2630.328) [-2626.911] * (-2624.589) [-2630.178] (-2628.439) (-2627.185) -- 0:03:12 526500 -- [-2624.186] (-2626.155) (-2629.529) (-2624.365) * (-2628.264) [-2624.292] (-2630.187) (-2628.658) -- 0:03:12 527000 -- [-2622.869] (-2629.285) (-2620.393) (-2626.706) * [-2626.140] (-2623.738) (-2638.365) (-2639.895) -- 0:03:12 527500 -- (-2624.849) (-2631.257) [-2626.350] (-2631.798) * (-2632.450) (-2622.268) (-2628.405) [-2625.504] -- 0:03:11 528000 -- (-2632.124) (-2626.389) (-2632.122) [-2625.864] * (-2627.095) [-2625.785] (-2625.594) (-2639.365) -- 0:03:11 528500 -- (-2627.073) (-2624.426) [-2626.914] (-2628.026) * (-2633.048) [-2627.445] (-2628.021) (-2630.862) -- 0:03:11 529000 -- (-2626.537) (-2624.858) [-2624.953] (-2625.100) * (-2635.984) [-2622.453] (-2628.772) (-2627.983) -- 0:03:11 529500 -- (-2632.404) (-2631.632) (-2621.942) [-2621.441] * (-2630.780) (-2628.813) [-2620.265] (-2620.505) -- 0:03:11 530000 -- (-2632.499) (-2638.978) (-2627.055) [-2629.525] * (-2623.257) (-2634.464) [-2628.830] (-2626.659) -- 0:03:10 Average standard deviation of split frequencies: 0.000355 530500 -- [-2628.185] (-2633.940) (-2627.725) (-2623.563) * (-2631.316) (-2639.121) [-2632.218] (-2626.148) -- 0:03:10 531000 -- (-2631.912) [-2629.397] (-2622.366) (-2626.871) * (-2627.489) (-2622.629) (-2632.251) [-2626.829] -- 0:03:10 531500 -- (-2620.216) (-2631.293) (-2624.437) [-2621.459] * [-2619.134] (-2636.779) (-2625.341) (-2624.128) -- 0:03:10 532000 -- (-2627.654) [-2623.151] (-2627.896) (-2622.997) * [-2625.163] (-2621.432) (-2624.660) (-2625.586) -- 0:03:10 532500 -- (-2627.596) (-2627.389) [-2627.719] (-2622.680) * (-2627.596) [-2622.035] (-2629.207) (-2631.122) -- 0:03:09 533000 -- (-2628.238) (-2626.572) (-2624.677) [-2623.048] * (-2629.667) (-2625.554) [-2629.187] (-2633.130) -- 0:03:09 533500 -- (-2633.365) [-2623.553] (-2631.320) (-2626.150) * (-2636.682) (-2630.094) (-2635.990) [-2622.443] -- 0:03:09 534000 -- (-2632.512) (-2625.495) (-2629.615) [-2630.948] * (-2628.777) (-2622.797) [-2626.067] (-2622.708) -- 0:03:09 534500 -- (-2636.184) [-2625.258] (-2623.268) (-2629.075) * (-2630.258) [-2627.810] (-2627.433) (-2622.456) -- 0:03:08 535000 -- [-2628.441] (-2627.576) (-2631.965) (-2626.224) * (-2626.972) (-2622.380) [-2625.739] (-2630.141) -- 0:03:08 Average standard deviation of split frequencies: 0.000352 535500 -- (-2624.211) (-2630.712) (-2622.106) [-2623.469] * [-2624.159] (-2628.328) (-2623.509) (-2643.019) -- 0:03:09 536000 -- (-2631.264) [-2622.853] (-2626.973) (-2625.262) * (-2630.956) [-2622.781] (-2625.050) (-2627.926) -- 0:03:08 536500 -- [-2619.691] (-2634.038) (-2627.598) (-2626.205) * [-2624.798] (-2627.124) (-2626.284) (-2634.986) -- 0:03:08 537000 -- (-2628.160) [-2629.388] (-2628.398) (-2641.085) * (-2622.899) [-2623.096] (-2633.184) (-2624.308) -- 0:03:07 537500 -- (-2630.865) [-2630.407] (-2633.725) (-2626.950) * [-2623.483] (-2626.019) (-2631.681) (-2630.813) -- 0:03:07 538000 -- (-2636.032) [-2628.777] (-2625.986) (-2618.887) * (-2620.252) [-2620.835] (-2636.389) (-2628.225) -- 0:03:08 538500 -- (-2628.662) (-2624.863) [-2624.955] (-2629.125) * (-2628.396) [-2621.421] (-2628.116) (-2624.281) -- 0:03:07 539000 -- (-2622.424) (-2633.877) [-2623.018] (-2629.776) * (-2631.221) (-2624.410) [-2622.414] (-2624.360) -- 0:03:07 539500 -- (-2625.888) (-2627.328) (-2625.013) [-2623.068] * (-2623.168) [-2620.125] (-2628.554) (-2622.046) -- 0:03:06 540000 -- [-2622.949] (-2624.142) (-2626.751) (-2625.024) * [-2625.054] (-2629.109) (-2624.017) (-2629.501) -- 0:03:06 Average standard deviation of split frequencies: 0.000349 540500 -- (-2626.190) [-2623.381] (-2625.740) (-2629.287) * [-2623.474] (-2624.107) (-2628.729) (-2631.662) -- 0:03:07 541000 -- (-2625.845) [-2625.178] (-2634.000) (-2628.934) * (-2628.084) (-2624.499) (-2629.374) [-2625.235] -- 0:03:06 541500 -- (-2625.412) [-2626.818] (-2630.223) (-2625.667) * (-2625.500) [-2625.467] (-2623.164) (-2629.768) -- 0:03:06 542000 -- [-2623.750] (-2623.200) (-2628.517) (-2619.950) * (-2629.169) [-2629.964] (-2626.779) (-2633.378) -- 0:03:05 542500 -- (-2628.506) (-2623.794) (-2632.727) [-2624.040] * (-2631.549) [-2632.826] (-2625.502) (-2634.690) -- 0:03:05 543000 -- (-2622.836) [-2624.793] (-2635.359) (-2629.032) * (-2633.777) [-2623.814] (-2635.564) (-2633.341) -- 0:03:05 543500 -- (-2627.563) (-2625.451) [-2630.048] (-2625.809) * (-2633.071) [-2623.869] (-2631.024) (-2628.713) -- 0:03:05 544000 -- (-2632.651) [-2627.491] (-2622.645) (-2641.969) * (-2635.661) [-2624.335] (-2624.138) (-2624.427) -- 0:03:05 544500 -- (-2631.099) (-2630.723) [-2631.209] (-2627.578) * (-2628.397) (-2625.895) [-2625.990] (-2622.116) -- 0:03:04 545000 -- [-2626.558] (-2625.972) (-2632.199) (-2630.733) * (-2632.590) (-2625.043) [-2628.792] (-2622.568) -- 0:03:04 Average standard deviation of split frequencies: 0.000345 545500 -- [-2627.175] (-2629.959) (-2626.349) (-2629.209) * (-2625.411) (-2628.142) [-2624.982] (-2632.832) -- 0:03:04 546000 -- (-2624.329) [-2623.318] (-2625.492) (-2627.010) * (-2621.007) [-2627.263] (-2625.466) (-2627.030) -- 0:03:04 546500 -- [-2621.382] (-2627.251) (-2621.303) (-2630.974) * [-2631.001] (-2624.493) (-2621.266) (-2628.377) -- 0:03:04 547000 -- (-2623.101) (-2625.568) [-2624.828] (-2624.152) * (-2629.329) (-2626.533) [-2624.378] (-2624.181) -- 0:03:03 547500 -- (-2622.278) (-2621.168) (-2630.678) [-2631.691] * [-2628.094] (-2622.840) (-2623.335) (-2623.163) -- 0:03:04 548000 -- (-2629.268) (-2637.570) [-2626.529] (-2620.657) * (-2621.976) (-2626.391) [-2623.056] (-2628.621) -- 0:03:03 548500 -- [-2626.324] (-2624.947) (-2635.913) (-2627.429) * (-2625.344) (-2630.721) [-2627.894] (-2629.783) -- 0:03:03 549000 -- [-2628.306] (-2626.852) (-2624.244) (-2631.612) * (-2633.435) (-2630.487) [-2631.995] (-2626.920) -- 0:03:03 549500 -- (-2627.165) (-2624.937) (-2625.346) [-2624.811] * (-2635.801) (-2627.082) [-2623.807] (-2629.716) -- 0:03:02 550000 -- (-2626.976) (-2634.176) [-2619.549] (-2622.199) * (-2623.560) (-2625.226) [-2624.571] (-2622.657) -- 0:03:03 Average standard deviation of split frequencies: 0.000342 550500 -- (-2624.986) (-2630.452) (-2625.904) [-2629.900] * [-2626.024] (-2628.373) (-2623.866) (-2624.651) -- 0:03:02 551000 -- (-2627.824) (-2624.601) (-2624.223) [-2627.866] * [-2627.265] (-2622.410) (-2630.489) (-2629.914) -- 0:03:02 551500 -- (-2633.544) [-2627.598] (-2631.047) (-2622.641) * (-2635.046) [-2622.954] (-2622.404) (-2627.655) -- 0:03:02 552000 -- (-2628.995) [-2619.745] (-2638.540) (-2629.886) * (-2641.505) (-2629.017) [-2625.166] (-2633.202) -- 0:03:01 552500 -- (-2632.753) (-2623.341) [-2633.025] (-2625.088) * (-2621.936) (-2623.652) (-2626.844) [-2636.734] -- 0:03:02 553000 -- [-2622.860] (-2631.483) (-2634.287) (-2641.584) * (-2627.304) [-2626.092] (-2627.307) (-2636.223) -- 0:03:01 553500 -- [-2625.832] (-2623.957) (-2629.956) (-2628.263) * (-2623.199) (-2633.686) [-2623.065] (-2632.476) -- 0:03:01 554000 -- (-2630.931) [-2623.067] (-2627.187) (-2623.984) * (-2632.226) (-2630.700) [-2625.551] (-2629.445) -- 0:03:01 554500 -- (-2627.448) (-2618.810) (-2624.914) [-2622.093] * (-2628.820) (-2628.472) [-2621.725] (-2629.566) -- 0:03:00 555000 -- (-2631.529) [-2626.649] (-2622.710) (-2627.278) * (-2621.647) (-2633.463) (-2622.693) [-2631.334] -- 0:03:01 Average standard deviation of split frequencies: 0.000339 555500 -- (-2629.143) [-2621.319] (-2622.459) (-2634.923) * (-2628.587) (-2626.139) (-2627.884) [-2623.418] -- 0:03:00 556000 -- (-2625.581) (-2629.081) [-2623.572] (-2624.532) * [-2630.444] (-2636.075) (-2624.736) (-2633.494) -- 0:03:00 556500 -- (-2620.047) (-2623.978) [-2624.529] (-2622.380) * (-2627.082) (-2627.003) [-2620.383] (-2627.225) -- 0:03:00 557000 -- (-2629.125) (-2627.663) (-2624.889) [-2624.299] * (-2631.848) (-2620.955) [-2618.176] (-2628.269) -- 0:02:59 557500 -- (-2633.261) (-2619.668) [-2622.344] (-2630.814) * (-2626.274) [-2623.366] (-2628.577) (-2632.621) -- 0:03:00 558000 -- (-2626.352) [-2623.797] (-2627.976) (-2632.888) * (-2627.349) (-2624.410) (-2627.906) [-2626.194] -- 0:02:59 558500 -- (-2622.333) (-2625.490) [-2619.915] (-2624.134) * (-2626.330) (-2633.832) [-2625.095] (-2630.491) -- 0:02:59 559000 -- (-2630.927) (-2622.946) (-2625.709) [-2624.672] * (-2632.748) (-2625.329) (-2619.824) [-2628.501] -- 0:02:59 559500 -- [-2631.798] (-2625.895) (-2619.450) (-2622.127) * (-2628.558) (-2623.265) [-2621.654] (-2625.251) -- 0:02:58 560000 -- [-2619.381] (-2630.817) (-2629.150) (-2624.035) * (-2632.727) (-2631.982) [-2626.506] (-2620.988) -- 0:02:59 Average standard deviation of split frequencies: 0.000336 560500 -- [-2620.455] (-2636.827) (-2629.314) (-2626.229) * (-2629.059) [-2625.077] (-2628.949) (-2629.044) -- 0:02:58 561000 -- (-2622.359) (-2627.827) [-2623.849] (-2628.305) * (-2625.960) (-2625.982) [-2623.925] (-2634.726) -- 0:02:58 561500 -- (-2642.356) (-2627.020) (-2630.284) [-2621.485] * (-2626.206) (-2626.398) [-2630.400] (-2625.595) -- 0:02:58 562000 -- (-2642.087) [-2625.522] (-2623.613) (-2621.383) * (-2624.957) [-2625.609] (-2627.280) (-2626.855) -- 0:02:57 562500 -- (-2626.867) [-2623.420] (-2634.637) (-2623.602) * (-2626.778) [-2632.330] (-2628.597) (-2626.046) -- 0:02:58 563000 -- [-2627.925] (-2625.815) (-2627.583) (-2630.508) * (-2625.890) (-2626.594) (-2626.841) [-2624.927] -- 0:02:57 563500 -- [-2622.116] (-2627.032) (-2620.634) (-2621.393) * (-2626.980) [-2624.622] (-2625.706) (-2624.537) -- 0:02:57 564000 -- [-2619.364] (-2626.621) (-2626.912) (-2624.351) * (-2629.272) (-2631.533) (-2627.117) [-2625.397] -- 0:02:57 564500 -- (-2623.693) (-2624.052) (-2620.562) [-2621.331] * (-2626.393) (-2623.502) (-2626.268) [-2628.849] -- 0:02:56 565000 -- (-2622.720) (-2624.620) (-2632.988) [-2626.605] * (-2628.770) (-2617.124) [-2628.169] (-2621.484) -- 0:02:57 Average standard deviation of split frequencies: 0.000333 565500 -- [-2621.394] (-2629.056) (-2625.809) (-2622.651) * [-2626.840] (-2635.293) (-2632.616) (-2627.137) -- 0:02:56 566000 -- (-2621.886) (-2625.426) (-2625.408) [-2629.669] * (-2630.961) (-2629.461) (-2627.747) [-2625.554] -- 0:02:56 566500 -- (-2623.705) (-2631.189) [-2620.656] (-2626.041) * (-2626.042) (-2622.151) (-2624.158) [-2624.560] -- 0:02:56 567000 -- [-2628.003] (-2635.196) (-2623.470) (-2635.106) * [-2625.164] (-2632.649) (-2623.290) (-2622.007) -- 0:02:55 567500 -- [-2624.636] (-2625.162) (-2623.118) (-2633.387) * (-2626.630) (-2629.132) [-2627.128] (-2626.314) -- 0:02:56 568000 -- (-2631.575) (-2627.314) (-2622.524) [-2634.303] * [-2622.310] (-2626.866) (-2625.272) (-2624.747) -- 0:02:55 568500 -- (-2626.814) [-2622.705] (-2630.272) (-2634.349) * (-2629.142) (-2632.347) [-2625.117] (-2631.067) -- 0:02:55 569000 -- (-2634.399) (-2624.244) [-2627.927] (-2633.829) * (-2621.887) (-2627.970) (-2625.542) [-2623.700] -- 0:02:54 569500 -- [-2626.465] (-2627.055) (-2630.030) (-2628.988) * (-2622.748) (-2626.218) (-2622.422) [-2625.398] -- 0:02:54 570000 -- (-2630.294) (-2628.137) (-2621.564) [-2622.814] * [-2623.561] (-2629.346) (-2626.755) (-2631.449) -- 0:02:55 Average standard deviation of split frequencies: 0.000330 570500 -- (-2625.191) (-2634.470) [-2627.700] (-2627.549) * [-2622.017] (-2622.284) (-2630.359) (-2635.100) -- 0:02:54 571000 -- (-2629.620) [-2626.620] (-2626.009) (-2625.610) * (-2639.362) (-2623.573) (-2625.935) [-2623.554] -- 0:02:54 571500 -- (-2631.927) (-2632.200) [-2624.431] (-2623.547) * (-2627.411) (-2629.351) (-2625.085) [-2629.610] -- 0:02:53 572000 -- (-2635.182) [-2627.104] (-2628.046) (-2625.627) * (-2632.427) [-2622.501] (-2634.868) (-2626.807) -- 0:02:54 572500 -- [-2633.017] (-2620.307) (-2622.668) (-2631.566) * [-2622.627] (-2628.174) (-2628.011) (-2635.324) -- 0:02:53 573000 -- (-2625.910) (-2627.094) [-2624.377] (-2627.881) * (-2621.830) [-2622.500] (-2624.715) (-2625.986) -- 0:02:53 573500 -- (-2622.591) [-2622.516] (-2625.708) (-2633.266) * (-2624.332) (-2634.139) [-2624.100] (-2630.785) -- 0:02:53 574000 -- [-2621.935] (-2627.071) (-2624.065) (-2624.636) * [-2624.284] (-2634.541) (-2621.601) (-2636.207) -- 0:02:52 574500 -- (-2625.017) [-2626.392] (-2628.333) (-2624.152) * (-2630.817) [-2628.418] (-2622.881) (-2632.450) -- 0:02:53 575000 -- (-2624.788) (-2623.948) [-2626.521] (-2630.126) * [-2629.220] (-2630.314) (-2626.967) (-2630.939) -- 0:02:52 Average standard deviation of split frequencies: 0.000327 575500 -- (-2625.354) (-2624.978) [-2625.655] (-2620.262) * (-2628.375) (-2629.218) [-2627.147] (-2634.620) -- 0:02:52 576000 -- (-2624.249) [-2627.453] (-2620.695) (-2621.369) * [-2625.075] (-2640.582) (-2627.791) (-2634.955) -- 0:02:52 576500 -- (-2635.077) (-2626.808) (-2637.755) [-2630.707] * [-2620.543] (-2640.097) (-2623.745) (-2633.551) -- 0:02:51 577000 -- [-2625.870] (-2625.577) (-2629.180) (-2628.314) * [-2621.192] (-2627.581) (-2624.513) (-2623.230) -- 0:02:52 577500 -- (-2630.956) [-2626.150] (-2623.073) (-2633.089) * [-2628.045] (-2626.743) (-2628.057) (-2626.399) -- 0:02:51 578000 -- [-2623.202] (-2629.979) (-2631.497) (-2626.152) * (-2623.994) [-2631.300] (-2625.382) (-2625.162) -- 0:02:51 578500 -- (-2621.754) (-2630.314) [-2621.771] (-2627.813) * [-2625.056] (-2628.999) (-2628.652) (-2626.321) -- 0:02:51 579000 -- (-2635.839) (-2625.160) [-2626.702] (-2627.404) * (-2631.824) [-2628.516] (-2629.348) (-2621.478) -- 0:02:50 579500 -- (-2627.998) (-2624.214) [-2628.299] (-2624.695) * (-2628.662) [-2627.612] (-2626.656) (-2622.831) -- 0:02:51 580000 -- (-2631.858) (-2621.742) [-2626.950] (-2635.050) * (-2635.404) (-2630.034) [-2633.529] (-2629.583) -- 0:02:50 Average standard deviation of split frequencies: 0.000325 580500 -- [-2629.181] (-2631.049) (-2619.323) (-2636.417) * (-2628.832) [-2624.974] (-2629.412) (-2628.966) -- 0:02:50 581000 -- (-2627.119) (-2634.102) (-2627.156) [-2633.445] * (-2629.478) [-2625.005] (-2626.207) (-2625.587) -- 0:02:50 581500 -- [-2629.455] (-2628.753) (-2626.737) (-2628.506) * [-2629.723] (-2626.813) (-2626.381) (-2636.212) -- 0:02:49 582000 -- (-2630.584) [-2622.196] (-2628.307) (-2633.909) * (-2623.740) (-2629.242) [-2621.672] (-2641.162) -- 0:02:50 582500 -- [-2635.640] (-2629.247) (-2630.667) (-2636.876) * (-2626.506) (-2621.860) [-2624.600] (-2636.669) -- 0:02:49 583000 -- [-2629.097] (-2624.053) (-2628.871) (-2627.329) * (-2621.310) (-2620.149) (-2624.226) [-2626.015] -- 0:02:49 583500 -- [-2623.370] (-2627.099) (-2623.012) (-2633.282) * (-2626.328) (-2632.973) (-2633.298) [-2636.298] -- 0:02:49 584000 -- (-2628.985) [-2625.225] (-2628.898) (-2629.031) * [-2627.889] (-2633.170) (-2628.044) (-2629.897) -- 0:02:48 584500 -- (-2627.677) [-2624.097] (-2629.420) (-2629.910) * [-2624.428] (-2624.373) (-2620.028) (-2626.693) -- 0:02:49 585000 -- [-2626.299] (-2626.427) (-2629.804) (-2625.747) * (-2628.067) (-2633.320) (-2623.224) [-2622.053] -- 0:02:48 Average standard deviation of split frequencies: 0.000322 585500 -- (-2626.792) (-2637.872) (-2624.653) [-2625.741] * [-2621.847] (-2621.399) (-2626.685) (-2627.493) -- 0:02:48 586000 -- (-2619.211) [-2625.467] (-2625.938) (-2637.290) * (-2626.033) (-2627.322) [-2634.326] (-2620.734) -- 0:02:48 586500 -- [-2619.293] (-2635.013) (-2625.473) (-2633.725) * (-2633.695) (-2631.513) [-2623.227] (-2626.297) -- 0:02:47 587000 -- (-2625.120) [-2634.166] (-2626.103) (-2629.561) * (-2623.073) [-2623.907] (-2629.709) (-2630.113) -- 0:02:48 587500 -- [-2629.974] (-2635.067) (-2634.056) (-2630.109) * [-2626.066] (-2627.786) (-2629.323) (-2634.040) -- 0:02:47 588000 -- (-2634.817) (-2630.089) [-2621.999] (-2630.448) * (-2630.562) (-2626.654) [-2628.126] (-2631.524) -- 0:02:47 588500 -- (-2622.826) (-2630.238) [-2624.392] (-2623.375) * (-2629.068) [-2622.662] (-2624.289) (-2626.782) -- 0:02:47 589000 -- (-2636.593) (-2626.177) [-2625.780] (-2633.137) * (-2622.372) [-2629.585] (-2629.541) (-2632.459) -- 0:02:46 589500 -- (-2627.940) (-2628.365) (-2626.635) [-2620.864] * (-2626.226) (-2621.391) (-2629.642) [-2631.862] -- 0:02:47 590000 -- (-2625.423) [-2627.642] (-2628.870) (-2624.404) * [-2621.940] (-2632.700) (-2625.780) (-2634.040) -- 0:02:46 Average standard deviation of split frequencies: 0.000319 590500 -- [-2620.017] (-2630.099) (-2623.460) (-2622.389) * (-2626.277) [-2625.926] (-2631.334) (-2628.394) -- 0:02:46 591000 -- [-2624.831] (-2633.478) (-2620.500) (-2625.563) * (-2625.532) (-2631.578) [-2619.516] (-2625.377) -- 0:02:46 591500 -- (-2629.573) (-2633.568) [-2623.859] (-2623.519) * (-2624.248) [-2628.343] (-2623.178) (-2626.256) -- 0:02:45 592000 -- (-2634.204) [-2623.566] (-2626.214) (-2627.016) * (-2632.234) (-2631.608) [-2623.038] (-2628.459) -- 0:02:46 592500 -- (-2630.230) [-2626.235] (-2631.479) (-2635.619) * (-2633.250) (-2620.245) (-2620.334) [-2625.493] -- 0:02:45 593000 -- [-2622.570] (-2630.177) (-2630.303) (-2631.538) * (-2626.667) (-2626.926) (-2621.584) [-2631.986] -- 0:02:45 593500 -- (-2626.747) (-2620.795) [-2631.914] (-2630.993) * (-2627.935) (-2627.609) (-2622.159) [-2631.757] -- 0:02:45 594000 -- [-2633.943] (-2623.033) (-2629.652) (-2628.931) * (-2624.324) (-2633.271) (-2627.675) [-2628.743] -- 0:02:44 594500 -- (-2630.745) (-2620.766) (-2627.184) [-2623.232] * (-2634.420) (-2628.634) [-2624.640] (-2628.078) -- 0:02:45 595000 -- (-2625.918) (-2627.379) [-2628.723] (-2624.626) * (-2622.996) [-2624.868] (-2620.860) (-2630.145) -- 0:02:44 Average standard deviation of split frequencies: 0.000316 595500 -- (-2625.105) (-2626.370) [-2626.039] (-2629.632) * [-2622.238] (-2630.163) (-2626.179) (-2624.141) -- 0:02:44 596000 -- (-2625.574) (-2627.209) [-2621.233] (-2627.876) * (-2628.319) [-2628.225] (-2626.290) (-2624.587) -- 0:02:44 596500 -- (-2623.259) (-2620.021) (-2626.059) [-2624.318] * (-2631.946) [-2621.318] (-2633.756) (-2623.068) -- 0:02:44 597000 -- (-2622.587) (-2624.566) (-2627.596) [-2620.474] * [-2629.339] (-2620.636) (-2634.523) (-2625.011) -- 0:02:44 597500 -- (-2621.733) (-2627.276) (-2623.726) [-2619.544] * (-2637.342) (-2626.484) (-2630.364) [-2625.570] -- 0:02:43 598000 -- [-2621.153] (-2624.436) (-2621.982) (-2628.289) * (-2629.835) [-2624.161] (-2629.354) (-2625.274) -- 0:02:43 598500 -- (-2624.736) (-2625.372) [-2625.129] (-2628.684) * [-2625.308] (-2628.322) (-2622.441) (-2634.764) -- 0:02:43 599000 -- [-2622.611] (-2622.153) (-2625.092) (-2626.375) * (-2626.745) (-2637.529) (-2636.447) [-2629.726] -- 0:02:43 599500 -- (-2625.523) (-2625.794) (-2627.021) [-2626.028] * (-2630.379) [-2628.632] (-2633.297) (-2621.006) -- 0:02:43 600000 -- (-2619.635) [-2624.388] (-2627.218) (-2624.233) * (-2631.307) (-2630.420) (-2624.192) [-2633.016] -- 0:02:42 Average standard deviation of split frequencies: 0.000314 600500 -- (-2631.799) [-2626.228] (-2631.177) (-2629.006) * (-2623.684) (-2628.281) [-2623.518] (-2632.955) -- 0:02:42 601000 -- (-2623.839) (-2630.515) (-2628.165) [-2629.881] * [-2621.570] (-2621.002) (-2627.139) (-2623.852) -- 0:02:41 601500 -- (-2630.836) (-2630.058) (-2624.451) [-2628.662] * [-2625.168] (-2630.674) (-2624.909) (-2627.778) -- 0:02:42 602000 -- (-2626.801) [-2623.994] (-2627.609) (-2625.766) * [-2622.148] (-2625.050) (-2627.511) (-2628.708) -- 0:02:41 602500 -- (-2622.483) (-2630.725) (-2626.270) [-2624.670] * [-2624.616] (-2627.968) (-2624.188) (-2626.392) -- 0:02:41 603000 -- [-2630.672] (-2631.262) (-2625.220) (-2623.378) * (-2624.344) (-2634.557) [-2624.322] (-2628.259) -- 0:02:41 603500 -- (-2627.793) (-2629.207) (-2623.556) [-2622.162] * (-2625.522) (-2626.976) [-2621.895] (-2645.954) -- 0:02:40 604000 -- (-2621.734) [-2620.055] (-2621.904) (-2634.489) * [-2622.526] (-2625.932) (-2621.605) (-2630.682) -- 0:02:41 604500 -- (-2637.201) [-2617.296] (-2626.917) (-2630.556) * (-2630.476) [-2626.196] (-2627.525) (-2628.334) -- 0:02:40 605000 -- (-2629.319) (-2624.207) (-2632.967) [-2625.085] * (-2625.640) (-2626.314) [-2630.248] (-2623.356) -- 0:02:40 Average standard deviation of split frequencies: 0.000311 605500 -- [-2622.745] (-2631.635) (-2633.987) (-2631.179) * (-2620.985) (-2643.199) (-2625.200) [-2623.273] -- 0:02:40 606000 -- (-2635.484) [-2623.556] (-2626.803) (-2630.610) * (-2624.914) [-2624.187] (-2623.887) (-2627.404) -- 0:02:39 606500 -- (-2629.952) [-2623.548] (-2628.387) (-2642.878) * (-2632.973) (-2626.940) (-2625.679) [-2626.370] -- 0:02:40 607000 -- (-2625.578) [-2620.979] (-2624.715) (-2630.120) * (-2637.083) [-2630.215] (-2626.084) (-2627.355) -- 0:02:39 607500 -- (-2627.515) (-2629.362) (-2628.965) [-2620.606] * [-2623.431] (-2630.039) (-2620.555) (-2627.283) -- 0:02:39 608000 -- (-2629.633) (-2625.076) (-2627.146) [-2626.588] * (-2629.981) [-2629.427] (-2621.102) (-2627.240) -- 0:02:39 608500 -- (-2634.731) (-2624.166) [-2629.042] (-2621.382) * (-2628.558) (-2621.766) (-2627.687) [-2625.933] -- 0:02:38 609000 -- (-2623.684) [-2619.843] (-2629.360) (-2629.234) * (-2630.113) [-2628.036] (-2628.420) (-2632.339) -- 0:02:39 609500 -- (-2632.568) (-2624.630) [-2623.418] (-2629.215) * (-2622.029) (-2635.456) [-2623.695] (-2626.444) -- 0:02:38 610000 -- [-2620.783] (-2626.533) (-2623.371) (-2620.089) * [-2623.863] (-2625.776) (-2621.094) (-2631.355) -- 0:02:38 Average standard deviation of split frequencies: 0.000309 610500 -- (-2623.646) [-2627.036] (-2624.842) (-2621.386) * (-2627.192) (-2630.922) (-2623.201) [-2627.415] -- 0:02:38 611000 -- [-2623.716] (-2629.545) (-2626.798) (-2620.247) * (-2624.091) (-2629.961) [-2628.020] (-2628.003) -- 0:02:37 611500 -- (-2622.417) (-2627.272) [-2632.942] (-2634.687) * [-2621.225] (-2633.185) (-2631.881) (-2631.243) -- 0:02:38 612000 -- (-2628.213) [-2620.142] (-2631.862) (-2623.267) * [-2624.150] (-2626.234) (-2632.388) (-2625.485) -- 0:02:37 612500 -- (-2626.149) (-2623.593) (-2627.463) [-2623.240] * (-2624.901) [-2620.162] (-2639.524) (-2621.676) -- 0:02:37 613000 -- [-2626.214] (-2626.745) (-2624.104) (-2627.069) * [-2621.325] (-2628.976) (-2632.941) (-2634.630) -- 0:02:37 613500 -- (-2626.771) (-2627.784) [-2625.786] (-2631.726) * [-2630.500] (-2627.024) (-2621.239) (-2622.896) -- 0:02:36 614000 -- (-2620.807) (-2622.224) [-2625.475] (-2622.853) * (-2628.985) (-2620.676) (-2631.260) [-2621.779] -- 0:02:37 614500 -- (-2628.329) (-2635.267) [-2626.013] (-2627.703) * (-2630.482) (-2628.885) (-2625.798) [-2624.106] -- 0:02:36 615000 -- (-2631.334) (-2633.331) [-2621.037] (-2623.269) * [-2626.055] (-2626.790) (-2631.112) (-2624.038) -- 0:02:36 Average standard deviation of split frequencies: 0.000306 615500 -- (-2630.143) [-2620.185] (-2622.064) (-2627.236) * (-2625.577) (-2625.552) [-2627.037] (-2623.783) -- 0:02:36 616000 -- (-2627.962) (-2630.698) (-2620.047) [-2619.492] * (-2628.827) [-2628.220] (-2628.507) (-2623.255) -- 0:02:35 616500 -- (-2628.602) [-2625.603] (-2626.657) (-2631.193) * [-2625.517] (-2624.089) (-2629.398) (-2626.762) -- 0:02:36 617000 -- [-2626.565] (-2623.298) (-2626.924) (-2623.274) * (-2627.483) [-2620.101] (-2634.564) (-2635.096) -- 0:02:35 617500 -- (-2628.185) (-2628.654) [-2627.787] (-2624.939) * (-2629.264) (-2625.931) [-2624.015] (-2632.088) -- 0:02:35 618000 -- (-2623.848) (-2631.867) [-2627.010] (-2632.315) * (-2626.108) (-2626.592) [-2621.462] (-2629.958) -- 0:02:35 618500 -- [-2628.827] (-2629.250) (-2619.302) (-2621.702) * [-2631.849] (-2630.887) (-2623.759) (-2628.330) -- 0:02:35 619000 -- (-2625.907) [-2623.844] (-2621.693) (-2626.723) * (-2632.500) [-2626.532] (-2630.604) (-2625.514) -- 0:02:35 619500 -- [-2624.165] (-2624.196) (-2624.785) (-2631.151) * (-2628.914) [-2622.337] (-2625.274) (-2621.903) -- 0:02:34 620000 -- (-2622.176) (-2623.876) (-2629.861) [-2621.824] * [-2624.726] (-2625.069) (-2622.750) (-2623.082) -- 0:02:34 Average standard deviation of split frequencies: 0.000304 620500 -- (-2624.947) (-2628.857) (-2625.450) [-2635.559] * (-2622.090) [-2627.509] (-2627.737) (-2631.034) -- 0:02:34 621000 -- (-2627.003) (-2627.832) [-2628.194] (-2628.091) * (-2623.341) (-2632.295) (-2636.541) [-2625.217] -- 0:02:34 621500 -- (-2634.742) [-2621.038] (-2629.827) (-2623.774) * (-2630.546) [-2623.883] (-2632.076) (-2620.816) -- 0:02:34 622000 -- (-2624.605) (-2631.046) (-2625.911) [-2621.812] * [-2621.190] (-2632.880) (-2632.335) (-2622.029) -- 0:02:33 622500 -- (-2636.131) [-2625.055] (-2625.661) (-2625.208) * [-2624.102] (-2620.716) (-2637.509) (-2625.337) -- 0:02:33 623000 -- [-2625.599] (-2625.033) (-2627.372) (-2627.516) * [-2624.581] (-2624.191) (-2631.330) (-2637.027) -- 0:02:33 623500 -- [-2625.621] (-2628.600) (-2624.092) (-2626.257) * (-2621.622) (-2628.111) [-2630.009] (-2623.953) -- 0:02:33 624000 -- (-2624.694) (-2639.420) [-2629.523] (-2624.299) * (-2624.327) (-2624.976) (-2631.920) [-2621.081] -- 0:02:33 624500 -- (-2635.170) (-2628.504) (-2624.497) [-2622.401] * [-2629.272] (-2633.300) (-2627.058) (-2628.623) -- 0:02:32 625000 -- [-2623.403] (-2624.883) (-2624.385) (-2626.033) * (-2640.783) [-2621.994] (-2621.452) (-2626.038) -- 0:02:32 Average standard deviation of split frequencies: 0.000301 625500 -- (-2629.031) [-2628.250] (-2625.450) (-2626.372) * (-2630.446) [-2630.246] (-2631.232) (-2626.831) -- 0:02:32 626000 -- [-2621.529] (-2627.348) (-2628.486) (-2628.510) * (-2632.162) [-2629.420] (-2625.526) (-2622.683) -- 0:02:32 626500 -- (-2624.445) (-2627.124) [-2625.254] (-2628.899) * (-2635.563) (-2630.559) [-2629.350] (-2622.105) -- 0:02:32 627000 -- (-2622.248) [-2627.399] (-2630.019) (-2625.987) * [-2635.854] (-2621.322) (-2635.858) (-2622.778) -- 0:02:31 627500 -- (-2625.609) [-2627.555] (-2622.899) (-2634.818) * [-2628.716] (-2619.875) (-2628.928) (-2626.585) -- 0:02:31 628000 -- (-2628.938) (-2631.642) (-2623.158) [-2624.937] * (-2628.875) [-2629.666] (-2632.966) (-2624.923) -- 0:02:31 628500 -- (-2627.951) [-2625.195] (-2624.908) (-2628.006) * [-2623.367] (-2623.414) (-2627.513) (-2628.120) -- 0:02:31 629000 -- [-2624.274] (-2632.121) (-2630.348) (-2622.574) * (-2624.650) [-2620.011] (-2636.943) (-2627.040) -- 0:02:30 629500 -- (-2624.928) [-2620.836] (-2622.754) (-2622.746) * [-2621.995] (-2622.880) (-2636.384) (-2624.206) -- 0:02:30 630000 -- (-2629.159) (-2625.722) [-2621.996] (-2626.051) * (-2642.957) (-2626.071) [-2634.465] (-2630.553) -- 0:02:30 Average standard deviation of split frequencies: 0.000299 630500 -- (-2619.680) [-2629.459] (-2624.441) (-2619.791) * (-2629.728) [-2625.423] (-2627.542) (-2620.319) -- 0:02:30 631000 -- (-2624.687) (-2629.612) [-2628.467] (-2629.381) * (-2636.833) [-2625.122] (-2628.040) (-2621.724) -- 0:02:30 631500 -- (-2623.566) (-2622.502) (-2632.119) [-2622.733] * (-2628.648) (-2624.100) [-2625.377] (-2630.425) -- 0:02:29 632000 -- (-2630.099) [-2620.052] (-2630.358) (-2625.289) * (-2633.047) [-2622.533] (-2624.237) (-2626.773) -- 0:02:29 632500 -- (-2623.159) (-2626.845) [-2624.694] (-2627.911) * (-2633.429) [-2622.793] (-2627.740) (-2623.291) -- 0:02:29 633000 -- [-2622.152] (-2625.360) (-2627.744) (-2627.571) * (-2628.936) (-2637.750) (-2625.527) [-2623.927] -- 0:02:29 633500 -- (-2633.182) (-2627.160) (-2630.766) [-2628.906] * (-2632.912) [-2623.011] (-2627.903) (-2624.969) -- 0:02:29 634000 -- [-2633.083] (-2623.029) (-2629.468) (-2629.233) * (-2622.776) [-2622.696] (-2632.115) (-2625.494) -- 0:02:28 634500 -- (-2626.976) [-2621.256] (-2624.439) (-2621.281) * [-2627.928] (-2630.529) (-2628.359) (-2631.546) -- 0:02:28 635000 -- (-2628.535) (-2626.262) [-2625.565] (-2623.566) * (-2631.781) (-2636.664) [-2625.069] (-2633.114) -- 0:02:28 Average standard deviation of split frequencies: 0.000296 635500 -- (-2630.452) [-2623.319] (-2621.040) (-2625.388) * (-2631.871) (-2628.755) [-2623.743] (-2622.689) -- 0:02:28 636000 -- (-2620.446) (-2622.373) [-2622.954] (-2627.998) * [-2624.472] (-2634.091) (-2633.215) (-2627.035) -- 0:02:28 636500 -- [-2628.376] (-2624.096) (-2622.012) (-2629.725) * (-2625.014) [-2620.914] (-2635.684) (-2622.215) -- 0:02:27 637000 -- [-2619.302] (-2623.367) (-2621.729) (-2622.963) * (-2626.561) (-2626.003) [-2618.020] (-2629.669) -- 0:02:27 637500 -- (-2633.308) (-2625.500) [-2623.644] (-2630.898) * (-2627.149) (-2630.615) [-2619.490] (-2628.778) -- 0:02:27 638000 -- (-2623.219) [-2629.236] (-2622.235) (-2624.871) * [-2628.951] (-2626.195) (-2621.033) (-2626.425) -- 0:02:27 638500 -- [-2625.255] (-2629.315) (-2626.716) (-2625.023) * (-2629.365) [-2621.694] (-2630.992) (-2621.340) -- 0:02:27 639000 -- (-2623.629) (-2633.734) (-2633.929) [-2625.669] * (-2621.069) [-2622.860] (-2624.276) (-2625.773) -- 0:02:26 639500 -- (-2627.681) (-2626.173) (-2630.197) [-2618.770] * (-2624.290) [-2627.052] (-2627.396) (-2623.558) -- 0:02:26 640000 -- [-2621.956] (-2629.186) (-2628.057) (-2623.800) * (-2622.382) (-2631.450) (-2628.037) [-2622.921] -- 0:02:26 Average standard deviation of split frequencies: 0.000294 640500 -- [-2622.537] (-2627.121) (-2625.678) (-2630.004) * (-2627.745) [-2630.311] (-2621.220) (-2624.522) -- 0:02:26 641000 -- (-2626.115) [-2625.024] (-2625.300) (-2625.459) * (-2622.658) (-2622.760) [-2621.546] (-2625.152) -- 0:02:26 641500 -- (-2626.938) (-2622.747) [-2631.931] (-2623.598) * (-2625.657) (-2628.450) [-2623.161] (-2619.945) -- 0:02:25 642000 -- (-2627.438) [-2624.864] (-2630.481) (-2631.189) * (-2628.171) (-2628.039) [-2624.341] (-2623.858) -- 0:02:25 642500 -- (-2627.814) [-2626.790] (-2627.991) (-2622.421) * [-2622.187] (-2623.941) (-2621.326) (-2624.625) -- 0:02:25 643000 -- (-2625.056) [-2623.729] (-2629.631) (-2621.578) * (-2627.835) (-2627.995) [-2618.951] (-2626.758) -- 0:02:25 643500 -- (-2628.022) [-2629.200] (-2621.549) (-2623.654) * (-2630.617) [-2628.690] (-2623.835) (-2627.523) -- 0:02:25 644000 -- (-2620.590) [-2627.220] (-2631.518) (-2624.587) * (-2623.994) (-2623.615) (-2622.968) [-2632.884] -- 0:02:24 644500 -- (-2625.800) [-2627.917] (-2626.907) (-2626.080) * (-2631.657) [-2626.115] (-2635.089) (-2629.241) -- 0:02:24 645000 -- (-2623.210) (-2622.691) [-2622.707] (-2635.898) * (-2625.034) (-2631.130) [-2628.620] (-2636.572) -- 0:02:24 Average standard deviation of split frequencies: 0.000292 645500 -- (-2628.666) (-2632.130) [-2625.164] (-2629.246) * (-2626.291) (-2630.572) (-2626.463) [-2623.266] -- 0:02:24 646000 -- [-2624.773] (-2620.681) (-2633.373) (-2626.237) * [-2626.686] (-2627.878) (-2627.919) (-2625.756) -- 0:02:24 646500 -- (-2622.842) (-2626.596) [-2623.392] (-2631.717) * [-2627.562] (-2632.466) (-2628.709) (-2635.378) -- 0:02:23 647000 -- (-2624.016) (-2625.224) (-2622.973) [-2630.496] * [-2621.032] (-2627.044) (-2625.655) (-2630.922) -- 0:02:23 647500 -- [-2620.740] (-2622.379) (-2619.800) (-2623.183) * (-2629.785) (-2619.526) (-2627.479) [-2622.788] -- 0:02:23 648000 -- (-2634.412) [-2620.876] (-2628.920) (-2621.776) * (-2629.667) (-2627.049) [-2622.477] (-2631.511) -- 0:02:23 648500 -- (-2625.202) (-2622.477) [-2625.216] (-2633.777) * [-2620.947] (-2631.144) (-2624.274) (-2624.211) -- 0:02:23 649000 -- [-2628.217] (-2626.191) (-2625.465) (-2624.289) * (-2624.076) (-2638.197) (-2623.838) [-2623.532] -- 0:02:22 649500 -- [-2621.167] (-2627.933) (-2621.940) (-2623.967) * (-2636.839) (-2631.251) [-2624.527] (-2626.203) -- 0:02:22 650000 -- (-2624.814) (-2627.260) (-2623.387) [-2624.814] * (-2623.397) (-2620.898) (-2630.200) [-2629.068] -- 0:02:22 Average standard deviation of split frequencies: 0.000290 650500 -- (-2629.076) (-2629.103) [-2625.742] (-2622.836) * [-2624.707] (-2626.958) (-2626.287) (-2621.006) -- 0:02:22 651000 -- (-2628.115) (-2630.413) [-2632.799] (-2628.691) * (-2618.580) [-2619.741] (-2626.394) (-2630.450) -- 0:02:22 651500 -- (-2635.385) (-2625.653) [-2620.132] (-2636.187) * (-2619.589) (-2624.883) (-2629.522) [-2629.320] -- 0:02:21 652000 -- (-2623.942) (-2637.038) (-2620.039) [-2627.505] * (-2630.651) [-2627.573] (-2623.531) (-2632.383) -- 0:02:21 652500 -- (-2623.350) [-2627.640] (-2635.756) (-2625.837) * (-2624.309) (-2624.166) (-2629.228) [-2630.294] -- 0:02:21 653000 -- [-2622.305] (-2627.529) (-2624.915) (-2632.199) * (-2623.245) [-2625.056] (-2629.725) (-2632.602) -- 0:02:21 653500 -- (-2625.654) (-2638.931) (-2621.053) [-2631.753] * (-2632.908) (-2629.868) (-2626.053) [-2629.203] -- 0:02:21 654000 -- [-2625.328] (-2627.445) (-2622.478) (-2630.992) * (-2631.607) (-2619.987) (-2623.355) [-2635.485] -- 0:02:20 654500 -- (-2630.157) (-2632.652) (-2629.590) [-2622.627] * (-2629.382) [-2619.596] (-2624.497) (-2629.226) -- 0:02:20 655000 -- (-2623.720) (-2627.816) (-2622.518) [-2619.094] * (-2627.736) (-2619.816) [-2628.158] (-2638.265) -- 0:02:20 Average standard deviation of split frequencies: 0.000287 655500 -- [-2625.556] (-2625.541) (-2640.532) (-2622.459) * [-2624.768] (-2631.691) (-2624.938) (-2622.792) -- 0:02:20 656000 -- (-2627.911) (-2631.366) (-2638.834) [-2625.286] * (-2628.892) [-2627.269] (-2624.327) (-2620.892) -- 0:02:20 656500 -- (-2628.344) (-2630.789) (-2628.865) [-2633.683] * (-2628.160) (-2627.605) [-2624.018] (-2630.666) -- 0:02:19 657000 -- (-2625.686) (-2626.185) (-2631.075) [-2628.135] * [-2631.395] (-2625.771) (-2629.028) (-2625.961) -- 0:02:19 657500 -- (-2630.197) [-2617.934] (-2629.908) (-2627.320) * (-2631.217) [-2627.843] (-2628.326) (-2627.904) -- 0:02:19 658000 -- [-2620.064] (-2623.950) (-2622.050) (-2619.801) * [-2626.237] (-2624.652) (-2639.412) (-2629.239) -- 0:02:19 658500 -- (-2627.224) [-2619.671] (-2623.427) (-2624.075) * [-2623.970] (-2626.640) (-2629.325) (-2622.539) -- 0:02:18 659000 -- (-2632.489) [-2624.273] (-2628.484) (-2626.534) * (-2632.583) [-2624.206] (-2638.756) (-2621.522) -- 0:02:18 659500 -- [-2630.206] (-2625.625) (-2630.156) (-2621.896) * (-2631.649) (-2623.749) [-2619.812] (-2625.679) -- 0:02:18 660000 -- (-2625.443) (-2629.622) [-2623.013] (-2619.670) * [-2633.032] (-2631.139) (-2618.920) (-2625.471) -- 0:02:18 Average standard deviation of split frequencies: 0.000285 660500 -- (-2624.758) (-2625.806) (-2634.624) [-2618.311] * (-2625.606) (-2625.452) (-2626.373) [-2623.028] -- 0:02:18 661000 -- [-2628.498] (-2628.318) (-2630.332) (-2624.858) * (-2623.810) (-2622.558) (-2637.363) [-2622.009] -- 0:02:17 661500 -- (-2620.245) (-2624.645) [-2630.843] (-2629.408) * (-2624.109) [-2625.070] (-2628.023) (-2623.190) -- 0:02:17 662000 -- (-2625.843) [-2623.516] (-2626.060) (-2630.160) * (-2628.865) (-2617.317) (-2627.510) [-2630.364] -- 0:02:17 662500 -- [-2630.644] (-2627.810) (-2623.168) (-2626.388) * (-2626.227) (-2626.069) [-2628.758] (-2622.950) -- 0:02:17 663000 -- (-2628.821) (-2631.398) (-2625.031) [-2629.939] * (-2631.155) (-2624.918) (-2626.399) [-2627.375] -- 0:02:17 663500 -- (-2624.520) (-2626.119) (-2621.699) [-2623.824] * (-2628.356) (-2636.435) [-2626.151] (-2624.962) -- 0:02:16 664000 -- (-2625.159) [-2622.096] (-2629.702) (-2629.829) * (-2638.784) (-2628.715) (-2623.363) [-2624.003] -- 0:02:16 664500 -- (-2632.333) (-2627.154) (-2630.080) [-2624.774] * (-2625.871) (-2628.445) (-2620.449) [-2628.524] -- 0:02:16 665000 -- (-2630.286) (-2625.219) [-2622.797] (-2638.520) * (-2624.433) (-2626.954) (-2628.713) [-2627.331] -- 0:02:16 Average standard deviation of split frequencies: 0.000283 665500 -- (-2644.658) [-2619.366] (-2626.245) (-2627.364) * [-2621.388] (-2625.824) (-2620.472) (-2632.257) -- 0:02:16 666000 -- (-2625.237) [-2626.467] (-2629.531) (-2626.274) * (-2634.335) (-2629.524) [-2632.995] (-2624.771) -- 0:02:15 666500 -- (-2636.044) [-2629.342] (-2623.095) (-2628.664) * [-2624.047] (-2632.483) (-2633.932) (-2626.972) -- 0:02:15 667000 -- [-2627.176] (-2630.577) (-2623.948) (-2626.948) * (-2625.360) [-2628.109] (-2626.236) (-2625.050) -- 0:02:15 667500 -- (-2621.430) (-2633.498) [-2621.483] (-2636.302) * [-2626.933] (-2625.085) (-2626.113) (-2629.580) -- 0:02:14 668000 -- (-2623.816) (-2635.993) [-2625.144] (-2627.835) * (-2621.241) (-2632.958) [-2625.292] (-2620.770) -- 0:02:15 668500 -- (-2626.208) (-2639.688) [-2622.017] (-2631.690) * [-2626.073] (-2631.558) (-2636.264) (-2634.704) -- 0:02:14 669000 -- [-2630.149] (-2633.977) (-2625.392) (-2628.724) * (-2625.360) (-2626.528) (-2626.625) [-2630.452] -- 0:02:14 669500 -- (-2630.854) (-2629.626) (-2624.461) [-2624.460] * (-2623.385) (-2626.111) (-2633.652) [-2624.855] -- 0:02:14 670000 -- [-2627.557] (-2626.455) (-2627.786) (-2620.339) * (-2632.363) [-2626.899] (-2627.935) (-2621.471) -- 0:02:14 Average standard deviation of split frequencies: 0.000281 670500 -- [-2624.249] (-2625.839) (-2627.076) (-2620.942) * (-2631.808) (-2628.547) [-2625.740] (-2621.965) -- 0:02:14 671000 -- (-2638.904) (-2630.144) (-2634.051) [-2626.155] * (-2622.494) (-2622.908) (-2621.055) [-2630.125] -- 0:02:13 671500 -- (-2629.355) (-2624.564) (-2632.267) [-2621.744] * (-2621.842) [-2623.421] (-2629.131) (-2630.556) -- 0:02:13 672000 -- (-2624.354) [-2624.972] (-2625.689) (-2629.343) * (-2628.685) [-2623.303] (-2628.092) (-2629.905) -- 0:02:13 672500 -- (-2624.757) (-2625.692) (-2631.846) [-2622.298] * [-2619.883] (-2626.184) (-2636.374) (-2627.869) -- 0:02:13 673000 -- (-2630.228) (-2625.006) [-2628.555] (-2626.870) * [-2627.347] (-2622.904) (-2635.301) (-2630.713) -- 0:02:13 673500 -- (-2633.251) (-2627.408) [-2625.560] (-2630.084) * (-2647.514) (-2622.909) [-2628.776] (-2628.813) -- 0:02:12 674000 -- (-2621.918) (-2623.789) [-2622.030] (-2623.105) * (-2631.767) (-2628.756) (-2628.422) [-2627.804] -- 0:02:12 674500 -- (-2634.442) [-2628.365] (-2630.451) (-2620.914) * (-2629.173) [-2622.687] (-2629.783) (-2628.457) -- 0:02:12 675000 -- (-2627.142) (-2631.131) (-2626.360) [-2625.722] * (-2631.804) (-2623.174) (-2638.172) [-2626.164] -- 0:02:12 Average standard deviation of split frequencies: 0.000279 675500 -- (-2633.142) (-2628.885) [-2629.516] (-2626.256) * [-2627.927] (-2625.073) (-2634.430) (-2624.299) -- 0:02:12 676000 -- (-2624.069) [-2630.069] (-2629.803) (-2629.838) * (-2638.264) [-2629.597] (-2623.335) (-2624.082) -- 0:02:11 676500 -- (-2627.008) (-2629.679) (-2632.018) [-2626.620] * (-2621.599) [-2622.402] (-2630.386) (-2629.889) -- 0:02:11 677000 -- (-2629.165) (-2629.031) [-2624.520] (-2622.837) * (-2635.326) (-2624.623) [-2625.253] (-2625.040) -- 0:02:11 677500 -- [-2624.861] (-2620.201) (-2622.210) (-2625.148) * (-2629.087) (-2621.143) (-2630.976) [-2630.355] -- 0:02:11 678000 -- (-2626.977) [-2625.512] (-2622.694) (-2626.328) * (-2633.908) [-2629.893] (-2624.566) (-2628.342) -- 0:02:11 678500 -- (-2635.493) (-2636.521) (-2637.130) [-2626.642] * (-2628.174) (-2624.106) [-2633.374] (-2629.632) -- 0:02:10 679000 -- [-2623.144] (-2634.508) (-2628.144) (-2631.231) * [-2625.200] (-2623.440) (-2625.780) (-2625.334) -- 0:02:10 679500 -- (-2633.765) [-2625.325] (-2629.856) (-2627.753) * [-2620.128] (-2630.943) (-2627.270) (-2632.242) -- 0:02:10 680000 -- (-2625.499) (-2621.757) [-2628.087] (-2624.017) * (-2630.117) (-2628.229) (-2622.939) [-2626.750] -- 0:02:10 Average standard deviation of split frequencies: 0.000277 680500 -- (-2627.202) [-2629.987] (-2623.571) (-2635.226) * (-2634.405) (-2632.548) (-2623.714) [-2623.710] -- 0:02:10 681000 -- (-2635.371) [-2630.784] (-2628.047) (-2624.651) * (-2628.510) [-2620.818] (-2629.933) (-2626.334) -- 0:02:09 681500 -- (-2618.121) (-2628.839) (-2627.904) [-2630.452] * (-2635.646) [-2628.152] (-2626.799) (-2629.418) -- 0:02:09 682000 -- (-2618.265) (-2633.159) [-2627.499] (-2630.810) * (-2630.646) (-2627.940) (-2638.424) [-2625.506] -- 0:02:09 682500 -- (-2629.349) (-2625.221) [-2627.944] (-2626.043) * (-2633.508) (-2630.340) [-2621.370] (-2625.793) -- 0:02:09 683000 -- (-2630.631) (-2623.470) [-2627.917] (-2624.975) * (-2625.558) (-2632.642) [-2628.416] (-2629.194) -- 0:02:09 683500 -- [-2626.231] (-2630.142) (-2627.864) (-2626.582) * (-2626.658) (-2631.050) [-2618.938] (-2628.874) -- 0:02:08 684000 -- (-2625.381) [-2620.949] (-2627.758) (-2629.425) * [-2622.009] (-2623.380) (-2624.529) (-2629.422) -- 0:02:08 684500 -- (-2630.043) (-2625.683) (-2621.731) [-2621.872] * [-2627.643] (-2630.746) (-2627.201) (-2635.499) -- 0:02:08 685000 -- (-2622.786) [-2622.008] (-2625.672) (-2624.741) * (-2633.555) [-2630.352] (-2620.586) (-2626.228) -- 0:02:08 Average standard deviation of split frequencies: 0.000275 685500 -- (-2624.926) (-2627.648) [-2620.599] (-2628.049) * (-2628.009) [-2625.475] (-2625.036) (-2631.131) -- 0:02:08 686000 -- (-2632.216) (-2626.247) (-2627.496) [-2619.317] * (-2624.321) (-2629.143) (-2625.046) [-2628.219] -- 0:02:07 686500 -- [-2624.209] (-2626.926) (-2625.898) (-2628.449) * (-2627.515) (-2629.493) [-2621.036] (-2630.166) -- 0:02:07 687000 -- (-2627.005) (-2631.204) (-2622.148) [-2627.407] * (-2629.098) (-2626.696) (-2627.886) [-2621.828] -- 0:02:07 687500 -- [-2617.717] (-2627.177) (-2622.857) (-2624.664) * (-2625.356) (-2626.362) [-2623.057] (-2628.963) -- 0:02:07 688000 -- (-2630.769) [-2628.080] (-2627.803) (-2624.592) * (-2627.519) (-2620.946) [-2625.428] (-2628.657) -- 0:02:06 688500 -- [-2629.649] (-2628.418) (-2628.045) (-2630.560) * [-2624.711] (-2628.880) (-2625.945) (-2625.228) -- 0:02:06 689000 -- (-2624.314) (-2631.865) (-2624.167) [-2630.398] * (-2621.372) (-2627.574) [-2626.537] (-2626.419) -- 0:02:06 689500 -- (-2623.736) (-2629.231) (-2621.295) [-2628.081] * (-2622.253) [-2622.060] (-2626.221) (-2624.661) -- 0:02:06 690000 -- (-2624.555) (-2626.440) [-2624.721] (-2622.779) * [-2622.130] (-2627.276) (-2631.325) (-2628.808) -- 0:02:06 Average standard deviation of split frequencies: 0.000273 690500 -- (-2624.935) (-2622.201) [-2629.652] (-2626.306) * [-2627.700] (-2627.585) (-2624.743) (-2631.187) -- 0:02:05 691000 -- [-2620.834] (-2627.965) (-2625.371) (-2629.220) * (-2623.037) (-2628.130) [-2626.161] (-2629.598) -- 0:02:05 691500 -- (-2630.556) (-2624.032) [-2626.237] (-2627.344) * [-2622.726] (-2630.857) (-2623.330) (-2630.567) -- 0:02:05 692000 -- (-2628.263) [-2621.094] (-2629.313) (-2628.857) * (-2624.662) (-2633.870) [-2619.322] (-2620.199) -- 0:02:05 692500 -- (-2638.165) (-2625.306) [-2625.992] (-2627.273) * (-2628.520) (-2638.211) [-2620.683] (-2634.240) -- 0:02:05 693000 -- (-2629.842) [-2627.437] (-2632.138) (-2629.389) * (-2630.570) [-2625.130] (-2624.881) (-2640.671) -- 0:02:04 693500 -- (-2626.288) (-2629.741) (-2619.752) [-2621.880] * (-2619.985) (-2624.053) [-2633.216] (-2631.700) -- 0:02:04 694000 -- [-2627.720] (-2624.788) (-2618.046) (-2636.091) * (-2625.081) [-2620.038] (-2622.948) (-2627.642) -- 0:02:04 694500 -- (-2633.338) (-2624.716) [-2625.875] (-2630.149) * (-2634.050) (-2623.118) (-2628.263) [-2632.137] -- 0:02:04 695000 -- (-2628.380) (-2623.034) [-2624.500] (-2629.311) * [-2628.429] (-2632.545) (-2637.212) (-2630.626) -- 0:02:04 Average standard deviation of split frequencies: 0.000271 695500 -- (-2623.309) (-2624.747) [-2628.348] (-2632.787) * (-2627.102) [-2631.444] (-2624.135) (-2628.203) -- 0:02:03 696000 -- [-2628.616] (-2627.645) (-2628.400) (-2622.490) * (-2625.553) (-2627.055) [-2625.622] (-2634.369) -- 0:02:03 696500 -- (-2623.465) [-2624.275] (-2623.992) (-2629.103) * (-2634.407) [-2623.179] (-2624.867) (-2623.688) -- 0:02:03 697000 -- [-2623.184] (-2624.576) (-2630.044) (-2631.092) * (-2619.754) [-2624.540] (-2631.060) (-2625.855) -- 0:02:03 697500 -- (-2625.316) (-2625.685) (-2625.577) [-2625.077] * (-2630.792) [-2623.829] (-2622.842) (-2630.087) -- 0:02:03 698000 -- [-2623.721] (-2633.985) (-2623.433) (-2619.871) * [-2625.998] (-2625.208) (-2627.187) (-2627.160) -- 0:02:02 698500 -- (-2626.293) (-2625.328) [-2622.905] (-2631.768) * [-2625.206] (-2630.381) (-2626.079) (-2621.664) -- 0:02:02 699000 -- [-2626.692] (-2623.643) (-2635.232) (-2631.798) * [-2623.322] (-2628.126) (-2627.942) (-2622.234) -- 0:02:02 699500 -- (-2623.878) [-2635.925] (-2630.711) (-2629.308) * [-2627.303] (-2625.977) (-2628.295) (-2635.937) -- 0:02:02 700000 -- (-2631.255) (-2624.268) [-2631.209] (-2628.721) * (-2626.761) [-2619.789] (-2623.154) (-2635.677) -- 0:02:02 Average standard deviation of split frequencies: 0.000269 700500 -- (-2636.213) [-2627.658] (-2637.472) (-2621.609) * (-2626.876) (-2628.828) [-2623.953] (-2626.234) -- 0:02:01 701000 -- (-2624.234) (-2628.041) (-2626.115) [-2627.172] * (-2623.174) (-2626.369) (-2633.173) [-2621.944] -- 0:02:01 701500 -- [-2630.479] (-2625.244) (-2628.968) (-2631.008) * [-2624.402] (-2628.235) (-2633.424) (-2622.217) -- 0:02:01 702000 -- (-2628.240) (-2624.233) [-2631.055] (-2630.100) * [-2625.122] (-2634.408) (-2626.399) (-2626.383) -- 0:02:01 702500 -- [-2626.471] (-2623.523) (-2629.087) (-2628.694) * (-2623.906) (-2621.285) (-2633.122) [-2624.917] -- 0:02:01 703000 -- (-2625.071) (-2626.644) [-2626.860] (-2635.452) * (-2622.768) (-2626.476) (-2631.918) [-2620.708] -- 0:02:00 703500 -- (-2623.943) [-2627.779] (-2620.998) (-2630.362) * (-2623.306) (-2631.654) (-2627.322) [-2621.644] -- 0:02:00 704000 -- (-2626.823) [-2624.054] (-2623.542) (-2629.079) * [-2623.795] (-2628.804) (-2626.744) (-2621.239) -- 0:02:00 704500 -- (-2620.918) [-2627.874] (-2626.548) (-2629.263) * (-2626.212) [-2626.712] (-2634.455) (-2622.799) -- 0:02:00 705000 -- (-2624.678) (-2622.986) (-2624.473) [-2626.153] * (-2637.871) [-2625.687] (-2624.423) (-2633.499) -- 0:02:00 Average standard deviation of split frequencies: 0.000267 705500 -- (-2621.350) (-2627.231) (-2627.208) [-2625.713] * (-2622.184) [-2625.684] (-2625.151) (-2626.390) -- 0:01:59 706000 -- (-2622.469) (-2624.368) (-2630.951) [-2624.120] * (-2627.335) (-2625.507) (-2637.716) [-2626.565] -- 0:01:59 706500 -- (-2628.155) (-2626.998) (-2631.403) [-2633.093] * [-2624.847] (-2637.977) (-2629.123) (-2632.372) -- 0:01:59 707000 -- [-2628.590] (-2625.920) (-2638.904) (-2630.904) * (-2622.211) (-2621.646) [-2624.270] (-2625.275) -- 0:01:59 707500 -- (-2633.850) (-2619.588) (-2629.642) [-2619.894] * [-2622.007] (-2631.926) (-2625.970) (-2629.063) -- 0:01:59 708000 -- (-2622.178) [-2624.782] (-2624.797) (-2627.124) * (-2628.000) [-2629.431] (-2629.496) (-2628.424) -- 0:01:58 708500 -- [-2622.169] (-2624.402) (-2629.247) (-2625.753) * (-2627.828) (-2622.830) [-2622.468] (-2625.434) -- 0:01:58 709000 -- (-2621.558) (-2630.222) [-2626.650] (-2626.053) * (-2625.897) (-2621.578) (-2620.726) [-2621.540] -- 0:01:58 709500 -- (-2624.130) (-2627.655) (-2621.062) [-2625.964] * (-2621.790) (-2628.757) [-2622.918] (-2631.367) -- 0:01:58 710000 -- (-2623.554) (-2635.041) [-2625.617] (-2626.550) * [-2620.209] (-2629.120) (-2629.056) (-2624.093) -- 0:01:58 Average standard deviation of split frequencies: 0.000265 710500 -- (-2626.562) (-2632.880) (-2634.257) [-2630.483] * [-2625.879] (-2625.034) (-2633.795) (-2622.844) -- 0:01:57 711000 -- (-2619.590) (-2629.682) [-2626.101] (-2632.783) * (-2629.388) (-2632.133) (-2627.325) [-2626.663] -- 0:01:57 711500 -- [-2621.642] (-2630.959) (-2623.587) (-2626.566) * [-2625.643] (-2634.177) (-2624.382) (-2628.171) -- 0:01:57 712000 -- [-2623.253] (-2632.482) (-2630.746) (-2627.418) * (-2630.681) [-2625.752] (-2623.690) (-2627.379) -- 0:01:57 712500 -- [-2624.102] (-2626.908) (-2631.103) (-2623.216) * (-2623.670) (-2630.209) [-2626.673] (-2627.214) -- 0:01:57 713000 -- (-2631.113) (-2627.432) (-2622.978) [-2624.944] * (-2620.141) (-2627.679) (-2629.124) [-2630.645] -- 0:01:56 713500 -- (-2624.414) (-2625.034) (-2630.363) [-2628.002] * [-2625.723] (-2632.350) (-2632.179) (-2624.119) -- 0:01:56 714000 -- (-2640.265) (-2625.687) [-2631.249] (-2625.138) * (-2632.811) (-2621.986) (-2624.017) [-2619.024] -- 0:01:56 714500 -- (-2633.205) [-2626.906] (-2627.440) (-2625.275) * (-2631.606) (-2625.133) (-2631.203) [-2624.244] -- 0:01:56 715000 -- (-2629.949) [-2628.117] (-2625.945) (-2629.539) * (-2630.285) [-2628.032] (-2625.060) (-2620.446) -- 0:01:55 Average standard deviation of split frequencies: 0.000263 715500 -- (-2626.892) (-2624.935) [-2625.583] (-2625.251) * (-2626.368) (-2625.115) (-2633.992) [-2619.426] -- 0:01:55 716000 -- (-2626.413) (-2624.979) (-2620.207) [-2624.884] * [-2628.884] (-2619.994) (-2620.356) (-2629.171) -- 0:01:55 716500 -- [-2624.669] (-2624.623) (-2627.444) (-2628.305) * (-2626.348) (-2632.924) (-2620.509) [-2623.716] -- 0:01:55 717000 -- (-2630.887) [-2625.521] (-2627.985) (-2624.285) * (-2624.211) (-2626.045) (-2624.262) [-2624.399] -- 0:01:55 717500 -- (-2622.722) (-2623.709) (-2627.761) [-2626.155] * (-2631.996) [-2625.378] (-2625.987) (-2627.987) -- 0:01:54 718000 -- (-2636.278) [-2625.570] (-2632.992) (-2629.313) * [-2625.319] (-2624.320) (-2624.317) (-2626.845) -- 0:01:54 718500 -- (-2624.475) (-2634.434) [-2628.516] (-2631.739) * (-2627.140) [-2623.747] (-2629.189) (-2630.065) -- 0:01:54 719000 -- (-2642.963) (-2627.885) (-2628.498) [-2631.106] * [-2626.977] (-2628.548) (-2627.903) (-2628.393) -- 0:01:54 719500 -- (-2625.794) (-2626.083) [-2626.781] (-2625.883) * (-2627.812) (-2621.504) (-2625.306) [-2626.796] -- 0:01:54 720000 -- (-2635.525) [-2623.497] (-2623.068) (-2631.372) * [-2628.361] (-2627.027) (-2629.799) (-2622.729) -- 0:01:53 Average standard deviation of split frequencies: 0.000262 720500 -- (-2621.303) (-2625.406) [-2624.421] (-2626.036) * (-2621.204) (-2628.677) [-2626.393] (-2622.925) -- 0:01:53 721000 -- (-2626.907) [-2619.716] (-2624.516) (-2630.317) * (-2632.071) (-2626.205) (-2626.254) [-2631.570] -- 0:01:53 721500 -- [-2622.972] (-2635.268) (-2620.321) (-2631.337) * (-2626.778) (-2620.658) (-2621.832) [-2637.835] -- 0:01:53 722000 -- (-2627.531) (-2624.245) [-2624.885] (-2621.976) * (-2631.497) [-2618.559] (-2624.833) (-2629.892) -- 0:01:53 722500 -- (-2630.129) (-2621.699) [-2621.451] (-2625.904) * (-2621.981) [-2627.409] (-2628.242) (-2636.315) -- 0:01:52 723000 -- (-2627.147) (-2630.168) (-2625.872) [-2623.722] * (-2632.353) [-2629.492] (-2629.917) (-2633.272) -- 0:01:52 723500 -- [-2631.434] (-2623.700) (-2623.624) (-2628.084) * (-2631.624) (-2627.034) [-2623.278] (-2624.599) -- 0:01:52 724000 -- (-2622.752) [-2631.003] (-2626.936) (-2631.323) * (-2627.253) [-2625.251] (-2631.760) (-2630.652) -- 0:01:52 724500 -- (-2623.299) [-2626.419] (-2624.795) (-2628.155) * (-2629.307) (-2631.988) [-2624.159] (-2626.008) -- 0:01:52 725000 -- (-2630.491) (-2620.406) (-2632.916) [-2641.108] * (-2626.955) (-2627.962) (-2626.760) [-2620.905] -- 0:01:51 Average standard deviation of split frequencies: 0.000260 725500 -- [-2626.160] (-2628.004) (-2631.086) (-2627.344) * (-2623.321) (-2630.727) [-2622.679] (-2629.328) -- 0:01:51 726000 -- (-2627.839) (-2629.053) [-2628.029] (-2625.385) * [-2624.005] (-2626.116) (-2632.377) (-2632.793) -- 0:01:51 726500 -- (-2625.884) [-2628.382] (-2627.827) (-2624.575) * (-2639.132) (-2627.008) (-2623.019) [-2626.399] -- 0:01:51 727000 -- (-2621.355) (-2623.987) [-2628.008] (-2630.091) * (-2625.804) [-2617.852] (-2625.174) (-2620.525) -- 0:01:51 727500 -- (-2636.020) [-2623.740] (-2633.095) (-2626.947) * (-2628.432) (-2624.976) (-2623.665) [-2626.977] -- 0:01:50 728000 -- (-2631.127) [-2621.785] (-2630.180) (-2625.455) * [-2630.998] (-2629.648) (-2627.480) (-2635.405) -- 0:01:50 728500 -- (-2628.443) [-2625.653] (-2635.224) (-2628.457) * [-2619.823] (-2629.639) (-2629.464) (-2623.803) -- 0:01:50 729000 -- (-2631.635) (-2628.493) [-2629.972] (-2631.760) * (-2627.788) [-2621.261] (-2627.533) (-2624.764) -- 0:01:50 729500 -- [-2625.169] (-2623.327) (-2628.491) (-2630.511) * [-2629.421] (-2621.961) (-2623.058) (-2622.885) -- 0:01:50 730000 -- (-2624.987) (-2633.606) (-2627.281) [-2626.100] * (-2626.255) (-2623.627) (-2625.972) [-2623.780] -- 0:01:49 Average standard deviation of split frequencies: 0.000258 730500 -- [-2621.529] (-2627.688) (-2624.642) (-2630.422) * [-2628.928] (-2623.754) (-2625.770) (-2621.084) -- 0:01:49 731000 -- (-2630.305) (-2621.709) [-2625.996] (-2624.965) * (-2636.139) [-2624.711] (-2628.142) (-2630.022) -- 0:01:49 731500 -- (-2626.314) [-2628.210] (-2626.268) (-2631.871) * (-2635.809) [-2621.884] (-2624.747) (-2622.975) -- 0:01:49 732000 -- (-2629.923) (-2625.237) [-2620.642] (-2631.788) * (-2633.304) [-2631.109] (-2633.524) (-2620.580) -- 0:01:49 732500 -- (-2632.679) (-2627.847) [-2629.254] (-2623.154) * (-2633.112) (-2624.155) [-2624.477] (-2622.051) -- 0:01:48 733000 -- (-2627.763) (-2639.190) [-2622.215] (-2631.301) * (-2621.264) (-2627.576) (-2627.977) [-2631.509] -- 0:01:48 733500 -- (-2628.864) (-2626.121) (-2634.643) [-2628.005] * (-2629.110) (-2628.524) [-2622.358] (-2628.051) -- 0:01:48 734000 -- [-2627.488] (-2632.347) (-2626.768) (-2635.480) * (-2629.825) (-2631.072) [-2625.553] (-2634.687) -- 0:01:48 734500 -- [-2628.873] (-2625.589) (-2624.804) (-2628.972) * (-2621.543) (-2625.281) (-2639.897) [-2632.582] -- 0:01:48 735000 -- (-2627.345) [-2621.224] (-2622.121) (-2626.034) * [-2622.736] (-2635.097) (-2631.498) (-2634.700) -- 0:01:47 Average standard deviation of split frequencies: 0.000256 735500 -- (-2628.229) [-2623.415] (-2625.633) (-2620.409) * (-2622.280) (-2622.583) [-2629.582] (-2632.384) -- 0:01:47 736000 -- (-2628.239) (-2627.668) (-2625.310) [-2623.020] * (-2628.325) [-2622.985] (-2624.086) (-2632.511) -- 0:01:47 736500 -- (-2635.476) (-2630.856) (-2627.699) [-2623.895] * [-2623.089] (-2628.415) (-2638.280) (-2621.906) -- 0:01:47 737000 -- (-2624.264) (-2632.328) (-2624.937) [-2623.209] * (-2632.173) (-2624.052) (-2628.358) [-2624.466] -- 0:01:47 737500 -- [-2623.787] (-2626.495) (-2638.007) (-2621.783) * (-2628.586) (-2630.461) (-2630.608) [-2621.895] -- 0:01:46 738000 -- [-2621.541] (-2625.284) (-2629.757) (-2622.233) * (-2621.445) (-2631.645) (-2625.791) [-2624.883] -- 0:01:46 738500 -- (-2625.968) [-2622.456] (-2627.913) (-2622.678) * [-2620.212] (-2634.506) (-2623.632) (-2625.936) -- 0:01:46 739000 -- (-2624.429) (-2624.159) (-2631.018) [-2622.514] * [-2626.770] (-2621.762) (-2627.980) (-2629.291) -- 0:01:46 739500 -- [-2633.585] (-2623.830) (-2619.464) (-2626.776) * (-2621.841) [-2623.165] (-2626.943) (-2629.237) -- 0:01:46 740000 -- [-2627.786] (-2627.547) (-2625.542) (-2625.588) * (-2620.942) (-2624.889) [-2623.759] (-2631.182) -- 0:01:45 Average standard deviation of split frequencies: 0.000255 740500 -- (-2627.327) (-2632.779) (-2630.697) [-2629.430] * [-2624.029] (-2623.699) (-2623.591) (-2635.248) -- 0:01:45 741000 -- (-2628.506) [-2622.991] (-2625.053) (-2626.466) * (-2622.194) (-2636.434) [-2622.415] (-2625.831) -- 0:01:45 741500 -- (-2629.027) [-2621.862] (-2630.755) (-2631.957) * (-2631.084) (-2630.834) [-2629.444] (-2631.687) -- 0:01:45 742000 -- (-2625.571) (-2622.236) [-2626.594] (-2630.098) * [-2624.772] (-2629.537) (-2633.845) (-2626.520) -- 0:01:45 742500 -- (-2631.064) [-2625.004] (-2635.509) (-2625.402) * (-2629.078) [-2626.532] (-2622.638) (-2622.933) -- 0:01:44 743000 -- (-2628.664) [-2627.643] (-2633.913) (-2629.208) * (-2631.240) (-2625.978) (-2623.896) [-2621.018] -- 0:01:44 743500 -- [-2623.223] (-2620.209) (-2628.683) (-2624.967) * (-2630.085) (-2625.109) (-2629.554) [-2626.767] -- 0:01:44 744000 -- (-2620.354) [-2624.853] (-2626.216) (-2620.900) * (-2628.556) (-2625.066) (-2625.051) [-2622.303] -- 0:01:44 744500 -- [-2620.398] (-2624.497) (-2622.087) (-2626.660) * (-2636.991) (-2627.569) (-2619.381) [-2623.469] -- 0:01:43 745000 -- [-2622.485] (-2630.449) (-2628.420) (-2642.004) * (-2627.651) [-2629.968] (-2629.967) (-2622.504) -- 0:01:43 Average standard deviation of split frequencies: 0.000253 745500 -- (-2629.738) [-2622.293] (-2620.310) (-2626.934) * (-2629.662) [-2624.506] (-2624.889) (-2631.020) -- 0:01:43 746000 -- (-2626.372) [-2636.336] (-2621.893) (-2624.621) * (-2632.172) (-2629.314) (-2630.128) [-2623.962] -- 0:01:43 746500 -- (-2625.541) (-2623.083) (-2629.630) [-2626.200] * (-2638.798) (-2625.882) [-2627.753] (-2623.491) -- 0:01:43 747000 -- (-2632.037) (-2624.579) [-2626.411] (-2625.419) * (-2632.199) (-2632.882) (-2635.619) [-2633.794] -- 0:01:42 747500 -- (-2628.676) (-2626.224) [-2620.596] (-2626.836) * (-2634.394) (-2626.020) (-2626.891) [-2623.254] -- 0:01:42 748000 -- (-2628.404) [-2619.340] (-2629.543) (-2629.273) * (-2632.277) (-2626.092) (-2638.405) [-2623.110] -- 0:01:42 748500 -- (-2634.953) [-2622.147] (-2625.529) (-2627.796) * (-2630.252) (-2628.259) (-2638.493) [-2623.757] -- 0:01:42 749000 -- (-2622.741) (-2635.925) [-2624.291] (-2621.882) * (-2631.224) (-2621.879) [-2624.364] (-2624.048) -- 0:01:42 749500 -- (-2618.839) (-2624.503) (-2624.437) [-2624.597] * [-2626.834] (-2625.940) (-2645.599) (-2624.250) -- 0:01:41 750000 -- (-2626.599) [-2627.161] (-2639.324) (-2623.349) * (-2626.780) (-2625.714) (-2625.100) [-2622.727] -- 0:01:41 Average standard deviation of split frequencies: 0.000251 750500 -- [-2628.928] (-2631.874) (-2628.410) (-2628.794) * (-2624.442) (-2627.407) [-2618.898] (-2627.892) -- 0:01:41 751000 -- (-2625.847) (-2628.139) [-2625.940] (-2626.004) * (-2627.061) (-2626.469) [-2623.301] (-2631.731) -- 0:01:41 751500 -- (-2630.277) (-2627.656) [-2625.661] (-2624.322) * [-2628.543] (-2625.452) (-2625.982) (-2632.773) -- 0:01:41 752000 -- (-2628.899) [-2624.976] (-2624.340) (-2623.663) * (-2629.929) (-2623.866) [-2624.200] (-2627.480) -- 0:01:40 752500 -- (-2628.860) (-2625.428) [-2627.175] (-2624.698) * (-2629.882) (-2624.354) [-2625.091] (-2628.996) -- 0:01:40 753000 -- (-2627.197) [-2625.089] (-2622.585) (-2629.199) * (-2624.836) [-2628.313] (-2627.451) (-2633.378) -- 0:01:40 753500 -- [-2622.764] (-2625.668) (-2632.536) (-2627.324) * (-2626.801) (-2628.085) (-2626.721) [-2623.264] -- 0:01:40 754000 -- [-2633.276] (-2620.669) (-2631.870) (-2624.596) * (-2629.033) (-2624.609) [-2623.317] (-2629.454) -- 0:01:40 754500 -- (-2631.493) [-2623.665] (-2626.386) (-2630.808) * (-2631.341) [-2625.171] (-2629.159) (-2632.372) -- 0:01:39 755000 -- (-2631.010) (-2632.321) [-2625.853] (-2626.165) * [-2629.416] (-2641.637) (-2627.090) (-2641.929) -- 0:01:39 Average standard deviation of split frequencies: 0.000249 755500 -- (-2630.316) [-2640.885] (-2627.318) (-2633.466) * (-2625.616) (-2631.593) [-2622.751] (-2625.933) -- 0:01:39 756000 -- (-2627.451) (-2629.059) (-2629.960) [-2626.719] * [-2627.558] (-2632.851) (-2632.679) (-2628.895) -- 0:01:39 756500 -- [-2626.036] (-2626.802) (-2618.706) (-2625.516) * (-2625.694) [-2629.853] (-2634.305) (-2624.283) -- 0:01:39 757000 -- (-2627.855) (-2627.922) (-2628.619) [-2622.322] * (-2625.922) (-2635.768) (-2640.831) [-2623.571] -- 0:01:38 757500 -- (-2621.481) (-2625.327) [-2628.413] (-2627.026) * (-2626.170) (-2634.981) [-2628.477] (-2623.009) -- 0:01:38 758000 -- (-2624.491) [-2626.909] (-2625.558) (-2626.135) * (-2618.777) (-2632.309) (-2637.362) [-2620.253] -- 0:01:38 758500 -- (-2631.640) (-2631.007) [-2628.205] (-2632.737) * [-2626.522] (-2627.720) (-2634.030) (-2628.462) -- 0:01:38 759000 -- [-2628.011] (-2631.545) (-2623.494) (-2637.755) * (-2625.290) (-2624.706) [-2627.238] (-2627.112) -- 0:01:38 759500 -- (-2628.983) (-2625.125) [-2629.427] (-2624.322) * (-2627.267) (-2634.556) (-2624.091) [-2622.670] -- 0:01:37 760000 -- [-2628.149] (-2631.606) (-2627.759) (-2623.692) * (-2630.233) [-2623.132] (-2630.941) (-2631.349) -- 0:01:37 Average standard deviation of split frequencies: 0.000248 760500 -- (-2626.553) (-2629.169) [-2626.835] (-2631.624) * (-2625.557) (-2619.403) (-2624.466) [-2623.136] -- 0:01:37 761000 -- [-2633.808] (-2632.577) (-2625.459) (-2623.621) * [-2625.586] (-2627.652) (-2619.019) (-2620.533) -- 0:01:37 761500 -- [-2625.489] (-2618.933) (-2619.770) (-2631.304) * [-2627.291] (-2632.644) (-2625.082) (-2629.208) -- 0:01:37 762000 -- (-2622.917) (-2628.129) [-2627.684] (-2629.574) * (-2628.853) [-2631.877] (-2625.189) (-2629.696) -- 0:01:36 762500 -- [-2622.231] (-2626.391) (-2627.080) (-2634.353) * (-2630.244) (-2628.282) [-2626.235] (-2629.218) -- 0:01:36 763000 -- (-2621.494) (-2624.747) [-2627.841] (-2632.633) * [-2627.613] (-2628.681) (-2629.966) (-2629.830) -- 0:01:36 763500 -- (-2631.629) (-2620.307) (-2634.128) [-2624.682] * (-2630.013) (-2626.077) (-2629.043) [-2623.858] -- 0:01:36 764000 -- (-2634.778) (-2628.594) (-2631.879) [-2626.373] * (-2632.525) [-2627.806] (-2634.056) (-2623.402) -- 0:01:36 764500 -- (-2629.997) (-2624.960) (-2630.768) [-2640.591] * (-2628.699) [-2640.392] (-2634.084) (-2623.654) -- 0:01:36 765000 -- (-2623.348) (-2625.228) [-2627.002] (-2635.583) * (-2628.645) (-2628.698) [-2633.089] (-2621.566) -- 0:01:35 Average standard deviation of split frequencies: 0.000246 765500 -- (-2624.576) (-2626.059) (-2625.456) [-2624.730] * (-2626.090) (-2624.916) [-2630.731] (-2623.353) -- 0:01:35 766000 -- [-2622.499] (-2621.626) (-2630.733) (-2632.062) * (-2626.406) (-2634.037) (-2626.292) [-2632.324] -- 0:01:35 766500 -- (-2628.398) [-2622.217] (-2627.621) (-2620.001) * [-2624.854] (-2622.471) (-2625.530) (-2625.703) -- 0:01:35 767000 -- (-2630.553) [-2622.121] (-2630.315) (-2625.658) * (-2621.585) (-2629.655) (-2623.366) [-2621.858] -- 0:01:35 767500 -- (-2629.923) [-2623.796] (-2623.602) (-2620.888) * (-2621.826) (-2631.295) [-2619.341] (-2629.265) -- 0:01:34 768000 -- [-2623.662] (-2627.255) (-2627.852) (-2625.757) * (-2624.869) [-2627.009] (-2628.159) (-2626.454) -- 0:01:34 768500 -- (-2623.636) [-2626.023] (-2630.199) (-2625.362) * (-2624.828) [-2623.319] (-2629.529) (-2624.409) -- 0:01:34 769000 -- (-2627.561) (-2627.124) (-2626.077) [-2629.874] * (-2626.278) (-2623.633) [-2627.926] (-2627.266) -- 0:01:34 769500 -- (-2631.515) [-2623.524] (-2623.210) (-2624.315) * (-2627.520) [-2635.925] (-2625.879) (-2626.655) -- 0:01:34 770000 -- (-2625.934) (-2630.021) [-2628.302] (-2624.832) * (-2628.728) (-2626.237) (-2632.298) [-2630.762] -- 0:01:34 Average standard deviation of split frequencies: 0.000245 770500 -- [-2627.258] (-2625.562) (-2631.994) (-2623.767) * (-2627.797) [-2625.431] (-2630.162) (-2634.414) -- 0:01:33 771000 -- (-2626.141) (-2628.148) (-2625.674) [-2619.337] * [-2622.923] (-2624.217) (-2630.974) (-2632.439) -- 0:01:33 771500 -- (-2634.712) (-2630.686) (-2628.226) [-2625.861] * (-2627.881) (-2626.019) [-2625.490] (-2626.941) -- 0:01:33 772000 -- [-2625.432] (-2619.354) (-2628.874) (-2628.392) * (-2625.426) [-2622.339] (-2628.210) (-2620.783) -- 0:01:33 772500 -- (-2625.937) (-2628.378) (-2625.810) [-2623.653] * (-2624.740) (-2626.156) (-2626.763) [-2619.592] -- 0:01:33 773000 -- (-2626.639) (-2625.642) [-2630.085] (-2624.315) * (-2623.255) (-2624.845) [-2629.836] (-2624.739) -- 0:01:32 773500 -- (-2627.132) (-2627.456) [-2623.820] (-2625.267) * (-2630.948) (-2637.856) (-2625.633) [-2628.282] -- 0:01:32 774000 -- (-2628.774) (-2630.802) (-2629.895) [-2625.803] * (-2625.488) [-2623.151] (-2630.778) (-2628.292) -- 0:01:32 774500 -- (-2622.371) [-2626.730] (-2624.024) (-2624.186) * (-2631.026) (-2622.109) (-2619.716) [-2623.622] -- 0:01:32 775000 -- [-2628.650] (-2642.822) (-2620.369) (-2627.323) * [-2625.646] (-2620.919) (-2626.003) (-2620.996) -- 0:01:32 Average standard deviation of split frequencies: 0.000243 775500 -- (-2632.937) (-2627.583) [-2628.687] (-2619.143) * (-2625.397) (-2629.355) [-2625.744] (-2631.825) -- 0:01:31 776000 -- [-2625.128] (-2632.456) (-2627.663) (-2625.644) * [-2628.924] (-2622.315) (-2628.672) (-2626.587) -- 0:01:31 776500 -- [-2624.753] (-2636.992) (-2625.221) (-2622.590) * (-2635.011) (-2623.610) (-2635.890) [-2630.321] -- 0:01:31 777000 -- (-2625.829) (-2625.392) [-2621.745] (-2625.064) * (-2630.220) (-2627.972) [-2620.789] (-2639.650) -- 0:01:31 777500 -- (-2624.745) (-2629.313) (-2629.046) [-2629.158] * [-2625.539] (-2627.293) (-2628.236) (-2624.848) -- 0:01:31 778000 -- (-2626.985) (-2627.527) [-2624.038] (-2622.332) * (-2629.536) (-2623.794) [-2629.476] (-2633.943) -- 0:01:31 778500 -- [-2635.286] (-2622.609) (-2631.229) (-2626.872) * (-2634.092) (-2625.603) [-2633.555] (-2631.689) -- 0:01:30 779000 -- (-2631.024) [-2620.076] (-2629.800) (-2624.372) * [-2619.524] (-2631.400) (-2634.074) (-2632.672) -- 0:01:30 779500 -- [-2626.018] (-2628.722) (-2620.818) (-2625.182) * (-2626.502) [-2625.808] (-2627.955) (-2624.920) -- 0:01:30 780000 -- [-2623.328] (-2625.710) (-2626.332) (-2624.254) * [-2620.595] (-2624.126) (-2627.777) (-2626.851) -- 0:01:30 Average standard deviation of split frequencies: 0.000242 780500 -- (-2629.413) (-2623.067) (-2628.099) [-2626.133] * [-2627.076] (-2636.962) (-2624.016) (-2627.901) -- 0:01:29 781000 -- [-2632.341] (-2621.141) (-2624.786) (-2627.142) * (-2626.973) (-2625.145) [-2620.868] (-2635.291) -- 0:01:29 781500 -- [-2625.932] (-2635.673) (-2632.519) (-2627.879) * (-2625.638) [-2620.043] (-2625.470) (-2626.297) -- 0:01:29 782000 -- [-2623.911] (-2626.195) (-2633.548) (-2624.101) * (-2626.002) (-2629.577) [-2622.608] (-2625.385) -- 0:01:29 782500 -- (-2626.307) (-2625.035) [-2625.974] (-2628.037) * [-2625.838] (-2631.274) (-2632.715) (-2622.579) -- 0:01:29 783000 -- (-2622.334) (-2623.113) [-2624.243] (-2634.993) * (-2622.065) (-2620.289) [-2627.495] (-2624.401) -- 0:01:28 783500 -- [-2623.428] (-2624.788) (-2630.261) (-2624.631) * (-2627.187) (-2625.834) [-2623.026] (-2623.704) -- 0:01:28 784000 -- (-2628.132) (-2628.330) (-2634.179) [-2621.230] * (-2628.325) (-2626.487) [-2621.477] (-2627.628) -- 0:01:28 784500 -- (-2620.102) [-2628.660] (-2627.574) (-2624.593) * (-2618.864) [-2627.367] (-2627.276) (-2630.823) -- 0:01:28 785000 -- (-2632.837) (-2621.344) (-2629.682) [-2624.118] * (-2624.202) [-2624.864] (-2631.395) (-2626.262) -- 0:01:28 Average standard deviation of split frequencies: 0.000240 785500 -- (-2625.513) (-2627.848) [-2624.438] (-2625.583) * (-2625.543) [-2623.634] (-2634.672) (-2622.790) -- 0:01:28 786000 -- (-2632.082) [-2631.082] (-2632.584) (-2621.479) * (-2625.673) [-2621.763] (-2627.293) (-2620.758) -- 0:01:27 786500 -- (-2629.509) (-2630.218) (-2631.545) [-2622.870] * [-2622.598] (-2625.470) (-2635.394) (-2625.214) -- 0:01:27 787000 -- (-2625.623) (-2624.006) [-2624.103] (-2629.394) * (-2622.563) (-2628.666) [-2624.473] (-2623.015) -- 0:01:27 787500 -- (-2625.447) (-2627.718) (-2623.466) [-2626.457] * (-2629.151) (-2629.760) [-2628.317] (-2622.961) -- 0:01:27 788000 -- (-2619.598) [-2634.183] (-2627.609) (-2629.534) * (-2620.685) (-2624.267) (-2633.134) [-2625.899] -- 0:01:27 788500 -- (-2631.163) (-2624.931) (-2628.082) [-2622.703] * (-2619.058) [-2623.064] (-2635.751) (-2634.876) -- 0:01:26 789000 -- (-2621.465) (-2627.530) (-2628.580) [-2624.849] * (-2627.768) (-2623.752) [-2623.911] (-2631.549) -- 0:01:26 789500 -- (-2630.134) [-2624.086] (-2635.158) (-2630.531) * (-2628.815) (-2634.103) [-2622.136] (-2641.045) -- 0:01:26 790000 -- (-2624.662) (-2625.624) [-2627.345] (-2630.573) * (-2626.902) (-2633.211) (-2625.557) [-2629.476] -- 0:01:26 Average standard deviation of split frequencies: 0.000238 790500 -- (-2626.858) (-2628.850) [-2619.582] (-2636.617) * [-2624.528] (-2621.165) (-2631.205) (-2629.057) -- 0:01:26 791000 -- (-2621.172) (-2630.410) (-2629.725) [-2621.709] * [-2627.364] (-2630.509) (-2630.259) (-2629.516) -- 0:01:25 791500 -- (-2618.089) (-2627.019) (-2626.747) [-2624.343] * (-2620.589) (-2623.309) [-2624.418] (-2625.109) -- 0:01:25 792000 -- (-2628.241) (-2631.749) [-2622.136] (-2626.481) * [-2624.622] (-2633.340) (-2624.020) (-2623.052) -- 0:01:25 792500 -- (-2625.905) [-2628.356] (-2625.983) (-2626.972) * (-2634.503) (-2625.856) (-2618.787) [-2621.715] -- 0:01:25 793000 -- (-2627.479) (-2624.943) [-2622.637] (-2625.444) * (-2637.621) (-2623.314) (-2621.657) [-2639.673] -- 0:01:25 793500 -- (-2627.707) [-2621.937] (-2623.041) (-2623.577) * (-2626.028) (-2625.301) (-2632.173) [-2628.152] -- 0:01:24 794000 -- [-2629.207] (-2622.873) (-2630.407) (-2624.872) * (-2631.965) (-2627.112) [-2623.064] (-2631.344) -- 0:01:24 794500 -- (-2625.210) (-2624.264) [-2622.417] (-2624.741) * (-2633.125) [-2631.853] (-2634.261) (-2631.606) -- 0:01:24 795000 -- (-2620.434) (-2621.017) (-2627.627) [-2636.736] * [-2619.735] (-2628.962) (-2629.686) (-2632.562) -- 0:01:24 Average standard deviation of split frequencies: 0.000237 795500 -- (-2627.655) (-2622.618) [-2625.814] (-2626.905) * [-2629.936] (-2631.703) (-2625.111) (-2622.091) -- 0:01:24 796000 -- (-2623.305) [-2624.451] (-2627.255) (-2626.542) * (-2623.572) [-2621.614] (-2621.981) (-2628.677) -- 0:01:23 796500 -- (-2621.721) (-2625.022) [-2625.430] (-2623.776) * (-2630.969) (-2629.054) (-2626.896) [-2631.594] -- 0:01:23 797000 -- (-2628.736) [-2631.248] (-2631.228) (-2621.123) * [-2623.165] (-2642.137) (-2632.920) (-2625.122) -- 0:01:23 797500 -- (-2627.942) [-2621.643] (-2641.036) (-2621.531) * (-2627.450) (-2630.280) (-2626.249) [-2626.043] -- 0:01:23 798000 -- (-2622.566) (-2633.188) [-2626.715] (-2624.776) * (-2626.185) [-2622.623] (-2631.589) (-2627.563) -- 0:01:23 798500 -- [-2625.307] (-2626.563) (-2628.582) (-2622.635) * [-2622.664] (-2632.059) (-2626.234) (-2631.005) -- 0:01:23 799000 -- (-2627.367) (-2627.770) (-2633.056) [-2625.469] * (-2627.221) (-2636.199) [-2620.432] (-2639.670) -- 0:01:22 799500 -- (-2623.970) (-2637.637) (-2633.840) [-2623.320] * (-2626.087) [-2630.104] (-2624.776) (-2629.384) -- 0:01:22 800000 -- [-2625.933] (-2629.695) (-2627.366) (-2627.051) * (-2631.574) (-2628.611) [-2623.321] (-2631.993) -- 0:01:22 Average standard deviation of split frequencies: 0.000236 800500 -- (-2622.527) (-2628.216) [-2621.673] (-2632.236) * [-2629.536] (-2623.158) (-2627.412) (-2634.708) -- 0:01:21 801000 -- (-2628.348) (-2632.783) [-2626.109] (-2630.078) * (-2628.478) [-2621.552] (-2630.077) (-2629.356) -- 0:01:21 801500 -- [-2624.450] (-2633.051) (-2622.743) (-2632.031) * (-2627.618) (-2623.332) (-2628.734) [-2628.830] -- 0:01:21 802000 -- [-2627.187] (-2627.785) (-2623.948) (-2628.149) * (-2624.388) [-2626.422] (-2627.718) (-2626.492) -- 0:01:21 802500 -- (-2627.997) (-2623.474) [-2627.179] (-2630.092) * (-2625.667) (-2620.857) (-2627.984) [-2624.255] -- 0:01:21 803000 -- (-2632.038) [-2631.531] (-2630.542) (-2626.256) * [-2631.836] (-2629.696) (-2631.524) (-2626.643) -- 0:01:20 803500 -- (-2626.965) (-2629.902) (-2622.993) [-2621.670] * (-2625.717) (-2634.777) [-2624.719] (-2627.886) -- 0:01:20 804000 -- [-2624.507] (-2622.392) (-2621.857) (-2625.490) * (-2624.448) [-2628.203] (-2627.270) (-2624.635) -- 0:01:20 804500 -- (-2631.781) [-2627.010] (-2629.307) (-2626.237) * (-2624.863) [-2629.954] (-2629.745) (-2624.953) -- 0:01:20 805000 -- (-2630.107) (-2629.884) [-2620.139] (-2626.363) * (-2639.220) (-2619.864) [-2625.286] (-2631.844) -- 0:01:20 Average standard deviation of split frequencies: 0.000234 805500 -- (-2630.422) (-2627.332) [-2620.609] (-2626.065) * (-2634.985) [-2625.096] (-2628.179) (-2621.900) -- 0:01:19 806000 -- (-2627.989) (-2625.620) [-2625.998] (-2630.895) * (-2627.930) (-2626.108) (-2629.576) [-2627.454] -- 0:01:19 806500 -- (-2631.392) (-2638.071) (-2627.774) [-2620.587] * (-2628.650) (-2635.059) (-2619.903) [-2626.843] -- 0:01:19 807000 -- (-2627.270) [-2618.342] (-2619.719) (-2628.593) * (-2626.520) (-2626.645) [-2625.298] (-2624.531) -- 0:01:19 807500 -- (-2626.793) (-2626.443) (-2627.248) [-2622.606] * (-2629.513) [-2621.700] (-2622.289) (-2622.161) -- 0:01:19 808000 -- (-2627.496) (-2629.926) [-2627.184] (-2629.061) * (-2629.313) (-2624.842) [-2626.289] (-2624.500) -- 0:01:19 808500 -- (-2632.320) (-2624.170) [-2622.774] (-2628.981) * (-2627.626) [-2625.575] (-2625.251) (-2633.805) -- 0:01:18 809000 -- (-2630.489) (-2624.761) (-2622.986) [-2623.516] * (-2630.504) (-2625.969) [-2629.420] (-2622.659) -- 0:01:18 809500 -- [-2623.576] (-2625.933) (-2620.636) (-2626.617) * (-2623.079) (-2627.841) (-2628.920) [-2625.523] -- 0:01:18 810000 -- (-2628.946) [-2634.762] (-2632.389) (-2626.254) * (-2621.114) (-2630.643) (-2623.198) [-2619.238] -- 0:01:18 Average standard deviation of split frequencies: 0.000233 810500 -- (-2628.659) (-2623.500) (-2631.266) [-2623.089] * (-2623.789) [-2624.070] (-2627.334) (-2628.527) -- 0:01:18 811000 -- [-2631.358] (-2626.666) (-2622.801) (-2624.812) * (-2622.896) [-2628.712] (-2624.877) (-2628.252) -- 0:01:17 811500 -- (-2624.864) (-2623.912) (-2626.993) [-2631.237] * (-2640.044) (-2628.818) [-2623.545] (-2627.250) -- 0:01:17 812000 -- [-2628.403] (-2624.804) (-2637.280) (-2630.465) * (-2632.992) (-2623.564) [-2629.188] (-2629.325) -- 0:01:17 812500 -- (-2622.394) [-2631.053] (-2633.614) (-2627.951) * (-2629.308) (-2628.696) (-2629.765) [-2626.470] -- 0:01:17 813000 -- [-2626.381] (-2621.529) (-2627.123) (-2626.334) * (-2626.947) (-2626.617) [-2629.615] (-2630.616) -- 0:01:17 813500 -- (-2631.505) [-2622.177] (-2620.943) (-2634.426) * (-2629.607) (-2619.221) [-2623.786] (-2625.989) -- 0:01:16 814000 -- (-2627.595) (-2622.881) (-2628.321) [-2629.829] * (-2620.890) [-2625.104] (-2633.188) (-2633.456) -- 0:01:16 814500 -- (-2619.703) (-2626.642) [-2632.670] (-2629.227) * [-2621.127] (-2620.617) (-2634.471) (-2621.618) -- 0:01:16 815000 -- [-2627.362] (-2622.567) (-2630.153) (-2632.573) * (-2623.239) [-2623.141] (-2632.453) (-2629.762) -- 0:01:16 Average standard deviation of split frequencies: 0.000231 815500 -- (-2629.471) [-2625.256] (-2635.411) (-2626.676) * (-2627.055) [-2623.854] (-2629.181) (-2628.311) -- 0:01:16 816000 -- (-2628.387) (-2625.441) [-2630.267] (-2624.677) * (-2633.646) [-2622.730] (-2629.781) (-2630.767) -- 0:01:15 816500 -- [-2623.886] (-2632.189) (-2627.919) (-2622.319) * (-2631.189) [-2622.679] (-2627.522) (-2628.796) -- 0:01:15 817000 -- (-2626.298) (-2633.184) [-2627.471] (-2624.287) * (-2629.470) (-2635.284) (-2626.833) [-2623.095] -- 0:01:15 817500 -- (-2627.962) (-2636.269) (-2627.263) [-2627.784] * [-2626.630] (-2627.737) (-2629.591) (-2630.272) -- 0:01:15 818000 -- (-2625.603) [-2620.036] (-2630.653) (-2625.556) * (-2626.442) (-2631.355) [-2628.667] (-2626.580) -- 0:01:14 818500 -- (-2625.134) (-2620.563) (-2625.788) [-2620.916] * (-2626.473) (-2628.425) [-2623.561] (-2623.741) -- 0:01:14 819000 -- (-2634.993) [-2624.146] (-2627.540) (-2636.641) * (-2620.606) (-2630.379) [-2628.417] (-2628.487) -- 0:01:14 819500 -- (-2626.910) [-2622.549] (-2632.542) (-2625.445) * (-2632.427) (-2627.555) (-2623.377) [-2629.309] -- 0:01:14 820000 -- [-2629.850] (-2622.916) (-2631.538) (-2625.476) * (-2624.230) (-2626.953) (-2630.592) [-2628.747] -- 0:01:14 Average standard deviation of split frequencies: 0.000230 820500 -- (-2636.975) [-2623.478] (-2628.057) (-2624.659) * (-2627.086) (-2626.632) [-2620.252] (-2625.361) -- 0:01:13 821000 -- (-2631.627) [-2625.600] (-2632.685) (-2630.146) * (-2626.795) [-2628.008] (-2619.185) (-2624.317) -- 0:01:13 821500 -- (-2633.132) (-2618.619) [-2623.660] (-2626.633) * (-2636.796) (-2623.869) (-2626.051) [-2619.387] -- 0:01:13 822000 -- (-2628.415) (-2621.812) [-2632.036] (-2621.893) * [-2634.441] (-2625.666) (-2622.570) (-2629.450) -- 0:01:13 822500 -- (-2628.238) [-2622.295] (-2622.959) (-2631.779) * (-2630.838) (-2628.125) [-2619.017] (-2627.644) -- 0:01:13 823000 -- (-2633.105) (-2624.052) [-2620.779] (-2628.872) * [-2625.876] (-2624.506) (-2625.266) (-2626.765) -- 0:01:12 823500 -- (-2629.253) (-2623.272) (-2622.662) [-2626.919] * [-2623.491] (-2625.933) (-2626.857) (-2624.847) -- 0:01:12 824000 -- [-2622.973] (-2620.060) (-2624.525) (-2623.864) * (-2622.615) (-2628.720) [-2624.045] (-2624.743) -- 0:01:12 824500 -- [-2625.346] (-2621.465) (-2626.355) (-2629.818) * (-2629.474) [-2624.698] (-2627.982) (-2627.408) -- 0:01:12 825000 -- (-2631.742) (-2623.322) (-2619.854) [-2625.061] * [-2623.703] (-2625.199) (-2627.866) (-2624.978) -- 0:01:12 Average standard deviation of split frequencies: 0.000228 825500 -- (-2624.216) [-2622.668] (-2627.768) (-2632.897) * (-2630.313) (-2632.869) (-2637.477) [-2622.689] -- 0:01:11 826000 -- (-2622.846) [-2629.628] (-2643.246) (-2623.593) * [-2621.100] (-2626.804) (-2621.945) (-2631.733) -- 0:01:11 826500 -- (-2623.973) (-2624.174) (-2630.178) [-2621.025] * [-2623.241] (-2621.429) (-2621.584) (-2624.219) -- 0:01:11 827000 -- (-2629.281) (-2626.591) [-2624.399] (-2624.149) * [-2622.779] (-2625.407) (-2629.554) (-2619.414) -- 0:01:11 827500 -- (-2623.820) (-2628.511) (-2629.729) [-2624.077] * [-2628.223] (-2629.588) (-2630.347) (-2632.817) -- 0:01:11 828000 -- (-2626.101) (-2626.850) (-2629.409) [-2627.400] * (-2634.321) [-2621.714] (-2627.571) (-2631.591) -- 0:01:10 828500 -- (-2631.231) (-2623.212) [-2630.281] (-2622.265) * (-2632.480) [-2624.814] (-2624.182) (-2630.812) -- 0:01:10 829000 -- [-2621.962] (-2631.988) (-2631.091) (-2621.788) * (-2634.583) (-2623.432) (-2622.091) [-2628.366] -- 0:01:10 829500 -- [-2621.871] (-2634.691) (-2628.984) (-2626.211) * (-2629.420) [-2620.555] (-2624.442) (-2624.450) -- 0:01:10 830000 -- (-2620.840) [-2625.483] (-2623.059) (-2625.891) * (-2636.350) [-2632.276] (-2626.849) (-2621.952) -- 0:01:10 Average standard deviation of split frequencies: 0.000227 830500 -- (-2633.658) [-2624.882] (-2636.582) (-2626.407) * (-2624.713) (-2631.963) [-2624.421] (-2619.556) -- 0:01:09 831000 -- [-2627.503] (-2627.685) (-2628.346) (-2622.303) * (-2639.398) (-2623.344) [-2626.596] (-2630.297) -- 0:01:09 831500 -- (-2631.252) (-2622.000) (-2627.109) [-2621.290] * (-2628.167) [-2620.432] (-2625.662) (-2635.077) -- 0:01:09 832000 -- (-2621.187) (-2637.688) (-2630.638) [-2629.581] * (-2639.267) (-2626.894) [-2624.764] (-2622.690) -- 0:01:09 832500 -- [-2629.207] (-2629.758) (-2624.213) (-2622.248) * (-2632.275) [-2628.441] (-2633.870) (-2624.223) -- 0:01:09 833000 -- (-2627.526) (-2620.758) (-2623.298) [-2622.223] * [-2625.617] (-2631.352) (-2621.628) (-2624.720) -- 0:01:08 833500 -- (-2629.390) (-2626.043) [-2626.189] (-2627.429) * (-2634.227) (-2620.871) [-2626.076] (-2623.675) -- 0:01:08 834000 -- (-2627.536) [-2632.341] (-2631.271) (-2637.648) * (-2627.195) [-2620.361] (-2629.599) (-2631.713) -- 0:01:08 834500 -- (-2627.101) (-2633.205) [-2622.632] (-2622.815) * (-2623.482) [-2629.035] (-2624.373) (-2631.261) -- 0:01:08 835000 -- (-2622.949) (-2627.719) (-2627.090) [-2630.493] * (-2626.423) [-2623.850] (-2624.168) (-2636.369) -- 0:01:07 Average standard deviation of split frequencies: 0.000226 835500 -- (-2627.243) (-2620.923) (-2629.639) [-2623.167] * (-2629.497) (-2626.222) [-2620.577] (-2631.804) -- 0:01:07 836000 -- [-2625.092] (-2625.214) (-2630.073) (-2635.025) * (-2624.839) [-2631.067] (-2625.346) (-2622.197) -- 0:01:07 836500 -- [-2625.243] (-2626.996) (-2627.396) (-2628.666) * (-2622.635) [-2625.440] (-2626.939) (-2625.887) -- 0:01:07 837000 -- (-2623.325) (-2636.127) (-2626.993) [-2626.764] * (-2633.441) [-2626.992] (-2624.152) (-2635.821) -- 0:01:07 837500 -- (-2622.515) (-2633.531) [-2626.384] (-2624.050) * (-2628.042) [-2622.559] (-2628.123) (-2625.641) -- 0:01:06 838000 -- [-2621.486] (-2628.658) (-2630.992) (-2624.759) * (-2631.715) (-2628.562) (-2622.824) [-2625.670] -- 0:01:06 838500 -- [-2621.074] (-2623.756) (-2627.484) (-2625.119) * (-2628.571) [-2620.408] (-2623.984) (-2625.602) -- 0:01:06 839000 -- [-2620.710] (-2630.118) (-2628.110) (-2622.607) * [-2624.859] (-2624.889) (-2629.355) (-2624.606) -- 0:01:06 839500 -- [-2629.264] (-2617.954) (-2633.830) (-2622.519) * (-2630.669) [-2625.175] (-2632.923) (-2628.144) -- 0:01:06 840000 -- (-2628.358) (-2624.710) (-2632.182) [-2622.837] * (-2628.519) [-2626.277] (-2633.926) (-2621.106) -- 0:01:05 Average standard deviation of split frequencies: 0.000224 840500 -- (-2631.701) [-2627.180] (-2623.105) (-2627.699) * (-2626.955) (-2626.706) (-2620.324) [-2628.048] -- 0:01:05 841000 -- [-2628.364] (-2624.687) (-2625.171) (-2629.896) * (-2627.285) [-2629.072] (-2631.984) (-2625.194) -- 0:01:05 841500 -- [-2622.957] (-2622.656) (-2629.613) (-2626.095) * [-2627.216] (-2629.608) (-2633.046) (-2619.955) -- 0:01:05 842000 -- (-2625.199) (-2630.831) (-2630.347) [-2623.227] * (-2627.113) (-2620.508) [-2625.254] (-2625.380) -- 0:01:05 842500 -- (-2623.101) [-2628.025] (-2632.286) (-2630.921) * (-2618.528) (-2624.357) [-2623.617] (-2620.346) -- 0:01:04 843000 -- (-2623.013) [-2624.948] (-2635.214) (-2628.089) * (-2621.833) (-2620.227) (-2630.926) [-2620.081] -- 0:01:04 843500 -- (-2621.057) [-2620.293] (-2622.162) (-2635.980) * [-2621.788] (-2628.356) (-2620.305) (-2624.861) -- 0:01:04 844000 -- [-2620.890] (-2625.894) (-2628.149) (-2629.798) * [-2631.984] (-2621.082) (-2630.448) (-2628.968) -- 0:01:04 844500 -- [-2622.829] (-2629.604) (-2634.322) (-2632.413) * (-2631.097) (-2628.271) (-2624.504) [-2630.043] -- 0:01:04 845000 -- (-2624.814) (-2624.309) (-2625.915) [-2623.464] * (-2635.441) [-2620.797] (-2623.187) (-2631.404) -- 0:01:03 Average standard deviation of split frequencies: 0.000223 845500 -- (-2630.332) [-2626.374] (-2621.087) (-2627.210) * [-2628.255] (-2627.435) (-2626.032) (-2631.211) -- 0:01:03 846000 -- (-2635.771) (-2630.787) (-2627.794) [-2620.910] * (-2629.946) (-2624.377) [-2618.991] (-2631.217) -- 0:01:03 846500 -- [-2627.810] (-2627.382) (-2628.589) (-2630.206) * (-2632.306) (-2630.228) (-2624.539) [-2619.973] -- 0:01:03 847000 -- (-2623.790) (-2625.196) (-2630.412) [-2625.461] * [-2625.698] (-2634.528) (-2636.466) (-2626.603) -- 0:01:03 847500 -- (-2632.932) [-2624.073] (-2628.051) (-2624.896) * (-2621.899) (-2629.467) [-2622.503] (-2629.459) -- 0:01:02 848000 -- (-2626.705) [-2620.405] (-2628.250) (-2623.938) * [-2620.390] (-2623.493) (-2624.082) (-2627.330) -- 0:01:02 848500 -- (-2630.611) (-2627.950) (-2630.979) [-2627.165] * [-2625.517] (-2631.484) (-2622.540) (-2626.006) -- 0:01:02 849000 -- [-2622.761] (-2627.950) (-2628.428) (-2628.529) * (-2622.593) (-2646.955) [-2626.796] (-2629.290) -- 0:01:02 849500 -- [-2623.879] (-2624.212) (-2626.219) (-2623.617) * [-2629.410] (-2637.385) (-2623.429) (-2622.312) -- 0:01:02 850000 -- (-2628.254) [-2626.325] (-2626.858) (-2627.255) * (-2625.444) (-2627.840) (-2632.396) [-2629.844] -- 0:01:01 Average standard deviation of split frequencies: 0.000222 850500 -- (-2629.293) [-2629.730] (-2627.960) (-2631.938) * (-2626.523) (-2630.488) (-2630.383) [-2625.612] -- 0:01:01 851000 -- [-2624.605] (-2642.419) (-2624.382) (-2629.548) * (-2632.113) [-2630.853] (-2630.186) (-2627.134) -- 0:01:01 851500 -- [-2620.773] (-2640.346) (-2630.590) (-2626.886) * [-2628.576] (-2623.969) (-2625.740) (-2629.663) -- 0:01:01 852000 -- (-2623.303) (-2627.975) [-2632.376] (-2630.755) * (-2621.756) (-2626.079) (-2629.847) [-2626.323] -- 0:01:00 852500 -- (-2626.774) (-2628.462) [-2625.722] (-2625.855) * (-2624.400) [-2633.582] (-2626.420) (-2628.743) -- 0:01:00 853000 -- (-2625.617) (-2630.855) [-2630.219] (-2623.076) * [-2621.486] (-2625.084) (-2628.110) (-2626.464) -- 0:01:00 853500 -- [-2624.990] (-2628.347) (-2625.514) (-2632.966) * [-2626.361] (-2624.762) (-2628.941) (-2627.197) -- 0:01:00 854000 -- (-2638.087) [-2631.374] (-2628.892) (-2634.731) * (-2631.293) (-2627.517) [-2624.435] (-2626.308) -- 0:01:00 854500 -- (-2631.591) [-2619.128] (-2628.614) (-2622.137) * (-2628.635) [-2625.471] (-2623.075) (-2625.264) -- 0:00:59 855000 -- (-2628.632) [-2623.446] (-2631.767) (-2624.909) * (-2629.084) (-2620.668) [-2631.007] (-2624.060) -- 0:00:59 Average standard deviation of split frequencies: 0.000220 855500 -- (-2636.046) (-2620.612) [-2623.154] (-2626.057) * (-2629.363) (-2630.128) [-2626.357] (-2633.629) -- 0:00:59 856000 -- [-2631.522] (-2628.391) (-2620.930) (-2629.155) * (-2628.605) [-2625.081] (-2622.701) (-2622.990) -- 0:00:59 856500 -- (-2625.449) (-2625.964) (-2624.479) [-2628.139] * (-2622.466) [-2620.520] (-2622.363) (-2626.010) -- 0:00:58 857000 -- [-2627.866] (-2621.352) (-2621.228) (-2626.603) * (-2621.188) [-2627.968] (-2626.439) (-2633.380) -- 0:00:58 857500 -- (-2626.964) [-2625.002] (-2634.604) (-2624.493) * (-2624.357) [-2623.261] (-2623.816) (-2624.917) -- 0:00:58 858000 -- (-2630.875) [-2620.712] (-2627.183) (-2628.098) * (-2634.547) [-2621.518] (-2627.390) (-2626.362) -- 0:00:58 858500 -- (-2630.155) (-2629.105) (-2631.144) [-2624.662] * (-2624.821) (-2628.048) [-2631.189] (-2626.562) -- 0:00:58 859000 -- [-2628.323] (-2627.602) (-2629.053) (-2629.327) * (-2620.145) (-2626.134) (-2625.889) [-2624.988] -- 0:00:58 859500 -- [-2624.166] (-2622.689) (-2628.976) (-2628.121) * [-2623.039] (-2621.453) (-2627.562) (-2622.801) -- 0:00:57 860000 -- (-2626.724) (-2631.978) [-2625.634] (-2635.410) * [-2624.434] (-2628.985) (-2629.643) (-2625.688) -- 0:00:57 Average standard deviation of split frequencies: 0.000219 860500 -- (-2624.221) [-2634.614] (-2630.184) (-2624.668) * (-2621.978) (-2628.825) (-2628.981) [-2627.051] -- 0:00:57 861000 -- (-2625.086) (-2636.286) (-2629.905) [-2626.706] * (-2626.237) [-2630.040] (-2625.314) (-2627.358) -- 0:00:57 861500 -- [-2627.126] (-2626.792) (-2627.573) (-2628.985) * (-2622.794) (-2633.959) [-2621.182] (-2624.958) -- 0:00:57 862000 -- (-2625.863) (-2630.415) [-2624.598] (-2630.574) * (-2628.393) (-2632.399) (-2629.233) [-2621.968] -- 0:00:56 862500 -- (-2627.638) (-2625.348) [-2625.792] (-2624.095) * (-2630.605) (-2636.530) [-2623.782] (-2629.967) -- 0:00:56 863000 -- (-2632.624) (-2622.603) [-2632.408] (-2631.699) * [-2628.711] (-2622.318) (-2624.318) (-2633.494) -- 0:00:56 863500 -- [-2626.858] (-2626.309) (-2629.539) (-2629.655) * (-2624.440) (-2620.535) [-2623.880] (-2624.351) -- 0:00:56 864000 -- (-2630.808) (-2628.541) [-2621.339] (-2623.654) * (-2626.681) [-2630.523] (-2623.622) (-2636.268) -- 0:00:56 864500 -- (-2626.579) [-2631.016] (-2626.791) (-2622.894) * (-2632.529) (-2625.377) (-2626.849) [-2626.934] -- 0:00:55 865000 -- (-2628.685) (-2624.559) [-2620.738] (-2624.615) * (-2627.933) (-2626.437) [-2623.192] (-2626.050) -- 0:00:55 Average standard deviation of split frequencies: 0.000218 865500 -- (-2623.891) (-2626.599) [-2623.463] (-2632.603) * (-2631.507) (-2625.489) (-2624.690) [-2622.772] -- 0:00:55 866000 -- (-2622.728) [-2629.656] (-2625.810) (-2627.912) * (-2630.112) (-2629.663) [-2627.737] (-2623.946) -- 0:00:55 866500 -- [-2624.832] (-2626.902) (-2624.867) (-2627.258) * (-2627.669) (-2620.888) (-2628.976) [-2624.669] -- 0:00:55 867000 -- (-2635.595) (-2622.748) (-2621.300) [-2624.219] * [-2620.965] (-2626.174) (-2625.602) (-2630.550) -- 0:00:54 867500 -- (-2626.254) (-2629.979) [-2616.000] (-2629.147) * (-2622.307) (-2633.831) [-2623.117] (-2634.032) -- 0:00:54 868000 -- (-2623.154) (-2624.925) [-2623.589] (-2632.040) * [-2628.072] (-2634.897) (-2628.300) (-2622.567) -- 0:00:54 868500 -- [-2624.460] (-2632.449) (-2624.166) (-2629.532) * (-2625.900) [-2630.579] (-2628.640) (-2623.023) -- 0:00:54 869000 -- [-2626.874] (-2623.121) (-2629.456) (-2623.276) * (-2626.709) [-2623.549] (-2620.909) (-2630.886) -- 0:00:53 869500 -- (-2633.790) (-2626.648) [-2628.601] (-2628.124) * (-2637.651) (-2630.832) [-2623.186] (-2624.962) -- 0:00:53 870000 -- (-2629.498) (-2622.968) (-2622.581) [-2619.884] * (-2632.579) (-2627.855) (-2622.774) [-2621.180] -- 0:00:53 Average standard deviation of split frequencies: 0.000217 870500 -- (-2629.501) (-2626.728) [-2619.701] (-2625.108) * (-2626.006) (-2631.272) [-2628.296] (-2626.503) -- 0:00:53 871000 -- [-2630.998] (-2633.568) (-2623.076) (-2628.242) * (-2628.881) (-2630.120) (-2625.157) [-2636.087] -- 0:00:53 871500 -- (-2628.194) (-2627.507) [-2629.872] (-2621.587) * [-2626.009] (-2623.160) (-2630.905) (-2623.683) -- 0:00:52 872000 -- (-2630.164) [-2622.807] (-2621.842) (-2620.044) * (-2628.229) (-2627.190) (-2630.118) [-2630.294] -- 0:00:52 872500 -- [-2620.660] (-2626.736) (-2626.181) (-2623.486) * (-2625.568) [-2628.324] (-2629.047) (-2629.564) -- 0:00:52 873000 -- (-2623.378) (-2631.306) (-2631.492) [-2622.175] * (-2627.970) [-2632.168] (-2638.646) (-2627.618) -- 0:00:52 873500 -- (-2622.981) [-2623.030] (-2624.017) (-2624.583) * (-2620.398) (-2624.543) (-2621.287) [-2623.493] -- 0:00:52 874000 -- [-2621.575] (-2622.412) (-2626.924) (-2624.582) * (-2625.832) [-2622.525] (-2627.417) (-2632.103) -- 0:00:51 874500 -- (-2622.376) (-2627.181) [-2626.730] (-2630.867) * [-2628.977] (-2621.972) (-2629.184) (-2628.989) -- 0:00:51 875000 -- (-2622.542) (-2636.509) (-2625.531) [-2634.490] * [-2627.946] (-2631.790) (-2622.962) (-2631.695) -- 0:00:51 Average standard deviation of split frequencies: 0.000215 875500 -- (-2623.373) [-2628.627] (-2627.167) (-2627.434) * (-2635.619) [-2624.271] (-2630.866) (-2624.129) -- 0:00:51 876000 -- (-2623.408) (-2628.367) [-2619.690] (-2624.971) * (-2634.188) (-2630.322) [-2625.158] (-2632.290) -- 0:00:51 876500 -- [-2625.141] (-2629.355) (-2628.133) (-2632.031) * (-2627.611) (-2622.197) [-2621.265] (-2623.611) -- 0:00:50 877000 -- (-2624.564) (-2628.583) (-2630.675) [-2623.387] * (-2627.194) (-2626.959) [-2619.696] (-2619.754) -- 0:00:50 877500 -- (-2629.436) (-2635.764) (-2624.134) [-2624.187] * (-2621.973) [-2630.751] (-2624.030) (-2625.720) -- 0:00:50 878000 -- (-2631.649) (-2628.515) (-2622.522) [-2622.638] * [-2628.365] (-2630.387) (-2627.378) (-2626.420) -- 0:00:50 878500 -- [-2625.071] (-2634.879) (-2622.286) (-2628.190) * (-2629.459) (-2622.464) (-2623.595) [-2620.153] -- 0:00:50 879000 -- [-2625.052] (-2633.254) (-2621.351) (-2624.354) * [-2628.188] (-2635.404) (-2622.762) (-2620.486) -- 0:00:49 879500 -- [-2623.957] (-2630.046) (-2620.148) (-2627.245) * (-2624.910) (-2633.939) (-2631.269) [-2621.662] -- 0:00:49 880000 -- (-2625.217) (-2628.009) [-2627.789] (-2630.244) * [-2622.871] (-2624.946) (-2623.919) (-2623.494) -- 0:00:49 Average standard deviation of split frequencies: 0.000214 880500 -- (-2623.163) (-2627.675) (-2635.458) [-2625.009] * (-2628.724) [-2628.812] (-2622.389) (-2625.401) -- 0:00:49 881000 -- (-2622.263) (-2631.092) [-2623.900] (-2629.902) * (-2629.405) (-2630.572) [-2630.507] (-2632.306) -- 0:00:49 881500 -- (-2623.144) (-2635.048) (-2632.403) [-2626.771] * (-2624.094) (-2626.891) (-2620.157) [-2631.261] -- 0:00:48 882000 -- [-2630.901] (-2630.011) (-2630.740) (-2624.693) * (-2631.147) (-2621.443) [-2623.729] (-2624.453) -- 0:00:48 882500 -- [-2626.663] (-2632.277) (-2626.537) (-2629.767) * [-2623.216] (-2632.734) (-2622.309) (-2629.277) -- 0:00:48 883000 -- (-2627.105) [-2627.910] (-2629.406) (-2623.226) * (-2626.524) (-2620.964) [-2630.788] (-2633.052) -- 0:00:48 883500 -- (-2627.583) (-2630.698) (-2625.558) [-2627.242] * (-2630.997) (-2631.467) (-2626.299) [-2631.292] -- 0:00:47 884000 -- (-2632.495) (-2624.212) [-2622.344] (-2624.569) * (-2630.494) (-2633.741) [-2626.467] (-2630.808) -- 0:00:47 884500 -- (-2630.266) (-2623.825) [-2630.087] (-2624.236) * (-2623.433) [-2619.676] (-2626.896) (-2630.063) -- 0:00:47 885000 -- [-2624.442] (-2631.305) (-2627.117) (-2619.673) * [-2625.007] (-2624.214) (-2637.373) (-2624.132) -- 0:00:47 Average standard deviation of split frequencies: 0.000213 885500 -- [-2628.508] (-2635.784) (-2623.069) (-2629.344) * (-2626.388) (-2628.555) (-2629.926) [-2627.282] -- 0:00:47 886000 -- (-2634.501) [-2631.172] (-2625.328) (-2623.833) * [-2627.280] (-2625.729) (-2633.047) (-2630.719) -- 0:00:46 886500 -- (-2621.826) (-2618.508) (-2625.752) [-2619.195] * (-2622.830) (-2629.174) (-2629.578) [-2629.510] -- 0:00:46 887000 -- [-2628.168] (-2625.386) (-2628.394) (-2623.380) * (-2623.198) (-2624.769) (-2632.908) [-2622.739] -- 0:00:46 887500 -- (-2631.327) (-2626.096) (-2629.722) [-2625.992] * (-2631.832) (-2627.968) [-2629.940] (-2626.139) -- 0:00:46 888000 -- (-2625.316) (-2622.303) (-2623.592) [-2628.417] * (-2629.450) [-2633.751] (-2623.387) (-2626.773) -- 0:00:46 888500 -- [-2624.323] (-2629.085) (-2626.687) (-2620.122) * (-2625.519) (-2631.828) (-2625.590) [-2619.399] -- 0:00:45 889000 -- (-2624.788) (-2626.969) (-2633.983) [-2629.043] * [-2627.579] (-2627.895) (-2627.988) (-2619.982) -- 0:00:45 889500 -- (-2625.594) (-2632.573) [-2634.213] (-2625.505) * (-2631.743) [-2621.952] (-2628.720) (-2629.614) -- 0:00:45 890000 -- (-2633.933) (-2622.669) [-2630.977] (-2623.962) * (-2623.609) [-2624.717] (-2629.448) (-2621.291) -- 0:00:45 Average standard deviation of split frequencies: 0.000212 890500 -- (-2632.232) (-2625.569) [-2624.781] (-2624.582) * [-2634.991] (-2627.582) (-2633.161) (-2621.693) -- 0:00:45 891000 -- [-2622.760] (-2631.307) (-2630.011) (-2631.894) * (-2629.239) (-2629.634) (-2633.561) [-2629.384] -- 0:00:44 891500 -- (-2632.162) (-2630.899) [-2622.877] (-2632.527) * (-2638.873) (-2626.311) [-2625.752] (-2627.199) -- 0:00:44 892000 -- (-2634.543) (-2631.006) [-2624.501] (-2633.536) * (-2625.578) (-2625.317) [-2629.051] (-2632.087) -- 0:00:44 892500 -- (-2627.837) [-2629.449] (-2626.920) (-2624.167) * (-2623.619) [-2623.181] (-2626.357) (-2626.610) -- 0:00:44 893000 -- (-2637.290) (-2635.843) (-2628.998) [-2627.333] * (-2622.084) (-2633.564) (-2634.141) [-2626.225] -- 0:00:44 893500 -- (-2632.859) [-2626.660] (-2630.128) (-2626.529) * [-2624.175] (-2631.173) (-2622.977) (-2629.181) -- 0:00:43 894000 -- [-2629.250] (-2629.617) (-2626.811) (-2629.042) * (-2621.988) (-2631.119) (-2620.279) [-2631.468] -- 0:00:43 894500 -- (-2634.695) (-2622.476) (-2627.283) [-2625.670] * (-2626.117) (-2630.441) (-2628.273) [-2625.237] -- 0:00:43 895000 -- (-2629.161) (-2620.580) [-2626.238] (-2627.496) * (-2625.114) (-2625.279) (-2631.321) [-2621.854] -- 0:00:43 Average standard deviation of split frequencies: 0.000210 895500 -- (-2622.455) (-2625.602) [-2624.071] (-2623.752) * (-2627.352) (-2623.104) [-2623.806] (-2627.636) -- 0:00:43 896000 -- (-2630.163) [-2625.462] (-2628.916) (-2621.084) * (-2634.526) (-2625.689) (-2621.105) [-2622.818] -- 0:00:42 896500 -- (-2627.054) (-2621.578) (-2627.944) [-2631.514] * (-2630.429) (-2634.058) [-2624.034] (-2621.336) -- 0:00:42 897000 -- (-2625.745) (-2619.737) [-2628.265] (-2629.777) * [-2620.504] (-2630.436) (-2629.639) (-2624.401) -- 0:00:42 897500 -- (-2627.020) [-2623.724] (-2632.013) (-2629.068) * [-2626.711] (-2628.112) (-2623.916) (-2622.025) -- 0:00:42 898000 -- (-2631.276) (-2623.933) [-2625.644] (-2624.959) * (-2625.656) (-2627.815) (-2625.472) [-2626.818] -- 0:00:42 898500 -- (-2622.483) (-2623.487) (-2625.977) [-2620.739] * (-2621.602) [-2629.439] (-2628.945) (-2628.319) -- 0:00:41 899000 -- [-2625.378] (-2627.699) (-2627.538) (-2620.563) * (-2627.192) (-2626.309) (-2624.855) [-2622.996] -- 0:00:41 899500 -- (-2624.306) (-2630.420) (-2633.247) [-2622.534] * (-2625.166) (-2637.806) (-2620.223) [-2628.701] -- 0:00:41 900000 -- [-2621.311] (-2625.707) (-2635.271) (-2627.682) * (-2632.985) (-2622.060) [-2625.707] (-2629.193) -- 0:00:41 Average standard deviation of split frequencies: 0.000209 900500 -- (-2625.277) [-2624.249] (-2631.401) (-2630.695) * (-2625.794) [-2627.930] (-2625.234) (-2627.698) -- 0:00:40 901000 -- [-2627.602] (-2621.810) (-2627.383) (-2626.659) * (-2639.850) (-2623.389) [-2626.200] (-2619.602) -- 0:00:40 901500 -- (-2622.677) (-2625.046) (-2623.953) [-2627.012] * (-2629.958) (-2626.341) [-2625.686] (-2623.288) -- 0:00:40 902000 -- [-2625.824] (-2626.002) (-2624.213) (-2624.293) * (-2627.426) [-2625.388] (-2629.076) (-2622.197) -- 0:00:40 902500 -- [-2622.977] (-2630.199) (-2626.648) (-2626.006) * (-2624.282) (-2622.182) (-2625.176) [-2626.503] -- 0:00:40 903000 -- (-2621.328) (-2629.236) (-2635.163) [-2620.659] * (-2620.047) (-2625.420) (-2634.325) [-2626.196] -- 0:00:39 903500 -- (-2628.343) [-2621.411] (-2626.394) (-2631.562) * (-2629.378) (-2628.540) (-2621.553) [-2621.971] -- 0:00:39 904000 -- (-2629.920) (-2623.813) [-2627.675] (-2629.092) * [-2628.902] (-2628.128) (-2631.788) (-2632.946) -- 0:00:39 904500 -- (-2630.087) [-2621.084] (-2626.690) (-2625.387) * [-2626.777] (-2630.538) (-2623.088) (-2627.704) -- 0:00:39 905000 -- (-2620.556) (-2631.736) (-2623.950) [-2623.926] * (-2628.856) [-2625.054] (-2625.456) (-2635.046) -- 0:00:39 Average standard deviation of split frequencies: 0.000208 905500 -- [-2625.502] (-2635.070) (-2626.375) (-2622.638) * [-2620.582] (-2625.939) (-2628.730) (-2630.381) -- 0:00:38 906000 -- (-2626.485) [-2628.993] (-2624.868) (-2628.025) * (-2632.413) (-2627.694) (-2632.745) [-2618.540] -- 0:00:38 906500 -- [-2625.061] (-2630.198) (-2626.706) (-2630.548) * [-2629.408] (-2625.827) (-2632.607) (-2625.631) -- 0:00:38 907000 -- (-2629.584) (-2636.228) (-2624.222) [-2624.008] * (-2634.191) [-2628.287] (-2632.506) (-2629.414) -- 0:00:38 907500 -- (-2626.511) [-2632.829] (-2633.066) (-2630.677) * [-2621.158] (-2623.858) (-2622.477) (-2629.079) -- 0:00:38 908000 -- (-2633.876) [-2625.286] (-2622.774) (-2629.837) * (-2622.773) (-2625.237) [-2624.939] (-2631.656) -- 0:00:37 908500 -- [-2619.310] (-2629.609) (-2625.621) (-2633.261) * (-2627.958) [-2628.091] (-2630.648) (-2626.589) -- 0:00:37 909000 -- (-2632.506) (-2626.893) [-2621.047] (-2623.150) * (-2625.323) (-2626.519) (-2623.522) [-2622.288] -- 0:00:37 909500 -- (-2624.940) [-2626.717] (-2621.913) (-2629.809) * (-2626.473) [-2628.712] (-2627.751) (-2624.557) -- 0:00:37 910000 -- [-2625.544] (-2632.538) (-2623.467) (-2624.167) * (-2624.647) (-2634.677) [-2623.943] (-2634.979) -- 0:00:36 Average standard deviation of split frequencies: 0.000207 910500 -- (-2622.588) [-2625.808] (-2632.152) (-2624.970) * [-2626.325] (-2628.375) (-2623.222) (-2631.790) -- 0:00:36 911000 -- [-2625.601] (-2632.063) (-2624.542) (-2628.140) * (-2625.943) (-2629.800) [-2625.596] (-2625.633) -- 0:00:36 911500 -- [-2624.681] (-2624.562) (-2621.011) (-2630.476) * (-2627.394) [-2624.916] (-2627.928) (-2628.582) -- 0:00:36 912000 -- [-2620.753] (-2624.521) (-2626.511) (-2628.326) * [-2625.955] (-2626.507) (-2631.870) (-2626.544) -- 0:00:36 912500 -- (-2627.819) (-2625.244) (-2637.088) [-2624.066] * (-2623.816) (-2623.187) [-2620.829] (-2624.835) -- 0:00:35 913000 -- [-2626.915] (-2632.172) (-2634.298) (-2622.866) * [-2620.017] (-2630.780) (-2625.921) (-2626.780) -- 0:00:35 913500 -- (-2638.550) (-2626.599) (-2636.607) [-2619.656] * (-2626.686) (-2630.752) (-2623.908) [-2625.866] -- 0:00:35 914000 -- (-2624.303) [-2624.530] (-2634.424) (-2626.509) * (-2622.713) (-2632.402) [-2625.864] (-2630.364) -- 0:00:35 914500 -- (-2638.860) [-2622.722] (-2632.848) (-2626.877) * (-2630.147) [-2622.670] (-2625.581) (-2634.380) -- 0:00:35 915000 -- [-2623.830] (-2621.196) (-2624.868) (-2625.187) * (-2625.694) (-2625.700) (-2625.851) [-2624.205] -- 0:00:34 Average standard deviation of split frequencies: 0.000206 915500 -- (-2621.169) (-2621.130) (-2625.219) [-2628.104] * (-2623.901) (-2634.447) [-2622.852] (-2626.674) -- 0:00:34 916000 -- (-2630.180) [-2626.436] (-2624.962) (-2623.712) * (-2631.770) (-2629.095) [-2621.083] (-2631.481) -- 0:00:34 916500 -- (-2624.429) (-2631.282) [-2622.608] (-2626.826) * (-2629.077) [-2620.854] (-2629.419) (-2636.336) -- 0:00:34 917000 -- (-2625.548) [-2631.274] (-2630.960) (-2625.828) * [-2618.979] (-2623.781) (-2627.114) (-2626.969) -- 0:00:34 917500 -- (-2626.462) (-2627.094) (-2629.304) [-2625.084] * (-2633.520) (-2626.173) (-2628.401) [-2622.866] -- 0:00:33 918000 -- (-2623.377) (-2623.318) [-2624.924] (-2632.586) * (-2625.701) (-2634.408) [-2622.885] (-2625.482) -- 0:00:33 918500 -- [-2627.185] (-2624.914) (-2625.345) (-2627.613) * (-2627.045) (-2625.290) [-2622.579] (-2626.197) -- 0:00:33 919000 -- (-2627.579) [-2626.021] (-2621.179) (-2624.901) * (-2637.814) (-2636.040) (-2625.264) [-2624.485] -- 0:00:33 919500 -- (-2624.165) (-2621.568) (-2620.953) [-2619.165] * (-2627.431) [-2622.383] (-2626.034) (-2626.651) -- 0:00:33 920000 -- [-2625.603] (-2631.600) (-2621.925) (-2624.470) * (-2630.727) (-2623.903) [-2620.414] (-2623.442) -- 0:00:32 Average standard deviation of split frequencies: 0.000205 920500 -- (-2628.164) (-2632.962) (-2624.916) [-2627.540] * (-2624.545) (-2632.138) (-2620.568) [-2627.272] -- 0:00:32 921000 -- [-2622.180] (-2631.007) (-2622.039) (-2622.527) * (-2630.758) (-2632.726) [-2627.670] (-2626.194) -- 0:00:32 921500 -- (-2622.915) (-2633.161) (-2629.590) [-2624.593] * (-2622.657) (-2628.880) (-2625.282) [-2627.845] -- 0:00:32 922000 -- [-2619.274] (-2627.805) (-2623.601) (-2626.354) * (-2626.278) (-2628.097) [-2629.908] (-2623.213) -- 0:00:32 922500 -- (-2623.456) (-2628.071) [-2621.594] (-2626.502) * (-2635.295) (-2628.536) (-2632.857) [-2627.212] -- 0:00:31 923000 -- (-2622.676) (-2624.232) [-2622.885] (-2625.706) * (-2625.011) (-2632.523) [-2628.043] (-2627.332) -- 0:00:31 923500 -- (-2621.380) [-2629.927] (-2635.511) (-2628.451) * [-2629.306] (-2628.298) (-2624.033) (-2626.817) -- 0:00:31 924000 -- [-2626.738] (-2633.523) (-2631.351) (-2631.394) * (-2623.698) (-2643.380) [-2628.929] (-2625.099) -- 0:00:31 924500 -- (-2623.574) [-2632.483] (-2633.190) (-2624.568) * (-2625.974) (-2629.768) (-2628.989) [-2621.960] -- 0:00:31 925000 -- (-2629.169) (-2629.152) [-2622.103] (-2629.772) * [-2628.487] (-2626.891) (-2622.666) (-2621.332) -- 0:00:30 Average standard deviation of split frequencies: 0.000204 925500 -- (-2634.361) [-2622.859] (-2632.554) (-2619.536) * (-2631.655) (-2627.018) [-2626.061] (-2627.471) -- 0:00:30 926000 -- (-2624.550) (-2624.794) (-2625.637) [-2624.850] * (-2620.436) (-2627.881) [-2644.605] (-2620.907) -- 0:00:30 926500 -- [-2622.650] (-2621.450) (-2632.357) (-2625.630) * (-2628.214) (-2628.554) [-2627.409] (-2628.763) -- 0:00:30 927000 -- (-2625.732) [-2622.533] (-2620.788) (-2628.405) * (-2626.834) (-2632.442) (-2627.529) [-2627.916] -- 0:00:30 927500 -- (-2627.284) (-2625.413) [-2618.788] (-2626.278) * (-2631.377) (-2638.363) [-2622.437] (-2625.402) -- 0:00:29 928000 -- (-2634.843) [-2627.269] (-2622.608) (-2628.891) * (-2628.720) (-2624.053) (-2626.568) [-2629.341] -- 0:00:29 928500 -- (-2621.468) (-2626.120) [-2624.384] (-2623.766) * (-2630.507) (-2631.045) [-2625.977] (-2632.352) -- 0:00:29 929000 -- (-2628.890) (-2622.818) [-2623.194] (-2631.863) * [-2630.264] (-2627.761) (-2625.924) (-2627.889) -- 0:00:29 929500 -- [-2630.972] (-2621.073) (-2629.229) (-2624.908) * (-2626.873) [-2630.256] (-2627.573) (-2626.204) -- 0:00:28 930000 -- (-2625.167) [-2625.526] (-2626.955) (-2627.052) * (-2626.028) (-2621.776) (-2626.646) [-2622.864] -- 0:00:28 Average standard deviation of split frequencies: 0.000203 930500 -- [-2628.699] (-2620.743) (-2623.120) (-2629.977) * (-2626.534) (-2629.505) (-2629.515) [-2623.125] -- 0:00:28 931000 -- (-2633.527) [-2629.924] (-2632.855) (-2620.403) * (-2626.508) (-2624.915) (-2634.298) [-2624.343] -- 0:00:28 931500 -- [-2623.235] (-2622.241) (-2632.464) (-2626.192) * [-2626.047] (-2624.200) (-2621.947) (-2635.482) -- 0:00:28 932000 -- (-2633.632) (-2627.793) (-2629.028) [-2626.443] * [-2626.968] (-2623.004) (-2622.172) (-2635.291) -- 0:00:27 932500 -- (-2624.211) [-2619.586] (-2630.436) (-2625.695) * [-2623.666] (-2629.853) (-2623.178) (-2624.195) -- 0:00:27 933000 -- (-2633.471) [-2624.454] (-2624.732) (-2632.787) * (-2635.830) (-2624.962) [-2628.363] (-2630.221) -- 0:00:27 933500 -- (-2627.971) (-2623.742) [-2620.577] (-2625.424) * [-2624.040] (-2635.597) (-2622.071) (-2626.693) -- 0:00:27 934000 -- [-2624.905] (-2634.353) (-2628.577) (-2625.885) * [-2628.594] (-2633.148) (-2626.160) (-2630.842) -- 0:00:27 934500 -- (-2628.395) (-2629.092) [-2623.258] (-2622.434) * (-2628.750) (-2626.078) [-2625.689] (-2628.009) -- 0:00:26 935000 -- (-2622.311) [-2629.170] (-2636.677) (-2622.800) * (-2630.302) [-2627.061] (-2625.832) (-2623.461) -- 0:00:26 Average standard deviation of split frequencies: 0.000201 935500 -- [-2627.691] (-2624.308) (-2629.964) (-2626.454) * (-2627.085) (-2633.796) (-2626.912) [-2624.267] -- 0:00:26 936000 -- [-2631.127] (-2622.387) (-2626.698) (-2632.196) * [-2621.648] (-2628.937) (-2623.362) (-2627.831) -- 0:00:26 936500 -- (-2624.261) (-2628.380) [-2625.698] (-2637.769) * (-2632.142) (-2625.933) (-2629.364) [-2623.736] -- 0:00:26 937000 -- [-2629.678] (-2642.191) (-2620.606) (-2633.916) * (-2624.382) (-2621.288) (-2628.740) [-2623.698] -- 0:00:25 937500 -- (-2624.407) (-2630.886) [-2628.693] (-2631.354) * (-2630.280) (-2630.265) [-2622.641] (-2621.632) -- 0:00:25 938000 -- (-2626.602) (-2628.748) [-2628.516] (-2630.281) * (-2625.388) (-2641.002) (-2627.408) [-2621.458] -- 0:00:25 938500 -- (-2627.902) (-2623.299) (-2627.646) [-2627.464] * [-2632.628] (-2636.673) (-2633.348) (-2628.510) -- 0:00:25 939000 -- (-2629.979) (-2630.298) [-2629.168] (-2636.417) * (-2624.359) [-2626.206] (-2632.433) (-2631.840) -- 0:00:25 939500 -- (-2629.011) (-2626.595) (-2624.753) [-2631.246] * (-2622.525) [-2626.191] (-2624.926) (-2627.647) -- 0:00:24 940000 -- (-2624.980) [-2628.946] (-2638.508) (-2626.250) * (-2628.847) (-2623.084) (-2623.335) [-2628.846] -- 0:00:24 Average standard deviation of split frequencies: 0.000200 940500 -- (-2622.875) [-2619.331] (-2629.152) (-2628.733) * (-2628.683) (-2623.348) [-2626.796] (-2622.574) -- 0:00:24 941000 -- (-2623.409) [-2622.673] (-2629.821) (-2622.145) * (-2628.437) [-2627.975] (-2625.891) (-2631.714) -- 0:00:24 941500 -- (-2624.403) (-2628.006) (-2631.664) [-2625.729] * (-2628.405) (-2635.930) (-2630.876) [-2627.760] -- 0:00:24 942000 -- (-2628.199) (-2624.549) [-2633.598] (-2628.249) * (-2632.068) (-2625.337) [-2625.184] (-2626.951) -- 0:00:23 942500 -- [-2626.956] (-2626.288) (-2628.810) (-2626.300) * (-2630.233) (-2628.454) (-2628.489) [-2626.391] -- 0:00:23 943000 -- (-2636.292) (-2627.810) [-2625.324] (-2633.208) * [-2623.102] (-2625.491) (-2634.224) (-2623.826) -- 0:00:23 943500 -- (-2624.075) (-2629.094) (-2628.349) [-2627.274] * [-2632.430] (-2629.114) (-2628.656) (-2628.949) -- 0:00:23 944000 -- (-2625.482) [-2620.147] (-2628.225) (-2634.527) * [-2622.748] (-2622.557) (-2627.769) (-2630.093) -- 0:00:23 944500 -- (-2628.481) (-2621.258) [-2630.775] (-2630.533) * [-2620.149] (-2626.730) (-2624.228) (-2621.767) -- 0:00:22 945000 -- (-2629.981) (-2627.433) (-2633.618) [-2621.895] * [-2620.809] (-2619.109) (-2624.103) (-2631.305) -- 0:00:22 Average standard deviation of split frequencies: 0.000199 945500 -- [-2628.356] (-2634.790) (-2620.350) (-2625.424) * [-2625.934] (-2623.097) (-2629.072) (-2627.562) -- 0:00:22 946000 -- (-2625.883) (-2629.768) (-2631.792) [-2630.903] * [-2633.123] (-2623.116) (-2629.884) (-2628.452) -- 0:00:22 946500 -- (-2626.921) (-2629.244) [-2620.197] (-2634.223) * [-2629.398] (-2627.996) (-2624.912) (-2631.353) -- 0:00:21 947000 -- (-2624.962) (-2630.246) [-2621.106] (-2627.048) * [-2631.765] (-2625.024) (-2628.702) (-2632.882) -- 0:00:21 947500 -- (-2633.088) (-2623.824) [-2619.189] (-2633.457) * (-2635.583) (-2628.597) [-2627.303] (-2622.908) -- 0:00:21 948000 -- [-2631.247] (-2631.161) (-2626.457) (-2627.802) * (-2632.169) (-2626.740) [-2622.129] (-2627.852) -- 0:00:21 948500 -- (-2635.262) (-2630.586) [-2628.112] (-2622.521) * (-2630.119) [-2625.362] (-2623.414) (-2624.932) -- 0:00:21 949000 -- [-2628.989] (-2627.385) (-2628.170) (-2628.127) * (-2635.484) [-2619.003] (-2631.188) (-2623.838) -- 0:00:20 949500 -- (-2635.157) (-2634.368) [-2629.349] (-2627.563) * (-2637.916) (-2625.671) (-2629.889) [-2620.625] -- 0:00:20 950000 -- [-2625.800] (-2622.692) (-2633.792) (-2623.604) * (-2651.893) (-2627.652) [-2629.220] (-2636.892) -- 0:00:20 Average standard deviation of split frequencies: 0.000198 950500 -- (-2631.646) (-2622.243) (-2624.807) [-2621.390] * (-2638.368) [-2625.879] (-2626.695) (-2624.294) -- 0:00:20 951000 -- [-2630.005] (-2630.866) (-2626.157) (-2625.610) * [-2626.886] (-2622.259) (-2626.719) (-2632.304) -- 0:00:20 951500 -- (-2629.770) (-2625.674) [-2626.829] (-2624.675) * (-2626.193) [-2622.674] (-2623.932) (-2624.376) -- 0:00:19 952000 -- (-2631.285) (-2638.344) [-2638.214] (-2625.818) * (-2621.889) (-2628.691) (-2622.058) [-2622.078] -- 0:00:19 952500 -- (-2627.911) [-2627.235] (-2624.619) (-2630.112) * (-2626.459) (-2623.313) (-2632.531) [-2623.339] -- 0:00:19 953000 -- (-2622.826) (-2628.290) [-2622.665] (-2627.127) * (-2629.414) (-2624.273) (-2632.815) [-2622.576] -- 0:00:19 953500 -- [-2627.741] (-2626.336) (-2631.486) (-2627.073) * [-2623.611] (-2628.863) (-2633.257) (-2625.400) -- 0:00:19 954000 -- (-2623.807) [-2625.001] (-2632.315) (-2629.704) * (-2623.234) (-2630.727) (-2635.993) [-2629.724] -- 0:00:18 954500 -- (-2628.837) (-2625.710) (-2626.514) [-2622.184] * (-2623.723) [-2628.339] (-2628.853) (-2633.150) -- 0:00:18 955000 -- (-2621.949) [-2623.619] (-2637.963) (-2628.345) * (-2630.892) (-2628.573) (-2624.920) [-2625.582] -- 0:00:18 Average standard deviation of split frequencies: 0.000197 955500 -- [-2628.430] (-2629.825) (-2625.641) (-2628.742) * [-2625.467] (-2627.246) (-2633.259) (-2632.630) -- 0:00:18 956000 -- (-2626.884) (-2630.166) [-2627.130] (-2626.101) * (-2620.379) (-2638.886) [-2625.467] (-2627.278) -- 0:00:18 956500 -- (-2630.134) (-2628.442) [-2628.208] (-2624.976) * (-2625.772) (-2633.214) (-2623.214) [-2624.350] -- 0:00:17 957000 -- [-2624.151] (-2636.592) (-2637.565) (-2626.190) * (-2617.991) (-2627.813) [-2624.714] (-2630.909) -- 0:00:17 957500 -- [-2618.644] (-2629.381) (-2632.175) (-2628.959) * (-2627.248) [-2628.311] (-2626.564) (-2621.833) -- 0:00:17 958000 -- (-2621.399) (-2626.894) [-2625.999] (-2632.248) * [-2624.921] (-2626.897) (-2633.301) (-2620.393) -- 0:00:17 958500 -- (-2623.547) (-2630.354) [-2621.019] (-2622.598) * (-2632.759) (-2630.607) (-2630.868) [-2625.530] -- 0:00:17 959000 -- (-2635.534) (-2634.930) (-2630.893) [-2619.778] * (-2637.207) (-2621.842) [-2628.515] (-2627.557) -- 0:00:16 959500 -- (-2632.089) (-2624.977) (-2621.076) [-2629.741] * (-2630.738) [-2623.569] (-2632.473) (-2627.136) -- 0:00:16 960000 -- (-2629.513) (-2627.732) (-2625.010) [-2624.197] * (-2623.329) [-2618.702] (-2631.244) (-2628.554) -- 0:00:16 Average standard deviation of split frequencies: 0.000196 960500 -- [-2629.208] (-2624.872) (-2624.189) (-2628.236) * (-2626.923) (-2627.237) [-2625.324] (-2634.137) -- 0:00:16 961000 -- [-2624.896] (-2631.627) (-2624.090) (-2626.314) * (-2626.095) (-2632.778) [-2626.169] (-2628.473) -- 0:00:16 961500 -- (-2630.190) [-2622.646] (-2624.310) (-2626.968) * (-2629.894) [-2631.279] (-2625.920) (-2626.861) -- 0:00:15 962000 -- [-2623.189] (-2639.275) (-2622.340) (-2628.756) * (-2625.681) (-2627.028) [-2630.027] (-2628.165) -- 0:00:15 962500 -- (-2622.459) [-2622.970] (-2629.914) (-2628.008) * (-2628.144) [-2624.686] (-2622.303) (-2621.597) -- 0:00:15 963000 -- [-2620.171] (-2624.986) (-2634.339) (-2630.037) * (-2623.417) (-2624.851) (-2624.499) [-2621.983] -- 0:00:15 963500 -- (-2628.906) (-2630.790) [-2634.641] (-2624.902) * (-2623.975) (-2628.841) (-2625.275) [-2625.242] -- 0:00:15 964000 -- (-2626.652) (-2621.381) [-2625.297] (-2626.979) * [-2626.147] (-2632.888) (-2639.311) (-2632.299) -- 0:00:14 964500 -- (-2630.147) (-2634.779) (-2627.642) [-2622.808] * (-2629.201) (-2631.142) [-2632.161] (-2626.701) -- 0:00:14 965000 -- (-2628.119) (-2624.991) [-2622.959] (-2621.888) * (-2626.511) (-2623.455) (-2629.250) [-2621.038] -- 0:00:14 Average standard deviation of split frequencies: 0.000195 965500 -- (-2630.726) [-2626.801] (-2627.817) (-2623.192) * [-2626.090] (-2621.577) (-2626.742) (-2623.178) -- 0:00:14 966000 -- (-2631.290) [-2626.134] (-2625.372) (-2624.631) * (-2628.747) (-2623.948) (-2631.117) [-2626.330] -- 0:00:13 966500 -- (-2642.593) (-2630.219) [-2628.613] (-2623.659) * [-2627.209] (-2628.883) (-2627.613) (-2623.307) -- 0:00:13 967000 -- (-2626.129) [-2623.778] (-2626.547) (-2625.060) * (-2627.395) (-2637.728) [-2626.525] (-2626.230) -- 0:00:13 967500 -- [-2629.376] (-2626.679) (-2628.469) (-2623.107) * (-2629.445) (-2632.910) [-2623.037] (-2626.251) -- 0:00:13 968000 -- (-2626.422) (-2624.221) (-2631.523) [-2622.141] * (-2624.992) (-2631.006) (-2629.470) [-2624.275] -- 0:00:13 968500 -- (-2630.724) [-2624.862] (-2624.815) (-2626.217) * [-2628.216] (-2628.899) (-2630.988) (-2626.563) -- 0:00:12 969000 -- [-2625.556] (-2628.315) (-2633.082) (-2627.456) * (-2623.578) (-2631.875) [-2625.520] (-2623.663) -- 0:00:12 969500 -- [-2630.072] (-2628.818) (-2636.024) (-2632.577) * [-2626.381] (-2622.920) (-2626.307) (-2624.429) -- 0:00:12 970000 -- (-2625.011) (-2620.772) [-2626.753] (-2626.392) * (-2622.940) [-2621.222] (-2623.857) (-2620.221) -- 0:00:12 Average standard deviation of split frequencies: 0.000194 970500 -- [-2624.695] (-2631.885) (-2639.067) (-2624.587) * (-2627.070) [-2628.393] (-2635.858) (-2622.895) -- 0:00:12 971000 -- (-2623.435) [-2625.546] (-2628.874) (-2632.947) * (-2629.473) (-2633.032) [-2626.103] (-2626.471) -- 0:00:11 971500 -- [-2624.979] (-2624.894) (-2630.732) (-2626.607) * [-2625.664] (-2624.257) (-2627.393) (-2627.681) -- 0:00:11 972000 -- (-2629.159) [-2623.002] (-2628.518) (-2630.288) * (-2628.519) (-2629.214) (-2624.791) [-2621.603] -- 0:00:11 972500 -- [-2629.653] (-2622.477) (-2628.821) (-2630.889) * (-2631.623) (-2631.662) [-2625.117] (-2618.207) -- 0:00:11 973000 -- [-2621.411] (-2627.304) (-2621.015) (-2624.063) * [-2624.766] (-2623.273) (-2624.968) (-2627.359) -- 0:00:11 973500 -- (-2628.077) (-2638.689) [-2623.573] (-2626.887) * [-2623.054] (-2625.065) (-2628.111) (-2625.044) -- 0:00:10 974000 -- (-2631.504) (-2628.101) (-2623.947) [-2623.743] * (-2624.402) (-2625.645) (-2626.297) [-2622.314] -- 0:00:10 974500 -- (-2627.554) [-2623.779] (-2624.398) (-2627.756) * (-2629.961) [-2620.709] (-2630.778) (-2633.407) -- 0:00:10 975000 -- (-2631.587) [-2624.465] (-2628.015) (-2629.397) * (-2625.289) (-2622.342) (-2620.539) [-2625.846] -- 0:00:10 Average standard deviation of split frequencies: 0.000193 975500 -- (-2628.717) (-2630.761) (-2633.129) [-2626.945] * (-2640.694) [-2626.181] (-2632.127) (-2629.934) -- 0:00:10 976000 -- (-2625.653) (-2631.466) (-2632.818) [-2619.671] * (-2628.079) (-2630.190) [-2624.102] (-2624.584) -- 0:00:09 976500 -- (-2630.896) (-2625.353) (-2630.331) [-2622.897] * (-2623.930) (-2627.014) [-2627.025] (-2633.903) -- 0:00:09 977000 -- (-2626.025) [-2625.050] (-2624.377) (-2629.027) * (-2625.188) (-2621.464) [-2630.171] (-2624.359) -- 0:00:09 977500 -- (-2628.816) (-2622.988) [-2622.659] (-2624.188) * (-2630.170) (-2637.394) [-2628.382] (-2628.598) -- 0:00:09 978000 -- (-2623.670) [-2624.533] (-2627.992) (-2621.516) * [-2624.376] (-2629.819) (-2633.000) (-2621.872) -- 0:00:09 978500 -- (-2624.452) [-2629.899] (-2628.847) (-2629.711) * (-2622.375) (-2622.071) (-2634.485) [-2622.934] -- 0:00:08 979000 -- [-2623.213] (-2623.523) (-2629.489) (-2627.776) * [-2630.064] (-2622.931) (-2631.457) (-2625.444) -- 0:00:08 979500 -- [-2625.815] (-2629.990) (-2627.174) (-2619.830) * [-2633.818] (-2625.306) (-2632.697) (-2628.018) -- 0:00:08 980000 -- (-2633.116) (-2640.400) (-2628.592) [-2625.200] * (-2629.147) (-2627.816) (-2631.165) [-2625.442] -- 0:00:08 Average standard deviation of split frequencies: 0.000192 980500 -- (-2628.219) (-2626.421) (-2621.932) [-2630.899] * (-2623.284) [-2623.996] (-2630.433) (-2622.711) -- 0:00:08 981000 -- (-2623.127) [-2626.132] (-2630.206) (-2623.839) * (-2628.570) (-2626.589) (-2625.057) [-2621.810] -- 0:00:07 981500 -- (-2625.506) (-2623.367) (-2624.691) [-2625.344] * (-2626.110) (-2637.507) [-2624.834] (-2623.900) -- 0:00:07 982000 -- [-2626.769] (-2627.596) (-2633.926) (-2627.316) * (-2626.860) (-2633.620) [-2626.502] (-2628.224) -- 0:00:07 982500 -- [-2627.788] (-2626.018) (-2629.313) (-2629.555) * [-2625.909] (-2634.542) (-2624.640) (-2638.530) -- 0:00:07 983000 -- (-2632.155) (-2621.724) [-2621.932] (-2633.644) * [-2624.907] (-2632.216) (-2628.003) (-2628.570) -- 0:00:06 983500 -- [-2628.222] (-2623.475) (-2619.163) (-2626.441) * (-2625.153) (-2629.239) [-2632.008] (-2619.314) -- 0:00:06 984000 -- [-2628.404] (-2626.320) (-2624.411) (-2626.790) * [-2629.942] (-2621.540) (-2627.228) (-2626.915) -- 0:00:06 984500 -- (-2624.092) (-2631.395) (-2628.061) [-2620.139] * (-2634.895) [-2622.997] (-2624.530) (-2624.108) -- 0:00:06 985000 -- (-2621.937) (-2625.926) (-2630.383) [-2628.771] * (-2636.692) [-2627.989] (-2625.876) (-2620.337) -- 0:00:06 Average standard deviation of split frequencies: 0.000191 985500 -- (-2626.268) (-2633.748) [-2622.792] (-2626.017) * (-2624.943) (-2624.994) [-2629.703] (-2623.690) -- 0:00:05 986000 -- (-2626.562) (-2624.928) (-2633.688) [-2627.573] * (-2630.932) [-2630.967] (-2629.116) (-2622.185) -- 0:00:05 986500 -- (-2631.320) [-2622.863] (-2628.918) (-2629.910) * (-2630.205) [-2625.072] (-2636.461) (-2629.590) -- 0:00:05 987000 -- (-2626.256) (-2619.664) [-2631.136] (-2629.480) * [-2628.879] (-2626.564) (-2626.192) (-2630.136) -- 0:00:05 987500 -- (-2622.895) (-2626.210) [-2626.611] (-2625.479) * (-2633.162) (-2629.170) [-2626.729] (-2621.554) -- 0:00:05 988000 -- (-2623.093) (-2622.106) [-2623.910] (-2635.573) * [-2625.191] (-2627.155) (-2630.530) (-2632.988) -- 0:00:04 988500 -- (-2626.225) (-2631.917) (-2627.712) [-2626.278] * [-2626.929] (-2625.594) (-2628.647) (-2624.169) -- 0:00:04 989000 -- (-2627.557) (-2628.388) (-2630.499) [-2624.580] * (-2626.067) (-2632.058) [-2623.918] (-2627.407) -- 0:00:04 989500 -- (-2623.307) [-2627.458] (-2626.859) (-2634.735) * (-2625.595) [-2624.171] (-2627.545) (-2636.439) -- 0:00:04 990000 -- (-2627.117) [-2635.135] (-2630.549) (-2637.876) * (-2624.156) (-2629.232) [-2618.855] (-2630.506) -- 0:00:04 Average standard deviation of split frequencies: 0.000190 990500 -- (-2631.985) [-2621.459] (-2622.290) (-2630.335) * (-2626.566) (-2638.272) [-2619.280] (-2634.760) -- 0:00:03 991000 -- (-2638.800) (-2618.223) [-2622.284] (-2629.549) * [-2619.723] (-2636.161) (-2631.790) (-2625.366) -- 0:00:03 991500 -- (-2627.768) [-2628.335] (-2626.335) (-2634.615) * (-2631.072) [-2623.948] (-2630.671) (-2627.902) -- 0:00:03 992000 -- (-2626.463) (-2623.684) (-2627.807) [-2640.205] * (-2623.807) (-2626.463) [-2632.314] (-2635.122) -- 0:00:03 992500 -- (-2628.904) (-2631.180) [-2623.261] (-2633.513) * [-2630.233] (-2633.999) (-2622.405) (-2628.916) -- 0:00:03 993000 -- (-2624.230) (-2621.055) [-2632.372] (-2633.149) * [-2623.731] (-2635.794) (-2630.113) (-2632.622) -- 0:00:02 993500 -- (-2627.389) [-2621.265] (-2635.255) (-2627.823) * (-2625.935) (-2631.062) (-2629.662) [-2623.084] -- 0:00:02 994000 -- (-2624.344) (-2627.395) [-2630.805] (-2625.202) * (-2629.623) [-2625.545] (-2634.759) (-2633.028) -- 0:00:02 994500 -- (-2625.362) (-2633.974) [-2622.492] (-2627.576) * (-2627.332) (-2628.574) [-2625.785] (-2632.125) -- 0:00:02 995000 -- (-2629.132) (-2624.116) (-2632.853) [-2627.002] * (-2628.446) (-2630.274) (-2625.103) [-2623.244] -- 0:00:02 Average standard deviation of split frequencies: 0.000189 995500 -- [-2628.850] (-2632.079) (-2628.950) (-2631.629) * (-2630.775) [-2624.411] (-2629.240) (-2623.746) -- 0:00:01 996000 -- (-2625.815) (-2626.336) [-2627.637] (-2630.910) * [-2629.233] (-2624.994) (-2626.083) (-2626.628) -- 0:00:01 996500 -- (-2632.843) (-2630.228) [-2621.013] (-2622.791) * (-2621.919) (-2625.261) (-2622.661) [-2628.700] -- 0:00:01 997000 -- (-2624.698) [-2625.073] (-2624.733) (-2622.601) * [-2623.680] (-2622.900) (-2626.303) (-2622.920) -- 0:00:01 997500 -- [-2620.237] (-2621.309) (-2626.589) (-2622.647) * (-2632.305) (-2629.806) (-2625.203) [-2620.289] -- 0:00:01 998000 -- (-2624.313) (-2626.197) (-2627.936) [-2628.678] * (-2624.217) [-2635.368] (-2620.934) (-2628.301) -- 0:00:00 998500 -- [-2629.577] (-2630.545) (-2625.169) (-2628.913) * (-2637.506) (-2628.997) (-2621.682) [-2620.455] -- 0:00:00 999000 -- (-2629.741) (-2630.739) [-2628.977] (-2625.980) * (-2635.166) (-2628.793) [-2621.583] (-2636.895) -- 0:00:00 999500 -- (-2626.021) (-2632.481) (-2622.889) [-2628.759] * (-2631.790) (-2632.328) (-2628.158) [-2628.275] -- 0:00:00 1000000 -- (-2629.052) [-2628.156] (-2625.031) (-2630.484) * (-2629.153) [-2624.740] (-2630.544) (-2630.061) -- 0:00:00 Average standard deviation of split frequencies: 0.000188 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2629.052177 -- 12.642433 Chain 1 -- -2629.052156 -- 12.642433 Chain 2 -- -2628.156179 -- 16.188856 Chain 2 -- -2628.156181 -- 16.188856 Chain 3 -- -2625.031055 -- 17.027282 Chain 3 -- -2625.031060 -- 17.027282 Chain 4 -- -2630.483936 -- 19.616987 Chain 4 -- -2630.483926 -- 19.616987 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2629.152848 -- 14.574563 Chain 1 -- -2629.152856 -- 14.574563 Chain 2 -- -2624.740187 -- 16.465068 Chain 2 -- -2624.740188 -- 16.465068 Chain 3 -- -2630.544496 -- 12.814584 Chain 3 -- -2630.544493 -- 12.814584 Chain 4 -- -2630.061116 -- 13.532284 Chain 4 -- -2630.061136 -- 13.532284 Analysis completed in 6 mins 51 seconds Analysis used 410.99 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2615.13 Likelihood of best state for "cold" chain of run 2 was -2615.25 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 42.0 % ( 31 %) Dirichlet(Revmat{all}) 56.8 % ( 42 %) Slider(Revmat{all}) 25.6 % ( 34 %) Dirichlet(Pi{all}) 26.7 % ( 19 %) Slider(Pi{all}) 34.1 % ( 35 %) Multiplier(Alpha{1,2}) 44.0 % ( 23 %) Multiplier(Alpha{3}) 57.7 % ( 31 %) Slider(Pinvar{all}) 0.0 % ( 0 %) ExtSPR(Tau{all},V{all}) 0.0 % ( 0 %) ExtTBR(Tau{all},V{all}) 0.0 % ( 1 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 26.1 % ( 26 %) Multiplier(V{all}) 30.2 % ( 18 %) Nodeslider(V{all}) 25.2 % ( 33 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 41.6 % ( 33 %) Dirichlet(Revmat{all}) 56.3 % ( 39 %) Slider(Revmat{all}) 25.1 % ( 24 %) Dirichlet(Pi{all}) 27.5 % ( 24 %) Slider(Pi{all}) 34.3 % ( 24 %) Multiplier(Alpha{1,2}) 44.1 % ( 22 %) Multiplier(Alpha{3}) 57.6 % ( 27 %) Slider(Pinvar{all}) 0.0 % ( 0 %) ExtSPR(Tau{all},V{all}) 0.0 % ( 0 %) ExtTBR(Tau{all},V{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 26.1 % ( 26 %) Multiplier(V{all}) 30.1 % ( 35 %) Nodeslider(V{all}) 25.4 % ( 25 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166514 0.83 0.67 3 | 166397 166680 0.84 4 | 167171 166255 166983 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166951 0.82 0.66 3 | 166896 166672 0.83 4 | 166426 166472 166583 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2623.86 | 1 1 2 | | 2 1 1 1 2 | | 2 1 | | 2 21 211 2 1 1 1 2 2 1 | |2 1 12 1 2 1 2 22 1 2 2| |1 22 1 2 * 1 * 1 11 2 2 2 1 1 1 | | 2 2 222 2 2 1 2 1 1 | | 111 2 12 2 2 2 11 11 22 | | 2 2 1 11 *1 22 2 2 | | 1 1 2 12 | | 1 * 22 2 12 1 | | 12 1 21 | | 2 1 1 2 21| | | | 1 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2627.58 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2621.36 -2634.89 2 -2621.59 -2637.33 -------------------------------------- TOTAL -2621.47 -2636.72 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.779663 0.006734 0.629642 0.943847 0.773218 1203.55 1352.28 1.001 r(A<->C){all} 0.086651 0.000400 0.051370 0.128583 0.085229 1218.04 1230.31 1.000 r(A<->G){all} 0.238300 0.001321 0.173523 0.312639 0.235503 614.91 777.70 1.000 r(A<->T){all} 0.197501 0.001655 0.120352 0.277447 0.195508 929.44 932.23 1.000 r(C<->G){all} 0.044300 0.000146 0.020022 0.067380 0.043567 961.68 1064.80 1.000 r(C<->T){all} 0.324947 0.001799 0.242997 0.409177 0.323865 889.23 944.60 1.000 r(G<->T){all} 0.108302 0.000646 0.062211 0.160564 0.106249 673.98 728.17 1.000 pi(A){all} 0.221604 0.000168 0.196999 0.247555 0.221297 1155.00 1307.61 1.000 pi(C){all} 0.329344 0.000222 0.302974 0.360473 0.329315 1342.36 1359.13 1.000 pi(G){all} 0.278205 0.000209 0.252199 0.307758 0.277970 1081.96 1119.08 1.000 pi(T){all} 0.170846 0.000137 0.147577 0.192946 0.170569 936.55 1014.05 1.000 alpha{1,2} 0.134058 0.001498 0.052669 0.210920 0.134628 1108.09 1192.13 1.000 alpha{3} 2.319434 0.740613 1.004297 4.143426 2.182697 989.25 1180.87 1.000 pinvar{all} 0.188331 0.008083 0.004948 0.336468 0.192165 996.61 1205.45 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 8 -- C8 Key to taxon bipartitions (saved to file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition -------------- 1 -- .******* 2 -- .*...... 3 -- ..*..... 4 -- ...*.... 5 -- ....*... 6 -- .....*.. 7 -- ......*. 8 -- .......* 9 -- .**..... 10 -- ...**... 11 -- .....**. 12 -- ...***** 13 -- .....*** -------------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 9 3002 1.000000 0.000000 1.000000 1.000000 2 10 3002 1.000000 0.000000 1.000000 1.000000 2 11 3002 1.000000 0.000000 1.000000 1.000000 2 12 3001 0.999667 0.000471 0.999334 1.000000 2 13 3001 0.999667 0.000471 0.999334 1.000000 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.020045 0.000051 0.007818 0.034597 0.019284 1.000 2 length{all}[2] 0.022135 0.000043 0.010077 0.034984 0.021529 1.000 2 length{all}[3] 0.003048 0.000006 0.000002 0.008029 0.002433 1.000 2 length{all}[4] 0.045846 0.000133 0.025658 0.070179 0.044651 1.000 2 length{all}[5] 0.047658 0.000141 0.027445 0.072905 0.046506 1.001 2 length{all}[6] 0.089390 0.000432 0.052094 0.132606 0.087971 1.001 2 length{all}[7] 0.041350 0.000234 0.013806 0.072646 0.040133 1.000 2 length{all}[8] 0.184283 0.001270 0.116507 0.253457 0.181068 1.000 2 length{all}[9] 0.016034 0.000044 0.004444 0.029176 0.015460 1.000 2 length{all}[10] 0.043695 0.000227 0.016594 0.073364 0.042099 1.000 2 length{all}[11] 0.137290 0.001069 0.073908 0.198079 0.135444 1.000 2 length{all}[12] 0.049731 0.000225 0.022488 0.079274 0.048783 1.000 2 length{all}[13] 0.079193 0.000639 0.033936 0.128770 0.076887 1.001 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.000188 Maximum standard deviation of split frequencies = 0.000471 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------ C2 (2) |-------------------------100-------------------------+ | \------------------ C3 (3) + | /------------------ C4 (4) | /----------------100----------------+ | | \------------------ C5 (5) | | \-------100-------+ /------------------ C6 (6) | /-------100-------+ | | \------------------ C7 (7) \-------100-------+ \------------------------------------ C8 (8) Phylogram (based on average branch lengths): /---- C1 (1) | | /----- C2 (2) |--+ | \- C3 (3) + | /--------- C4 (4) | /--------+ | | \--------- C5 (5) | | \---------+ /------------------ C6 (6) | /---------------------------+ | | \-------- C7 (7) \---------------+ \------------------------------------- C8 (8) |---------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (3 trees sampled): 99 % credible set contains 1 tree Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 8 ls = 870 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Reading seq # 7: C7 Reading seq # 8: C8 Sites with gaps or missing data are removed. 84 ambiguity characters in seq. 1 84 ambiguity characters in seq. 2 84 ambiguity characters in seq. 3 75 ambiguity characters in seq. 4 75 ambiguity characters in seq. 5 63 ambiguity characters in seq. 6 96 ambiguity characters in seq. 7 48 ambiguity characters in seq. 8 35 sites are removed. 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 Sequences read.. Counting site patterns.. 0:00 179 patterns at 255 / 255 sites (100.0%), 0:00 Counting codons.. 224 bytes for distance 174704 bytes for conP 24344 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (2, 3), ((4, 5), ((6, 7), 8))); MP score: 263 524112 bytes for conP, adjusted 0.040710 0.029516 0.042370 0.005486 0.069289 0.071813 0.073807 0.090286 0.076185 0.151990 0.122422 0.088877 0.327233 0.300000 1.300000 ntime & nrate & np: 13 2 15 Bounds (np=15): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 15 lnL0 = -2688.008607 Iterating by ming2 Initial: fx= 2688.008607 x= 0.04071 0.02952 0.04237 0.00549 0.06929 0.07181 0.07381 0.09029 0.07619 0.15199 0.12242 0.08888 0.32723 0.30000 1.30000 1 h-m-p 0.0000 0.0001 376.8574 ++ 2681.059613 m 0.0001 20 | 0/15 2 h-m-p 0.0000 0.0000 10214.1058 ++ 2609.590665 m 0.0000 38 | 0/15 3 h-m-p 0.0000 0.0000 15964.1913 +YYCCC 2582.550724 4 0.0000 63 | 0/15 4 h-m-p 0.0002 0.0017 1876.7473 YYCCCC 2550.713419 5 0.0003 89 | 0/15 5 h-m-p 0.0002 0.0008 475.6872 +YYYYYYYYYC 2500.745040 10 0.0006 118 | 0/15 6 h-m-p 0.0000 0.0000 1970.0128 +YYCCCC 2493.907489 5 0.0000 145 | 0/15 7 h-m-p 0.0001 0.0004 670.0702 +YYCCCC 2476.239953 5 0.0002 172 | 0/15 8 h-m-p 0.0002 0.0010 601.1085 +YYYYCCCC 2416.275063 7 0.0007 201 | 0/15 9 h-m-p 0.0000 0.0001 1283.1419 CCCCC 2413.169425 4 0.0000 227 | 0/15 10 h-m-p 0.0004 0.0019 60.6477 YC 2412.779131 1 0.0002 246 | 0/15 11 h-m-p 0.0005 0.0056 31.1203 CYC 2412.560172 2 0.0005 267 | 0/15 12 h-m-p 0.0001 0.0013 195.6030 CYC 2412.309667 2 0.0001 288 | 0/15 13 h-m-p 0.0025 0.0143 7.6367 YCCC 2412.175128 3 0.0017 311 | 0/15 14 h-m-p 0.0017 0.0575 7.5212 +CCC 2410.565888 2 0.0095 334 | 0/15 15 h-m-p 0.0030 0.0148 16.1689 YCCCCC 2403.356590 5 0.0065 361 | 0/15 16 h-m-p 0.0014 0.0072 46.1213 YCCCCC 2389.616020 5 0.0031 388 | 0/15 17 h-m-p 0.2307 1.1533 0.1637 YCCCC 2381.242019 4 0.5679 413 | 0/15 18 h-m-p 0.8073 4.0366 0.1135 CYCCC 2373.287380 4 0.9873 453 | 0/15 19 h-m-p 0.6226 3.1131 0.0644 YCYCCC 2365.710308 5 1.6082 494 | 0/15 20 h-m-p 1.6000 8.0000 0.0474 CCCC 2364.608019 3 1.6134 533 | 0/15 21 h-m-p 1.5664 8.0000 0.0488 YC 2363.810152 1 2.9433 567 | 0/15 22 h-m-p 1.4199 7.0995 0.0658 YYC 2363.433536 2 1.2053 602 | 0/15 23 h-m-p 1.6000 8.0000 0.0439 CYC 2363.226669 2 1.7086 638 | 0/15 24 h-m-p 1.6000 8.0000 0.0194 YC 2363.124947 1 3.3857 672 | 0/15 25 h-m-p 1.6000 8.0000 0.0107 C 2363.094072 0 1.5892 705 | 0/15 26 h-m-p 1.6000 8.0000 0.0030 +YC 2363.066265 1 4.3864 740 | 0/15 27 h-m-p 1.6000 8.0000 0.0017 YC 2363.037440 1 3.6503 774 | 0/15 28 h-m-p 1.6000 8.0000 0.0021 CC 2363.021927 1 1.8874 809 | 0/15 29 h-m-p 1.6000 8.0000 0.0009 YC 2363.017593 1 3.1467 843 | 0/15 30 h-m-p 1.2648 8.0000 0.0022 +YC 2363.004252 1 5.9083 878 | 0/15 31 h-m-p 1.6000 8.0000 0.0015 YC 2363.003560 1 1.1866 912 | 0/15 32 h-m-p 1.6000 8.0000 0.0002 ++ 2363.003037 m 8.0000 945 | 0/15 33 h-m-p 0.7273 8.0000 0.0021 YC 2363.002562 1 1.4694 979 | 0/15 34 h-m-p 1.6000 8.0000 0.0002 C 2363.002458 0 2.2396 1012 | 0/15 35 h-m-p 1.5239 8.0000 0.0003 Y 2363.002381 0 3.0571 1045 | 0/15 36 h-m-p 1.6000 8.0000 0.0001 Y 2363.002381 0 1.1454 1078 | 0/15 37 h-m-p 1.6000 8.0000 0.0000 Y 2363.002381 0 3.9878 1111 | 0/15 38 h-m-p 1.6000 8.0000 0.0000 Y 2363.002381 0 3.7827 1144 | 0/15 39 h-m-p 1.6000 8.0000 0.0000 Y 2363.002381 0 1.1236 1177 | 0/15 40 h-m-p 1.1882 8.0000 0.0000 C 2363.002381 0 1.1882 1210 | 0/15 41 h-m-p 1.6000 8.0000 0.0000 C 2363.002381 0 0.4000 1243 | 0/15 42 h-m-p 1.2718 8.0000 0.0000 -------------C 2363.002381 0 0.0000 1289 Out.. lnL = -2363.002381 1290 lfun, 1290 eigenQcodon, 16770 P(t) Time used: 0:07 Model 1: NearlyNeutral TREE # 1 (1, (2, 3), ((4, 5), ((6, 7), 8))); MP score: 263 0.040710 0.029516 0.042370 0.005486 0.069289 0.071813 0.073807 0.090286 0.076185 0.151990 0.122422 0.088877 0.327233 2.269799 0.700642 0.304419 ntime & nrate & np: 13 2 16 Bounds (np=16): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 6.576996 np = 16 lnL0 = -2417.940085 Iterating by ming2 Initial: fx= 2417.940085 x= 0.04071 0.02952 0.04237 0.00549 0.06929 0.07181 0.07381 0.09029 0.07619 0.15199 0.12242 0.08888 0.32723 2.26980 0.70064 0.30442 1 h-m-p 0.0000 0.0001 276.1758 ++ 2412.259453 m 0.0001 21 | 0/16 2 h-m-p -0.0000 -0.0000 6851.3694 h-m-p: -4.87335329e-20 -2.43667665e-19 6.85136937e+03 2412.259453 .. | 0/16 3 h-m-p 0.0000 0.0013 2475.4561 YYCYCCC 2410.572531 6 0.0000 65 | 0/16 4 h-m-p 0.0000 0.0013 270.2768 +++YYYYCCC 2334.808514 6 0.0011 95 | 0/16 5 h-m-p 0.0002 0.0011 91.1490 CCCCC 2333.659387 4 0.0003 122 | 0/16 6 h-m-p 0.0003 0.0021 77.2448 CCC 2332.969553 2 0.0004 145 | 0/16 7 h-m-p 0.0010 0.0098 26.9715 YC 2332.825563 1 0.0005 165 | 0/16 8 h-m-p 0.0015 0.0271 8.6753 YCC 2332.782804 2 0.0012 187 | 0/16 9 h-m-p 0.0008 0.0093 13.0847 YC 2332.761590 1 0.0005 207 | 0/16 10 h-m-p 0.0006 0.0425 9.9731 C 2332.744407 0 0.0006 226 | 0/16 11 h-m-p 0.0010 0.0141 6.6486 YC 2332.735639 1 0.0005 246 | 0/16 12 h-m-p 0.0006 0.0823 6.1704 +CC 2332.684060 1 0.0035 268 | 0/16 13 h-m-p 0.0008 0.0235 28.3588 +YC 2332.548815 1 0.0019 289 | 0/16 14 h-m-p 0.0010 0.0218 52.2911 YC 2332.281615 1 0.0021 309 | 0/16 15 h-m-p 0.0055 0.0276 15.4329 YC 2332.256417 1 0.0007 329 | 0/16 16 h-m-p 0.0105 0.1839 1.0986 YC 2332.254216 1 0.0020 349 | 0/16 17 h-m-p 0.0014 0.5297 1.5359 ++CC 2332.212260 1 0.0277 372 | 0/16 18 h-m-p 0.0013 0.0369 34.0512 YCC 2332.138122 2 0.0022 394 | 0/16 19 h-m-p 0.1537 0.7687 0.2585 --C 2332.137949 0 0.0029 415 | 0/16 20 h-m-p 0.0777 8.0000 0.0096 +YC 2332.112038 1 0.5228 452 | 0/16 21 h-m-p 1.5641 8.0000 0.0032 CC 2332.103611 1 2.4652 489 | 0/16 22 h-m-p 1.6000 8.0000 0.0011 YC 2332.087010 1 3.7171 525 | 0/16 23 h-m-p 1.6000 8.0000 0.0021 YC 2332.085345 1 1.0180 561 | 0/16 24 h-m-p 1.6000 8.0000 0.0008 Y 2332.085329 0 0.9016 596 | 0/16 25 h-m-p 1.6000 8.0000 0.0000 Y 2332.085329 0 1.0064 631 | 0/16 26 h-m-p 1.6000 8.0000 0.0000 -------Y 2332.085329 0 0.0000 673 Out.. lnL = -2332.085329 674 lfun, 2022 eigenQcodon, 17524 P(t) Time used: 0:14 Model 2: PositiveSelection TREE # 1 (1, (2, 3), ((4, 5), ((6, 7), 8))); MP score: 263 initial w for M2:NSpselection reset. 0.040710 0.029516 0.042370 0.005486 0.069289 0.071813 0.073807 0.090286 0.076185 0.151990 0.122422 0.088877 0.327233 2.361394 0.878998 0.263736 0.186073 2.329016 ntime & nrate & np: 13 3 18 Bounds (np=18): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.439606 np = 18 lnL0 = -2444.816560 Iterating by ming2 Initial: fx= 2444.816560 x= 0.04071 0.02952 0.04237 0.00549 0.06929 0.07181 0.07381 0.09029 0.07619 0.15199 0.12242 0.08888 0.32723 2.36139 0.87900 0.26374 0.18607 2.32902 1 h-m-p 0.0000 0.0003 286.0553 +++ 2429.409035 m 0.0003 24 | 0/18 2 h-m-p 0.0000 0.0000 6523.5994 +YCYCCC 2400.896684 5 0.0000 54 | 0/18 3 h-m-p 0.0000 0.0001 176.9391 ++ 2398.488523 m 0.0001 75 | 0/18 4 h-m-p 0.0001 0.0024 193.4422 +YCCCCC 2387.149397 5 0.0011 106 | 0/18 5 h-m-p 0.0008 0.0042 130.5068 YCCC 2381.883391 3 0.0014 132 | 0/18 6 h-m-p 0.0016 0.0104 120.3810 CCCC 2375.187359 3 0.0023 159 | 0/18 7 h-m-p 0.0019 0.0095 68.5234 YCCCC 2370.723827 4 0.0036 187 | 0/18 8 h-m-p 0.0011 0.0055 72.6818 YCCCC 2368.448945 4 0.0021 215 | 0/18 9 h-m-p 0.0025 0.0125 38.3606 YYCC 2367.560731 3 0.0022 240 | 0/18 10 h-m-p 0.0027 0.0217 32.0256 YCC 2367.036645 2 0.0021 264 | 0/18 11 h-m-p 0.0042 0.0288 16.0540 CYC 2366.655275 2 0.0039 288 | 0/18 12 h-m-p 0.0039 0.0582 15.8506 YCCC 2365.890295 3 0.0088 314 | 0/18 13 h-m-p 0.0037 0.0710 37.4717 +CCCCC 2360.693402 4 0.0239 344 | 0/18 14 h-m-p 0.0027 0.0133 265.0687 CCCCC 2355.417640 4 0.0035 373 | 0/18 15 h-m-p 0.0095 0.0473 6.6150 YYC 2355.091752 2 0.0074 396 | 0/18 16 h-m-p 0.0058 0.1613 8.3847 ++YCCCC 2348.631808 4 0.0660 426 | 0/18 17 h-m-p 0.0011 0.0055 168.5688 +YCCCC 2338.080619 4 0.0049 455 | 0/18 18 h-m-p 0.4618 5.7411 1.7873 CYCCC 2335.789352 4 0.3986 483 | 0/18 19 h-m-p 0.4046 2.0229 1.4478 YYCCC 2334.579800 4 0.2890 510 | 0/18 20 h-m-p 0.1397 0.6986 0.6275 YCCC 2333.910095 3 0.3219 536 | 0/18 21 h-m-p 0.1934 2.9630 1.0441 YC 2333.235745 1 0.4606 576 | 0/18 22 h-m-p 0.4356 3.6315 1.1039 YCCC 2332.430851 3 0.8646 602 | 0/18 23 h-m-p 0.9837 5.3215 0.9702 YYCC 2331.841538 3 0.7254 627 | 0/18 24 h-m-p 1.0748 5.3739 0.5299 YC 2331.737243 1 0.4457 667 | 0/18 25 h-m-p 0.5267 8.0000 0.4484 CC 2331.661060 1 0.8334 708 | 0/18 26 h-m-p 0.6798 8.0000 0.5497 YC 2331.629810 1 0.3880 748 | 0/18 27 h-m-p 0.4799 8.0000 0.4445 C 2331.609723 0 0.4794 787 | 0/18 28 h-m-p 0.9210 8.0000 0.2314 CC 2331.599136 1 0.7750 828 | 0/18 29 h-m-p 1.2118 8.0000 0.1480 CC 2331.596379 1 0.4499 869 | 0/18 30 h-m-p 1.6000 8.0000 0.0393 CC 2331.595724 1 0.6071 910 | 0/18 31 h-m-p 1.3485 8.0000 0.0177 YC 2331.595448 1 0.6919 950 | 0/18 32 h-m-p 1.6000 8.0000 0.0044 C 2331.595276 0 1.3765 989 | 0/18 33 h-m-p 0.6039 8.0000 0.0101 +YC 2331.594493 1 4.2710 1030 | 0/18 34 h-m-p 0.6274 8.0000 0.0690 YC 2331.592897 1 1.1348 1070 | 0/18 35 h-m-p 0.6765 8.0000 0.1157 YC 2331.590431 1 1.3075 1110 | 0/18 36 h-m-p 0.8746 8.0000 0.1730 C 2331.588636 0 0.8320 1149 | 0/18 37 h-m-p 1.6000 8.0000 0.0668 YC 2331.588176 1 0.8993 1189 | 0/18 38 h-m-p 1.6000 8.0000 0.0120 Y 2331.588150 0 1.0215 1228 | 0/18 39 h-m-p 1.6000 8.0000 0.0007 Y 2331.588150 0 0.6932 1267 | 0/18 40 h-m-p 1.6000 8.0000 0.0001 Y 2331.588150 0 0.9189 1306 | 0/18 41 h-m-p 1.6000 8.0000 0.0000 C 2331.588150 0 1.6000 1345 | 0/18 42 h-m-p 1.6000 8.0000 0.0000 C 2331.588150 0 0.4000 1384 | 0/18 43 h-m-p 0.7564 8.0000 0.0000 Y 2331.588150 0 0.3421 1423 | 0/18 44 h-m-p 0.4292 8.0000 0.0000 ---------------.. | 0/18 45 h-m-p 0.0160 8.0000 0.0003 ------------Y 2331.588150 0 0.0000 1526 Out.. lnL = -2331.588150 1527 lfun, 6108 eigenQcodon, 59553 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2342.732705 S = -2222.049480 -112.606622 Calculating f(w|X), posterior probabilities of site classes. did 10 / 179 patterns 0:39 did 20 / 179 patterns 0:39 did 30 / 179 patterns 0:39 did 40 / 179 patterns 0:39 did 50 / 179 patterns 0:39 did 60 / 179 patterns 0:39 did 70 / 179 patterns 0:39 did 80 / 179 patterns 0:39 did 90 / 179 patterns 0:40 did 100 / 179 patterns 0:40 did 110 / 179 patterns 0:40 did 120 / 179 patterns 0:40 did 130 / 179 patterns 0:40 did 140 / 179 patterns 0:40 did 150 / 179 patterns 0:40 did 160 / 179 patterns 0:40 did 170 / 179 patterns 0:40 did 179 / 179 patterns 0:40 Time used: 0:40 Model 3: discrete TREE # 1 (1, (2, 3), ((4, 5), ((6, 7), 8))); MP score: 263 0.040710 0.029516 0.042370 0.005486 0.069289 0.071813 0.073807 0.090286 0.076185 0.151990 0.122422 0.088877 0.327233 2.406399 0.062503 0.014820 0.054615 0.127517 0.218802 ntime & nrate & np: 13 4 19 Bounds (np=19): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 12.389010 np = 19 lnL0 = -2357.995652 Iterating by ming2 Initial: fx= 2357.995652 x= 0.04071 0.02952 0.04237 0.00549 0.06929 0.07181 0.07381 0.09029 0.07619 0.15199 0.12242 0.08888 0.32723 2.40640 0.06250 0.01482 0.05461 0.12752 0.21880 1 h-m-p 0.0000 0.0001 190.4564 +CCYYC 2356.365670 4 0.0001 32 | 0/19 2 h-m-p 0.0000 0.0000 1382.7332 ++ 2346.366613 m 0.0000 54 | 1/19 3 h-m-p 0.0002 0.0009 178.3483 +YYC 2340.110497 2 0.0006 79 | 1/19 4 h-m-p 0.0000 0.0001 445.6461 ++ 2338.219617 m 0.0001 101 | 1/19 5 h-m-p 0.0000 0.0000 64.8762 h-m-p: 1.24810808e-19 6.24054040e-19 6.48762140e+01 2338.219617 .. | 1/19 6 h-m-p 0.0000 0.0025 866.1375 CCYC 2337.420725 3 0.0000 148 | 1/19 7 h-m-p 0.0000 0.0024 124.4700 +YYCCC 2336.255571 4 0.0002 177 | 1/19 8 h-m-p 0.0003 0.0016 59.0471 CCCCC 2335.649424 4 0.0004 207 | 1/19 9 h-m-p 0.0002 0.0009 66.3418 YC 2335.168319 1 0.0004 230 | 1/19 10 h-m-p 0.0001 0.0003 31.9274 ++ 2334.997988 m 0.0003 252 | 1/19 11 h-m-p 0.0003 0.0150 31.6783 YCC 2334.857209 2 0.0006 277 | 1/19 12 h-m-p 0.0012 0.0169 16.5220 YC 2334.818162 1 0.0005 300 | 1/19 13 h-m-p 0.0006 0.0038 14.1979 CC 2334.794308 1 0.0005 324 | 1/19 14 h-m-p 0.0013 0.0604 5.3981 C 2334.780643 0 0.0013 346 | 1/19 15 h-m-p 0.0007 0.1903 9.9944 +YCC 2334.709084 2 0.0046 372 | 1/19 16 h-m-p 0.0007 0.0287 70.3371 +CCC 2334.398349 2 0.0028 399 | 1/19 17 h-m-p 0.0015 0.0277 133.9178 YCCC 2333.801670 3 0.0029 426 | 1/19 18 h-m-p 0.0014 0.0201 264.8269 CCC 2333.267048 2 0.0013 452 | 1/19 19 h-m-p 0.0030 0.0150 86.6262 YC 2333.100498 1 0.0013 475 | 1/19 20 h-m-p 0.0049 0.0394 22.3222 CC 2333.059609 1 0.0013 499 | 1/19 21 h-m-p 0.0050 0.1000 5.8300 YC 2333.045588 1 0.0021 522 | 1/19 22 h-m-p 0.0096 4.7920 7.5867 +CYC 2332.694833 2 0.0464 548 | 1/19 23 h-m-p 1.6000 8.0000 0.0922 CCC 2332.192081 2 1.4461 574 | 0/19 24 h-m-p 0.0006 0.0050 225.1414 C 2332.051861 0 0.0002 614 | 0/19 25 h-m-p 0.2551 8.0000 0.1568 +YCCC 2331.726076 3 1.8013 642 | 0/19 26 h-m-p 0.5480 2.7402 0.2565 CYC 2331.634165 2 0.5805 686 | 0/19 27 h-m-p 1.3651 8.0000 0.1091 C 2331.590800 0 1.1563 727 | 0/19 28 h-m-p 1.6000 8.0000 0.0583 CCC 2331.578123 2 2.2995 772 | 0/19 29 h-m-p 1.6000 8.0000 0.0589 +YC 2331.558360 1 4.0583 815 | 0/19 30 h-m-p 1.1773 8.0000 0.2029 YCCC 2331.549784 3 0.6655 861 | 0/19 31 h-m-p 1.6000 8.0000 0.0545 CC 2331.546026 1 0.4528 904 | 0/19 32 h-m-p 0.3248 8.0000 0.0760 +CCC 2331.542399 2 1.7643 950 | 0/19 33 h-m-p 1.6000 8.0000 0.0270 CC 2331.540537 1 1.3133 993 | 0/19 34 h-m-p 0.4469 8.0000 0.0794 YC 2331.539486 1 1.0607 1035 | 0/19 35 h-m-p 1.6000 8.0000 0.0151 C 2331.539311 0 1.3662 1076 | 0/19 36 h-m-p 1.5239 8.0000 0.0136 Y 2331.539284 0 1.0158 1117 | 0/19 37 h-m-p 1.6000 8.0000 0.0003 Y 2331.539283 0 0.9711 1158 | 0/19 38 h-m-p 0.4797 8.0000 0.0006 +Y 2331.539283 0 1.4270 1200 | 0/19 39 h-m-p 1.6000 8.0000 0.0001 Y 2331.539283 0 3.1701 1241 | 0/19 40 h-m-p 1.6000 8.0000 0.0001 Y 2331.539283 0 1.1419 1282 | 0/19 41 h-m-p 1.6000 8.0000 0.0000 +Y 2331.539283 0 4.8766 1324 | 0/19 42 h-m-p 1.2896 8.0000 0.0000 --Y 2331.539283 0 0.0202 1367 | 0/19 43 h-m-p 0.0160 8.0000 0.0001 --C 2331.539283 0 0.0003 1410 Out.. lnL = -2331.539283 1411 lfun, 5644 eigenQcodon, 55029 P(t) Time used: 1:03 Model 7: beta TREE # 1 (1, (2, 3), ((4, 5), ((6, 7), 8))); MP score: 263 0.040710 0.029516 0.042370 0.005486 0.069289 0.071813 0.073807 0.090286 0.076185 0.151990 0.122422 0.088877 0.327233 2.327552 0.942968 1.067294 ntime & nrate & np: 13 1 16 Bounds (np=16): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 6.875181 np = 16 lnL0 = -2408.774438 Iterating by ming2 Initial: fx= 2408.774438 x= 0.04071 0.02952 0.04237 0.00549 0.06929 0.07181 0.07381 0.09029 0.07619 0.15199 0.12242 0.08888 0.32723 2.32755 0.94297 1.06729 1 h-m-p 0.0000 0.0001 165.6049 +YCYCCC 2407.256872 5 0.0001 31 | 0/16 2 h-m-p 0.0000 0.0018 1148.9411 +YYCCC 2402.218902 4 0.0001 57 | 0/16 3 h-m-p 0.0003 0.0016 170.3694 +YYCCCC 2391.339266 5 0.0011 85 | 0/16 4 h-m-p 0.0002 0.0008 620.5636 +YYYCCC 2370.392495 5 0.0006 112 | 0/16 5 h-m-p 0.0000 0.0001 4990.5063 +YYCCC 2358.232908 4 0.0000 138 | 0/16 6 h-m-p 0.0000 0.0002 1500.3249 CCCCC 2354.744177 4 0.0001 165 | 0/16 7 h-m-p 0.0013 0.0064 46.7754 CCCC 2353.528092 3 0.0013 190 | 0/16 8 h-m-p 0.0012 0.0191 52.2982 +YYYC 2349.930269 3 0.0047 213 | 0/16 9 h-m-p 0.0033 0.0188 73.7463 CCC 2346.346908 2 0.0045 236 | 0/16 10 h-m-p 0.0013 0.0065 105.5400 YCCC 2345.721457 3 0.0006 260 | 0/16 11 h-m-p 0.0012 0.0090 53.3025 CYC 2345.202046 2 0.0011 282 | 0/16 12 h-m-p 0.0051 0.0311 11.5965 CCC 2345.141611 2 0.0011 305 | 0/16 13 h-m-p 0.0040 0.0862 3.1864 YC 2345.109492 1 0.0030 325 | 0/16 14 h-m-p 0.0047 0.2425 2.0193 +YC 2344.596206 1 0.0307 346 | 0/16 15 h-m-p 0.0021 0.0269 30.2451 +CCCCC 2341.096719 4 0.0101 374 | 0/16 16 h-m-p 0.0013 0.0067 103.2493 CCCCC 2339.043094 4 0.0018 401 | 0/16 17 h-m-p 0.0508 0.7090 3.6909 YCCC 2337.099344 3 0.1152 425 | 0/16 18 h-m-p 0.3964 1.9818 0.4755 YCCC 2335.933957 3 0.2627 449 | 0/16 19 h-m-p 0.7466 8.0000 0.1673 YCCC 2335.387340 3 1.1648 489 | 0/16 20 h-m-p 1.2032 8.0000 0.1620 CCCC 2334.758662 3 1.8129 530 | 0/16 21 h-m-p 0.6405 3.9713 0.4585 +YYCCCC 2332.564358 5 1.9746 574 | 0/16 22 h-m-p 1.6000 8.0000 0.1071 YCCC 2332.306843 3 0.9040 614 | 0/16 23 h-m-p 0.5819 8.0000 0.1664 YCC 2332.239383 2 0.3795 652 | 0/16 24 h-m-p 1.6000 8.0000 0.0198 YC 2332.206601 1 1.2475 688 | 0/16 25 h-m-p 0.3253 8.0000 0.0761 YC 2332.188558 1 0.6261 724 | 0/16 26 h-m-p 1.6000 8.0000 0.0094 YC 2332.178224 1 0.8377 760 | 0/16 27 h-m-p 1.1368 8.0000 0.0069 CC 2332.174378 1 1.0183 797 | 0/16 28 h-m-p 1.6000 8.0000 0.0016 CC 2332.172599 1 2.1231 834 | 0/16 29 h-m-p 1.3453 8.0000 0.0026 CC 2332.171423 1 1.7062 871 | 0/16 30 h-m-p 1.6000 8.0000 0.0013 C 2332.170839 0 1.8712 906 | 0/16 31 h-m-p 1.6000 8.0000 0.0014 Y 2332.170789 0 0.9523 941 | 0/16 32 h-m-p 1.6000 8.0000 0.0003 Y 2332.170787 0 0.9439 976 | 0/16 33 h-m-p 1.6000 8.0000 0.0000 Y 2332.170787 0 1.0650 1011 | 0/16 34 h-m-p 1.6000 8.0000 0.0000 Y 2332.170787 0 1.0418 1046 | 0/16 35 h-m-p 1.6000 8.0000 0.0000 C 2332.170787 0 1.6000 1081 | 0/16 36 h-m-p 1.6000 8.0000 0.0000 C 2332.170787 0 0.4000 1116 | 0/16 37 h-m-p 0.5123 8.0000 0.0000 ---C 2332.170787 0 0.0020 1154 Out.. lnL = -2332.170787 1155 lfun, 12705 eigenQcodon, 150150 P(t) Time used: 2:04 Model 8: beta&w>1 TREE # 1 (1, (2, 3), ((4, 5), ((6, 7), 8))); MP score: 263 initial w for M8:NSbetaw>1 reset. 0.040710 0.029516 0.042370 0.005486 0.069289 0.071813 0.073807 0.090286 0.076185 0.151990 0.122422 0.088877 0.327233 2.323978 0.900000 1.091300 1.180709 2.396835 ntime & nrate & np: 13 2 18 Bounds (np=18): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 5.398691 np = 18 lnL0 = -2427.603345 Iterating by ming2 Initial: fx= 2427.603345 x= 0.04071 0.02952 0.04237 0.00549 0.06929 0.07181 0.07381 0.09029 0.07619 0.15199 0.12242 0.08888 0.32723 2.32398 0.90000 1.09130 1.18071 2.39683 1 h-m-p 0.0000 0.0001 280.6235 ++ 2420.090838 m 0.0001 23 | 0/18 2 h-m-p 0.0000 0.0000 6806.1064 +CYCCC 2409.182508 4 0.0000 52 | 0/18 3 h-m-p 0.0000 0.0002 139.7073 ++ 2407.277334 m 0.0002 73 | 0/18 4 h-m-p 0.0001 0.0020 176.4599 +YCYCCC 2397.677291 5 0.0012 104 | 0/18 5 h-m-p 0.0002 0.0008 663.9600 +YYYCCC 2377.481322 5 0.0006 133 | 0/18 6 h-m-p 0.0000 0.0001 7096.2271 +YCYCCC 2355.716751 5 0.0001 163 | 0/18 7 h-m-p 0.0001 0.0005 656.9236 YYC 2353.814439 2 0.0001 186 | 0/18 8 h-m-p 0.0005 0.0026 45.8551 CCCC 2353.287032 3 0.0006 213 | 0/18 9 h-m-p 0.0006 0.0139 50.1701 +CCCC 2351.077346 3 0.0033 241 | 0/18 10 h-m-p 0.0015 0.0086 109.7084 CCC 2348.065207 2 0.0024 266 | 0/18 11 h-m-p 0.0038 0.0189 58.8684 CYC 2346.122307 2 0.0034 290 | 0/18 12 h-m-p 0.0030 0.0151 16.1127 YCC 2345.976579 2 0.0015 314 | 0/18 13 h-m-p 0.0033 0.0675 7.3087 YCC 2345.906601 2 0.0025 338 | 0/18 14 h-m-p 0.0109 0.2745 1.6486 YC 2345.551730 1 0.0271 360 | 0/18 15 h-m-p 0.0052 0.1156 8.5390 +YCCCC 2338.892044 4 0.0453 389 | 0/18 16 h-m-p 0.0015 0.0075 98.8087 CCCCC 2335.167184 4 0.0022 418 | 0/18 17 h-m-p 0.0109 0.0547 5.1819 CC 2335.108758 1 0.0034 441 | 0/18 18 h-m-p 0.0034 0.6289 5.2441 ++YCCCC 2333.477595 4 0.1198 471 | 0/18 19 h-m-p 0.1508 0.7541 2.0344 CYCCC 2332.506494 4 0.2463 499 | 0/18 20 h-m-p 0.9337 4.6685 0.2403 CCC 2332.153869 2 0.3524 524 | 0/18 21 h-m-p 0.6384 8.0000 0.1326 CC 2332.052645 1 0.5103 565 | 0/18 22 h-m-p 1.2832 8.0000 0.0527 YC 2331.940531 1 3.1527 605 | 0/18 23 h-m-p 1.0033 8.0000 0.1657 YC 2331.688050 1 2.2067 645 | 0/18 24 h-m-p 1.2705 8.0000 0.2879 YYC 2331.548486 2 1.0028 686 | 0/18 25 h-m-p 1.6000 8.0000 0.1448 CCCC 2331.396933 3 2.5927 731 | 0/18 26 h-m-p 1.1754 5.8769 0.2511 YYCC 2331.247135 3 1.0286 774 | 0/18 27 h-m-p 0.7732 3.8660 0.2906 YYCC 2331.133667 3 0.7118 817 | 0/18 28 h-m-p 0.7870 8.0000 0.2628 YCCC 2331.006393 3 1.5688 861 | 0/18 29 h-m-p 1.1291 8.0000 0.3652 YCCC 2330.797908 3 2.2811 905 | 0/18 30 h-m-p 0.6019 3.0095 0.6274 CCCC 2330.717034 3 0.6749 950 | 0/18 31 h-m-p 0.8062 8.0000 0.5252 CCC 2330.616542 2 0.6880 993 | 0/18 32 h-m-p 0.9505 8.0000 0.3802 YC 2330.514425 1 1.9779 1033 | 0/18 33 h-m-p 1.6000 8.0000 0.3775 CC 2330.461647 1 1.2664 1074 | 0/18 34 h-m-p 1.6000 8.0000 0.0566 YC 2330.455948 1 1.0529 1114 | 0/18 35 h-m-p 1.6000 8.0000 0.0245 YC 2330.454961 1 1.1053 1154 | 0/18 36 h-m-p 1.6000 8.0000 0.0048 C 2330.454429 0 1.9431 1193 | 0/18 37 h-m-p 0.6999 8.0000 0.0134 C 2330.454287 0 0.8913 1232 | 0/18 38 h-m-p 1.6000 8.0000 0.0047 Y 2330.454258 0 1.1923 1271 | 0/18 39 h-m-p 1.6000 8.0000 0.0021 Y 2330.454257 0 1.1434 1310 | 0/18 40 h-m-p 1.6000 8.0000 0.0005 C 2330.454256 0 1.3299 1349 | 0/18 41 h-m-p 1.6000 8.0000 0.0002 Y 2330.454256 0 1.1658 1388 | 0/18 42 h-m-p 1.6000 8.0000 0.0000 Y 2330.454256 0 0.9148 1427 | 0/18 43 h-m-p 1.5465 8.0000 0.0000 Y 2330.454256 0 1.5465 1466 | 0/18 44 h-m-p 1.6000 8.0000 0.0000 Y 2330.454256 0 1.1790 1505 | 0/18 45 h-m-p 1.6000 8.0000 0.0000 -----C 2330.454256 0 0.0004 1549 Out.. lnL = -2330.454256 1550 lfun, 18600 eigenQcodon, 221650 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2341.780272 S = -2223.149394 -110.956447 Calculating f(w|X), posterior probabilities of site classes. did 10 / 179 patterns 3:35 did 20 / 179 patterns 3:35 did 30 / 179 patterns 3:35 did 40 / 179 patterns 3:36 did 50 / 179 patterns 3:36 did 60 / 179 patterns 3:36 did 70 / 179 patterns 3:36 did 80 / 179 patterns 3:36 did 90 / 179 patterns 3:37 did 100 / 179 patterns 3:37 did 110 / 179 patterns 3:37 did 120 / 179 patterns 3:37 did 130 / 179 patterns 3:37 did 140 / 179 patterns 3:38 did 150 / 179 patterns 3:38 did 160 / 179 patterns 3:38 did 170 / 179 patterns 3:38 did 179 / 179 patterns 3:38 Time used: 3:38 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=290 D_melanogaster_CG2034-PB MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV D_sechellia_CG2034-PB MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV D_simulans_CG2034-PB MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV D_yakuba_CG2034-PB MLSNLVVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV D_erecta_CG2034-PB MLSNLLVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV D_biarmipes_CG2034-PB MLSNLLVTKQKLVLVIDKLNRERIAPKFIGSLLHEQGQGTETIKALPTGV D_suzukii_CG2034-PB MLSNLLVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGTETIKTLPTGI D_eugracilis_CG2034-PB MLSNLVVTNQKVVLIIDELNRERIAPKFIGSLLHEQGQGTDTIKALPTGV *****:**:**:**:**:*********************::***:****: D_melanogaster_CG2034-PB SLKHVATFEALIDKYAN---NNTGS---------TTDSNSTGFNVILPTL D_sechellia_CG2034-PB SLKHVATFEALIDKYAN---NNTGS---------TTDSNFTGFNVILPTL D_simulans_CG2034-PB SLKHVATFEALIDKYAN---NNTGS---------TTDPNFTGFNVILPTL D_yakuba_CG2034-PB SLKHVATFEALITECANTKNNNTAS---------SPRSKSTGFNVILPTL D_erecta_CG2034-PB SLKHVATFEALIGECANHKNNNTGS---------IPGSKATGFNVILPTL D_biarmipes_CG2034-PB SLKLVATFEALLSECANQNNNNNTAGTPG-----SGAGKPAGFNVILPTL D_suzukii_CG2034-PB SLKHVATFEALIAECANQNN----------------TGKPSGFNVILPTL D_eugracilis_CG2034-PB SLKHVATFESLIDECANHNNNNTPAGEVGDVDAVTPGSKSTGFNVILPTL *** *****:*: : ** : :********* D_melanogaster_CG2034-PB ADLLCYQTPAFIFGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCE D_sechellia_CG2034-PB ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE D_simulans_CG2034-PB ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE D_yakuba_CG2034-PB ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHADYILAGCE D_erecta_CG2034-PB ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHAEYILAGCE D_biarmipes_CG2034-PB ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPQHLQHPHAEYILAGCE D_suzukii_CG2034-PB ADLLCYQSPAFIFSFLNRLRRSEHVRRVFLWASPQHLQHPHADYILAGCE D_eugracilis_CG2034-PB ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPHHLQHPHAAYILAGCE *******:*****.********::* ********:***.*** ******* D_melanogaster_CG2034-PB YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP D_sechellia_CG2034-PB YLAELVLRLETDKLLSLISRKPGGGVTNRRYSCEVSKTQFKVTPLDGGRP D_simulans_CG2034-PB YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP D_yakuba_CG2034-PB YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCQVSKTSFQVTPLDGGLP D_erecta_CG2034-PB YLAELVLRLESDKLLSLISRKPGGAVSNKRYSCQVSKTFFQVTPLDGGLP D_biarmipes_CG2034-PB YLAELVLRLETDKQLSLISRKPGGGVTNRRFACQISKTEFQVTPLDEGQP D_suzukii_CG2034-PB YLAELVLRLETDKLLSLISRKPGGGVSNRRFACQVSKTQFQVTPLDEGLP D_eugracilis_CG2034-PB YLAKLVLRLETDKLLSIISRKPGGGVTNRRFSCQVSKTQFLVTPVDGGLP ***:******:** **:*******.*:*:*::*::*** * ***:* * * D_melanogaster_CG2034-PB AGASPKQPSPEAEQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSE D_sechellia_CG2034-PB AGASSKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE D_simulans_CG2034-PB AGASPKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE D_yakuba_CG2034-PB AGASPKQPSPESEQTPEPASSTFKIELDEDEVVARNALTLPYERTCEPSE D_erecta_CG2034-PB AGGSPKQPSPETEQTPEPASSTFKIELDEDEVMARNALTLPYERTCEPSE D_biarmipes_CG2034-PB AGASPKQSSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPTE D_suzukii_CG2034-PB TGVSPKQPTPEAEQTPEPASSTFKIELDEDEMVARNALTLPYERTSEPTE D_eugracilis_CG2034-PB AGVSPKQPSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPSE :* *.**.:**:***.***************::************.**.* D_melanogaster_CG2034-PB GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo---- D_sechellia_CG2034-PB GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo---- D_simulans_CG2034-PB GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo---- D_yakuba_CG2034-PB GNIIYTPDADDDFDEEDPDEDLCIooooooooo------- D_erecta_CG2034-PB GNIIYTPDADDDFDEEDPDEDLCIooooooooo------- D_biarmipes_CG2034-PB GNIIYTPDADDDFDEEDPDEDLCIooooo----------- D_suzukii_CG2034-PB GNIIYTPDADDDFDEEDPDEDLCIoooooooooooooooo D_eugracilis_CG2034-PB GNIIYTPDADDDFDEEDPDEDLCI---------------- ************************
>D_melanogaster_CG2034-PB ATGCTCTCCAACCTGGTGGTGACCAAGCAGAAAGTGGTCCTCGTAATAGA TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGTCTGCTGC ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTGCCCACCGGCGTC AGCCTTAAGCACGTGGCCACCTTCGAGGCACTGATCGACAAGTACGCCAA C---------AACAACACTGGGAGT------------------------- --ACTACGGATTCCAACTCCACTGGCTTTAACGTCATCCTGCCAACATTG GCAGACCTGCTGTGCTACCAGACGCCTGCTTTCATATTTGGCTTCCTCAA CCGCCTACGCCGCTCGGACAATGTGCGTCGGGTTTTCCTTTGGGCCTCCC CGCAGCACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG TACCTGGCCGAGCTGGTCCTCCGACTGGAATCGGACAAACTACTCTCGCT GATATCACGCAAGCCGGGCGGAGGGGTGTCCAACAGGCGCTACTCCTGCG AAGTCAGCAAAACCCAGTTCAAGGTGACGCCGCTGGACGGAGGACTGCCT GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCACAGA GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAAGTGTTGG CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGTCTGAG GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA TCCGGACGAGGATCTGTGCATC---------------------------- -------------------- >D_sechellia_CG2034-PB ATGCTCTCCAACCTGGTGGTCACCAAGCAGAAAGTGGTCCTCATAATAGA TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTCCCCACCGGCGTC AGCCTGAAGCACGTGGCCACCTTTGAGGCACTGATCGACAAGTACGCCAA C---------AACAACACTGGGAGT------------------------- --ACTACGGATTCCAACTTCACTGGCTTTAACGTCATCCTGCCCACATTG GCCGACCTGCTGTGCTACCAGACGCCCGCTTTCATATTTGGCTTTCTCAA CCGCCTACGACGCTCGGAAAATGTGCGTCGGGTGTTCCTTTGGGCCTCCC CGCAACACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG TACCTGGCCGAGCTGGTCCTCCGACTGGAAACGGACAAACTACTCTCGCT GATATCACGCAAGCCGGGTGGAGGGGTGACCAACAGGCGCTACTCCTGCG AAGTCAGCAAAACCCAATTTAAGGTGACGCCGCTTGACGGAGGACGTCCT GCAGGTGCCTCCTCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCCCAGA GCCGGCCAGCAGCACCTTTAAAATCGAGCTTGACGAGGATGAAGTGCTGG CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGCCTGAG GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA TCCGGACGAGGATCTGTGCATC---------------------------- -------------------- >D_simulans_CG2034-PB ATGCTCTCCAACCTGGTGGTCACCAAGCAGAAAGTGGTCCTCATAATAGA TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTCCCCACCGGCGTC AGCCTGAAGCACGTGGCCACCTTCGAGGCACTGATCGACAAGTACGCCAA C---------AACAACACTGGGAGT------------------------- --ACTACGGATCCCAACTTCACTGGCTTTAACGTCATCCTGCCCACATTG GCCGACCTGCTGTGCTACCAGACGCCCGCTTTCATATTTGGCTTCCTCAA CCGCCTACGACGCTCGGAAAATGTGCGTCGGGTGTTCCTTTGGGCCTCCC CGCAGCACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG TACCTGGCCGAGCTGGTCCTCCGACTGGAATCGGACAAACTACTCTCGCT GATATCACGCAAGCCGGGCGGAGGGGTGTCCAACAGGCGCTACTCCTGCG AAGTCAGCAAAACCCAGTTCAAGGTGACGCCGCTGGACGGAGGACTTCCT GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCCCAGA GCCGGCCAGCAGCACCTTTAAAATCGAGCTTGACGAGGATGAAGTGCTGG CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGCCTGAG GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA TCCGGACGAGGATCTGTGCATC---------------------------- -------------------- >D_yakuba_CG2034-PB ATGCTCTCCAACCTGGTGGTGACCAATCAGAAAGTGGTCCTCGTAATAGA TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGTCTGCTGC ACGAGCAGGGACAGGGGGCGGAAACCATCAAGGCCCTGCCCACCGGCGTC AGCCTGAAGCACGTGGCCACCTTCGAGGCGCTGATCACCGAGTGCGCCAA CACCAAAAACAACAACACTGCGAGC------------------------- --AGTCCTCGCTCGAAATCCACTGGCTTCAACGTCATCCTGCCCACCTTG GCCGATCTGCTGTGCTACCAGACGCCCGCTTTCATCTTTGGCTTCCTCAA CCGCCTGCGGCGCTCGGAGAATGTGTGCCGTGTGTTCCTGTGGGCCTCCC CGCAGCACCTACAGAATCCCCATGCCGACTACATCCTGGCGGGCTGCGAG TACCTGGCCGAGTTGGTCCTACGACTAGAATCCGACAAATTACTCTCACT GATTTCAAGAAAGCCGGGCGGTGGGGTGTCCAACAGGCGCTACTCCTGCC AAGTCAGCAAAACCTCTTTCCAGGTAACGCCGCTGGACGGAGGACTACCT GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAATCGGAGCAGACCCCAGA GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAAGTGGTGG CCCGCAATGCACTCACCCTTCCATACGAACGCACATGCGAACCGTCTGAG GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA TCCGGACGAGGATCTGTGCATC---------------------------- -------------------- >D_erecta_CG2034-PB ATGCTCTCCAACCTGTTGGTGACCAATCAGAAAGTGGTCCTCGTTATAGA TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC ACGAGCAGGGACAGGGGGCGGAAACTATCAAGGCCCTGCCCACCGGCGTC AGTCTGAAGCACGTGGCCACCTTCGAGGCGCTGATTGGCGAGTGCGCCAA CCACAAAAACAACAACACTGGGAGC------------------------- --ATTCCGGGATCCAAAGCCACTGGCTTCAACGTCATCCTGCCCACCTTG GCCGACCTGCTGTGCTACCAGACGCCCGCCTTCATCTTTGGCTTCCTCAA CCGCCTGCGGCGCTCGGAGAACGTGTGCCGCGTGTTCCTGTGGGCCTCCC CACAACACTTACAGAATCCCCATGCCGAATACATCCTGGCTGGCTGCGAG TACCTGGCCGAGTTGGTCCTACGACTGGAATCCGACAAATTACTCTCGCT GATTTCACGCAAGCCGGGCGGTGCGGTGTCCAACAAGCGCTACTCCTGCC AAGTCAGCAAAACCTTTTTCCAGGTGACGCCGCTGGACGGAGGGCTACCT GCAGGTGGCTCCCCCAAGCAGCCCTCGCCCGAGACGGAGCAGACCCCAGA GCCGGCCAGCAGCACCTTCAAAATCGAACTTGACGAGGATGAAGTGATGG CCCGCAATGCACTCACCCTGCCATACGAACGCACGTGCGAGCCGTCTGAG GGAAACATAATATACACGCCCGATGCCGACGATGATTTCGACGAGGAGGA TCCGGACGAGGATCTGTGCATC---------------------------- -------------------- >D_biarmipes_CG2034-PB ATGCTCTCCAACCTGCTGGTGACCAAACAAAAGCTGGTCCTCGTAATAGA TAAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC ACGAGCAGGGCCAGGGGACGGAGACCATCAAGGCCCTGCCCACCGGCGTC AGCCTCAAGCTCGTGGCCACCTTCGAGGCGCTGCTCTCGGAGTGCGCCAA CCAAAACAACAACAACAACACTGCGGGCACTCCGGGC------------- --TCAGGAGCAGGAAAGCCCGCCGGTTTCAACGTCATCCTGCCCACACTG GCCGACCTGCTGTGCTACCAGTCGCCCGCCTTCATCTTTGGCTTCCTCAA CCGCCTGCGTCGTTCGGAGCACGTGCGTCGTGTGTTCCTCTGGGCCTCCC CGCAGCACCTGCAGCATCCGCATGCGGAGTACATCCTGGCTGGCTGCGAG TACCTGGCGGAGTTGGTCCTTCGCCTGGAGACGGACAAGCAACTATCGCT GATATCGCGTAAACCCGGTGGCGGAGTGACCAACAGGCGCTTCGCCTGCC AGATCAGCAAGACCGAGTTCCAGGTGACGCCGCTGGACGAAGGACAGCCC GCAGGAGCCTCACCCAAACAGTCTTCCCCGGAGGCGGAGCAAACCCCAGA GCCGGCCAGCAGCACCTTCAAAATCGAGCTCGACGAGGACGAGGTGGTGG CCCGCAATGCACTCACCCTGCCATACGAACGCACCAGCGAGCCGACCGAG GGCAACATTATATACACACCCGATGCCGACGACGACTTCGACGAGGAGGA TCCGGACGAGGATCTGTGCATC---------------------------- -------------------- >D_suzukii_CG2034-PB ATGCTCTCCAACCTGCTGGTGACCAAACAAAAAGTGGTCCTCGTAATAGA TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC ACGAACAGGGCCAGGGGACGGAGACCATCAAGACCCTGCCCACCGGCATC AGCCTGAAGCACGTGGCCACCTTCGAGGCACTGATCGCCGAGTGCGCCAA CCAAAACAAC---------------------------------------- --------ACAGGGAAACCCTCCGGCTTCAACGTCATCCTGCCCACACTG GCCGACCTGCTGTGCTACCAGTCGCCCGCCTTTATCTTTAGCTTCCTCAA CCGCCTGCGTCGCTCGGAGCACGTGCGTCGTGTGTTCCTCTGGGCCTCCC CGCAGCACCTCCAGCATCCCCATGCCGACTACATCCTGGCTGGCTGCGAG TACCTGGCGGAGCTGGTGCTTCGCCTGGAGACGGACAAGCTACTATCACT GATATCGCGCAAACCCGGTGGCGGGGTGTCCAACAGGCGGTTCGCCTGCC AGGTCAGCAAGACCCAGTTCCAGGTGACGCCGCTTGACGAAGGGCTGCCC ACAGGTGTCTCACCCAAACAGCCTACCCCGGAGGCGGAGCAAACCCCAGA GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAGATGGTGG CCCGCAATGCACTCACCCTGCCATATGAACGCACCAGCGAGCCGACTGAG GGCAACATCATATACACACCCGATGCTGACGACGACTTCGATGAGGAGGA TCCGGACGAGGATCTGTGCATC---------------------------- -------------------- >D_eugracilis_CG2034-PB ATGCTTTCAAATCTTGTGGTGACCAATCAAAAAGTGGTCCTCATAATAGA TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCTTGCTTC ACGAACAGGGACAGGGGACAGATACAATCAAGGCCTTGCCCACCGGCGTC AGTCTGAAGCACGTGGCCACCTTCGAATCGCTGATCGACGAGTGCGCCAA CCATAACAACAACAACACCCCTGCCGGAGAAGTGGGCGACGTGGATGCGG TTACTCCGGGATCGAAATCTACCGGCTTCAACGTCATCCTGCCCACCTTG GCTGACCTGCTGTGCTATCAGTCGCCCGCTTTTATTTTTGGCTTCCTTAA CCGCCTACGTCGCTCGGAGCATGTGCGTCGAGTGTTCCTCTGGGCTTCCC CGCACCATCTGCAGCATCCTCATGCTGCCTACATTCTGGCTGGCTGCGAA TACTTGGCCAAGTTGGTGCTCCGCTTGGAAACAGACAAGCTACTGTCCAT AATATCACGCAAGCCGGGCGGAGGAGTTACAAACAGACGCTTCTCATGCC AGGTCAGCAAAACCCAGTTCCTGGTGACGCCGGTGGACGGAGGACTCCCG GCAGGTGTCTCTCCCAAGCAGCCCTCGCCAGAGGCAGAGCAAACCCCAGA ACCGGCCAGCAGCACCTTTAAGATCGAGCTCGACGAGGATGAAGTGGTTG CTCGCAATGCACTTACCCTGCCATACGAACGCACAAGCGAGCCGTCCGAG GGAAACATTATATACACGCCCGATGCCGACGACGACTTTGATGAGGAGGA TCCTGACGAGGATCTGTGCATC---------------------------- --------------------
>D_melanogaster_CG2034-PB MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYAN---NNTGS---------TTDSNSTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCE YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP AGASPKQPSPEAEQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSE GNIIYTPDADDDFDEEDPDEDLCI >D_sechellia_CG2034-PB MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYAN---NNTGS---------TTDSNFTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE YLAELVLRLETDKLLSLISRKPGGGVTNRRYSCEVSKTQFKVTPLDGGRP AGASSKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE GNIIYTPDADDDFDEEDPDEDLCI >D_simulans_CG2034-PB MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV SLKHVATFEALIDKYAN---NNTGS---------TTDPNFTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP AGASPKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE GNIIYTPDADDDFDEEDPDEDLCI >D_yakuba_CG2034-PB MLSNLVVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV SLKHVATFEALITECANTKNNNTAS---------SPRSKSTGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHADYILAGCE YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCQVSKTSFQVTPLDGGLP AGASPKQPSPESEQTPEPASSTFKIELDEDEVVARNALTLPYERTCEPSE GNIIYTPDADDDFDEEDPDEDLCI >D_erecta_CG2034-PB MLSNLLVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV SLKHVATFEALIGECANHKNNNTGS---------IPGSKATGFNVILPTL ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHAEYILAGCE YLAELVLRLESDKLLSLISRKPGGAVSNKRYSCQVSKTFFQVTPLDGGLP AGGSPKQPSPETEQTPEPASSTFKIELDEDEVMARNALTLPYERTCEPSE GNIIYTPDADDDFDEEDPDEDLCI >D_biarmipes_CG2034-PB MLSNLLVTKQKLVLVIDKLNRERIAPKFIGSLLHEQGQGTETIKALPTGV SLKLVATFEALLSECANQNNNNNTAGTPG-----SGAGKPAGFNVILPTL ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPQHLQHPHAEYILAGCE YLAELVLRLETDKQLSLISRKPGGGVTNRRFACQISKTEFQVTPLDEGQP AGASPKQSSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPTE GNIIYTPDADDDFDEEDPDEDLCI >D_suzukii_CG2034-PB MLSNLLVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGTETIKTLPTGI SLKHVATFEALIAECANQNN----------------TGKPSGFNVILPTL ADLLCYQSPAFIFSFLNRLRRSEHVRRVFLWASPQHLQHPHADYILAGCE YLAELVLRLETDKLLSLISRKPGGGVSNRRFACQVSKTQFQVTPLDEGLP TGVSPKQPTPEAEQTPEPASSTFKIELDEDEMVARNALTLPYERTSEPTE GNIIYTPDADDDFDEEDPDEDLCI >D_eugracilis_CG2034-PB MLSNLVVTNQKVVLIIDELNRERIAPKFIGSLLHEQGQGTDTIKALPTGV SLKHVATFESLIDECANHNNNNTPAGEVGDVDAVTPGSKSTGFNVILPTL ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPHHLQHPHAAYILAGCE YLAKLVLRLETDKLLSIISRKPGGGVTNRRFSCQVSKTQFLVTPVDGGLP AGVSPKQPSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPSE GNIIYTPDADDDFDEEDPDEDLCI
#NEXUS [ID: 3981457565] begin taxa; dimensions ntax=8; taxlabels D_melanogaster_CG2034-PB D_sechellia_CG2034-PB D_simulans_CG2034-PB D_yakuba_CG2034-PB D_erecta_CG2034-PB D_biarmipes_CG2034-PB D_suzukii_CG2034-PB D_eugracilis_CG2034-PB ; end; begin trees; translate 1 D_melanogaster_CG2034-PB, 2 D_sechellia_CG2034-PB, 3 D_simulans_CG2034-PB, 4 D_yakuba_CG2034-PB, 5 D_erecta_CG2034-PB, 6 D_biarmipes_CG2034-PB, 7 D_suzukii_CG2034-PB, 8 D_eugracilis_CG2034-PB ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.0192839,(2:0.02152893,3:0.002432525)1.000:0.01545975,((4:0.04465051,5:0.04650573)1.000:0.04209891,((6:0.08797058,7:0.04013295)1.000:0.1354437,8:0.1810676)1.000:0.07688734)1.000:0.04878292); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.0192839,(2:0.02152893,3:0.002432525):0.01545975,((4:0.04465051,5:0.04650573):0.04209891,((6:0.08797058,7:0.04013295):0.1354437,8:0.1810676):0.07688734):0.04878292); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2621.36 -2634.89 2 -2621.59 -2637.33 -------------------------------------- TOTAL -2621.47 -2636.72 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.779663 0.006734 0.629642 0.943847 0.773218 1203.55 1352.28 1.001 r(A<->C){all} 0.086651 0.000400 0.051370 0.128583 0.085229 1218.04 1230.31 1.000 r(A<->G){all} 0.238300 0.001321 0.173523 0.312639 0.235503 614.91 777.70 1.000 r(A<->T){all} 0.197501 0.001655 0.120352 0.277447 0.195508 929.44 932.23 1.000 r(C<->G){all} 0.044300 0.000146 0.020022 0.067380 0.043567 961.68 1064.80 1.000 r(C<->T){all} 0.324947 0.001799 0.242997 0.409177 0.323865 889.23 944.60 1.000 r(G<->T){all} 0.108302 0.000646 0.062211 0.160564 0.106249 673.98 728.17 1.000 pi(A){all} 0.221604 0.000168 0.196999 0.247555 0.221297 1155.00 1307.61 1.000 pi(C){all} 0.329344 0.000222 0.302974 0.360473 0.329315 1342.36 1359.13 1.000 pi(G){all} 0.278205 0.000209 0.252199 0.307758 0.277970 1081.96 1119.08 1.000 pi(T){all} 0.170846 0.000137 0.147577 0.192946 0.170569 936.55 1014.05 1.000 alpha{1,2} 0.134058 0.001498 0.052669 0.210920 0.134628 1108.09 1192.13 1.000 alpha{3} 2.319434 0.740613 1.004297 4.143426 2.182697 989.25 1180.87 1.000 pinvar{all} 0.188331 0.008083 0.004948 0.336468 0.192165 996.61 1205.45 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/100/CG2034-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 8 ls = 255 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 2 6 3 1 2 1 | Ser TCT 1 0 0 2 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0 TTC 8 5 8 9 9 10 | TCC 8 7 6 7 7 3 | TAC 7 7 7 6 6 5 | TGC 4 4 4 7 7 5 Leu TTA 0 0 0 1 2 0 | TCA 1 1 1 2 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 2 1 1 2 3 1 | TCG 4 3 4 4 3 5 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 3 3 3 2 1 1 | Pro CCT 2 2 2 1 1 0 | His CAT 1 1 1 1 1 2 | Arg CGT 1 2 1 1 0 5 CTC 6 7 7 5 5 9 | CCC 6 7 9 9 9 9 | CAC 3 3 3 3 3 3 | CGC 8 7 7 7 8 6 CTA 3 3 3 5 3 2 | CCA 2 2 2 2 3 2 | Gln CAA 0 2 0 1 2 3 | CGA 1 2 2 1 1 0 CTG 18 17 18 16 18 20 | CCG 7 7 7 6 5 7 | CAG 9 7 9 9 8 9 | CGG 2 2 2 2 2 1 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 1 1 1 2 3 2 | Thr ACT 1 1 1 1 2 0 | Asn AAT 3 3 3 5 4 2 | Ser AGT 1 0 0 1 1 0 ATC 7 7 7 8 7 8 | ACC 8 9 8 10 8 11 | AAC 7 7 7 6 7 6 | AGC 4 5 5 4 4 6 ATA 5 6 6 3 3 3 | ACA 3 2 2 1 0 2 | Lys AAA 4 4 4 5 5 4 | Arg AGA 0 0 0 1 0 0 Met ATG 1 1 1 1 2 1 | ACG 3 4 3 3 5 3 | AAG 8 8 8 5 6 8 | AGG 1 1 1 1 0 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 1 0 0 0 1 0 | Ala GCT 2 2 2 1 1 1 | Asp GAT 9 9 9 7 7 4 | Gly GGT 1 2 1 2 2 2 GTC 5 6 6 5 5 4 | GCC 11 12 12 12 13 13 | GAC 11 10 10 8 7 10 | GGC 6 5 6 6 8 7 GTA 1 0 0 2 0 1 | GCA 4 3 3 2 2 3 | Glu GAA 4 5 5 6 6 2 | GGA 5 5 5 4 4 4 GTG 8 8 8 9 8 8 | GCG 2 2 2 3 3 4 | GAG 16 16 16 16 17 22 | GGG 2 2 2 2 2 1 -------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------- Phe TTT 2 4 | Ser TCT 0 2 | Tyr TAT 1 1 | Cys TGT 0 0 TTC 9 7 | TCC 4 3 | TAC 4 4 | TGC 5 5 Leu TTA 0 0 | TCA 2 3 | *** TAA 0 0 | *** TGA 0 0 TTG 0 6 | TCG 3 5 | TAG 0 0 | Trp TGG 1 1 ---------------------------------------------------------------------- Leu CTT 3 5 | Pro CCT 1 2 | His CAT 2 4 | Arg CGT 3 2 CTC 6 5 | CCC 10 7 | CAC 4 3 | CGC 7 8 CTA 3 3 | CCA 2 3 | Gln CAA 2 2 | CGA 0 1 CTG 20 11 | CCG 6 6 | CAG 9 7 | CGG 2 1 ---------------------------------------------------------------------- Ile ATT 1 4 | Thr ACT 1 0 | Asn AAT 2 4 | Ser AGT 0 1 ATC 10 6 | ACC 11 9 | AAC 6 5 | AGC 7 5 ATA 3 5 | ACA 4 5 | Lys AAA 6 3 | Arg AGA 0 1 Met ATG 2 1 | ACG 3 2 | AAG 5 8 | AGG 1 0 ---------------------------------------------------------------------- Val GTT 0 2 | Ala GCT 2 6 | Asp GAT 6 7 | Gly GGT 2 1 GTC 4 5 | GCC 11 8 | GAC 9 9 | GGC 7 6 GTA 1 0 | GCA 2 3 | Glu GAA 3 7 | GGA 0 7 GTG 9 10 | GCG 2 0 | GAG 20 13 | GGG 4 1 ---------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_CG2034-PB position 1: T:0.14902 C:0.28235 A:0.22353 G:0.34510 position 2: T:0.27843 C:0.25490 A:0.32157 G:0.14510 position 3: T:0.11373 C:0.42745 A:0.12941 G:0.32941 Average T:0.18039 C:0.32157 A:0.22484 G:0.27320 #2: D_sechellia_CG2034-PB position 1: T:0.13725 C:0.29020 A:0.23137 G:0.34118 position 2: T:0.27843 C:0.25098 A:0.32157 G:0.14902 position 3: T:0.12549 C:0.42353 A:0.13725 G:0.31373 Average T:0.18039 C:0.32157 A:0.23007 G:0.26797 #3: D_simulans_CG2034-PB position 1: T:0.13725 C:0.29804 A:0.22353 G:0.34118 position 2: T:0.28235 C:0.25098 A:0.32157 G:0.14510 position 3: T:0.10588 C:0.43922 A:0.12941 G:0.32549 Average T:0.17516 C:0.32941 A:0.22484 G:0.27059 #4: D_yakuba_CG2034-PB position 1: T:0.16471 C:0.27843 A:0.22353 G:0.33333 position 2: T:0.27843 C:0.25882 A:0.30588 G:0.15686 position 3: T:0.10588 C:0.43922 A:0.14118 G:0.31373 Average T:0.18301 C:0.32549 A:0.22353 G:0.26797 #5: D_erecta_CG2034-PB position 1: T:0.16471 C:0.27451 A:0.22353 G:0.33725 position 2: T:0.28235 C:0.25098 A:0.30980 G:0.15686 position 3: T:0.10588 C:0.44314 A:0.12549 G:0.32549 Average T:0.18431 C:0.32288 A:0.21961 G:0.27320 #6: D_biarmipes_CG2034-PB position 1: T:0.12941 C:0.30980 A:0.22353 G:0.33725 position 2: T:0.27843 C:0.25490 A:0.31373 G:0.15294 position 3: T:0.08235 C:0.45098 A:0.10588 G:0.36078 Average T:0.16340 C:0.33856 A:0.21438 G:0.28366 #7: D_suzukii_CG2034-PB position 1: T:0.12157 C:0.31373 A:0.24314 G:0.32157 position 2: T:0.28627 C:0.25098 A:0.30980 G:0.15294 position 3: T:0.10196 C:0.44706 A:0.10980 G:0.34118 Average T:0.16993 C:0.33725 A:0.22092 G:0.27190 #8: D_eugracilis_CG2034-PB position 1: T:0.16078 C:0.27451 A:0.23137 G:0.33333 position 2: T:0.29020 C:0.25098 A:0.30196 G:0.15686 position 3: T:0.17647 C:0.37255 A:0.16863 G:0.28235 Average T:0.20915 C:0.29935 A:0.23399 G:0.25752 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 21 | Ser S TCT 7 | Tyr Y TAT 2 | Cys C TGT 0 TTC 65 | TCC 45 | TAC 46 | TGC 41 Leu L TTA 3 | TCA 12 | *** * TAA 0 | *** * TGA 0 TTG 16 | TCG 31 | TAG 0 | Trp W TGG 8 ------------------------------------------------------------------------------ Leu L CTT 21 | Pro P CCT 11 | His H CAT 13 | Arg R CGT 15 CTC 50 | CCC 66 | CAC 25 | CGC 58 CTA 25 | CCA 18 | Gln Q CAA 12 | CGA 8 CTG 138 | CCG 51 | CAG 67 | CGG 14 ------------------------------------------------------------------------------ Ile I ATT 15 | Thr T ACT 7 | Asn N AAT 26 | Ser S AGT 4 ATC 60 | ACC 74 | AAC 51 | AGC 40 ATA 34 | ACA 19 | Lys K AAA 35 | Arg R AGA 2 Met M ATG 10 | ACG 26 | AAG 56 | AGG 6 ------------------------------------------------------------------------------ Val V GTT 4 | Ala A GCT 17 | Asp D GAT 58 | Gly G GGT 13 GTC 40 | GCC 92 | GAC 74 | GGC 51 GTA 5 | GCA 22 | Glu E GAA 38 | GGA 34 GTG 68 | GCG 18 | GAG 136 | GGG 16 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.14559 C:0.29020 A:0.22794 G:0.33627 position 2: T:0.28186 C:0.25294 A:0.31324 G:0.15196 position 3: T:0.11471 C:0.43039 A:0.13088 G:0.32402 Average T:0.18072 C:0.32451 A:0.22402 G:0.27075 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_CG2034-PB D_sechellia_CG2034-PB 0.1522 (0.0159 0.1047) D_simulans_CG2034-PB 0.1646 (0.0106 0.0644) 0.2386 (0.0088 0.0369) D_yakuba_CG2034-PB 0.1917 (0.0387 0.2018) 0.1968 (0.0480 0.2437) 0.2099 (0.0424 0.2020) D_erecta_CG2034-PB 0.1984 (0.0451 0.2273) 0.2249 (0.0544 0.2419) 0.2285 (0.0488 0.2136) 0.1567 (0.0231 0.1476) D_biarmipes_CG2034-PB 0.1870 (0.0731 0.3910) 0.1669 (0.0721 0.4321) 0.1914 (0.0741 0.3870) 0.1356 (0.0631 0.4653) 0.1382 (0.0656 0.4748) D_suzukii_CG2034-PB 0.1696 (0.0652 0.3845) 0.1713 (0.0690 0.4028) 0.1718 (0.0649 0.3777) 0.1334 (0.0573 0.4296) 0.1496 (0.0632 0.4224) 0.2256 (0.0377 0.1670) D_eugracilis_CG2034-PB 0.1028 (0.0535 0.5199) 0.0958 (0.0525 0.5477) 0.1121 (0.0544 0.4850) 0.0813 (0.0488 0.6006) 0.0896 (0.0543 0.6062) 0.0964 (0.0596 0.6177) 0.0859 (0.0515 0.5998) Model 0: one-ratio TREE # 1: (1, (2, 3), ((4, 5), ((6, 7), 8))); MP score: 263 lnL(ntime: 13 np: 15): -2363.002381 +0.000000 9..1 9..10 10..2 10..3 9..11 11..12 12..4 12..5 11..13 13..14 14..6 14..7 13..8 0.036833 0.033987 0.044114 0.003970 0.088844 0.080297 0.062894 0.105587 0.105626 0.171074 0.134395 0.087126 0.287404 2.269799 0.109229 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.24215 (1: 0.036833, (2: 0.044114, 3: 0.003970): 0.033987, ((4: 0.062894, 5: 0.105587): 0.080297, ((6: 0.134395, 7: 0.087126): 0.171074, 8: 0.287404): 0.105626): 0.088844); (D_melanogaster_CG2034-PB: 0.036833, (D_sechellia_CG2034-PB: 0.044114, D_simulans_CG2034-PB: 0.003970): 0.033987, ((D_yakuba_CG2034-PB: 0.062894, D_erecta_CG2034-PB: 0.105587): 0.080297, ((D_biarmipes_CG2034-PB: 0.134395, D_suzukii_CG2034-PB: 0.087126): 0.171074, D_eugracilis_CG2034-PB: 0.287404): 0.105626): 0.088844); Detailed output identifying parameters kappa (ts/tv) = 2.26980 omega (dN/dS) = 0.10923 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 9..1 0.037 602.5 162.5 0.1092 0.0045 0.0411 2.7 6.7 9..10 0.034 602.5 162.5 0.1092 0.0041 0.0380 2.5 6.2 10..2 0.044 602.5 162.5 0.1092 0.0054 0.0493 3.2 8.0 10..3 0.004 602.5 162.5 0.1092 0.0005 0.0044 0.3 0.7 9..11 0.089 602.5 162.5 0.1092 0.0108 0.0992 6.5 16.1 11..12 0.080 602.5 162.5 0.1092 0.0098 0.0897 5.9 14.6 12..4 0.063 602.5 162.5 0.1092 0.0077 0.0702 4.6 11.4 12..5 0.106 602.5 162.5 0.1092 0.0129 0.1179 7.8 19.2 11..13 0.106 602.5 162.5 0.1092 0.0129 0.1180 7.8 19.2 13..14 0.171 602.5 162.5 0.1092 0.0209 0.1911 12.6 31.0 14..6 0.134 602.5 162.5 0.1092 0.0164 0.1501 9.9 24.4 14..7 0.087 602.5 162.5 0.1092 0.0106 0.0973 6.4 15.8 13..8 0.287 602.5 162.5 0.1092 0.0351 0.3210 21.1 52.2 tree length for dN: 0.1515 tree length for dS: 1.3874 Time used: 0:07 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (2, 3), ((4, 5), ((6, 7), 8))); MP score: 263 lnL(ntime: 13 np: 16): -2332.085329 +0.000000 9..1 9..10 10..2 10..3 9..11 11..12 12..4 12..5 11..13 13..14 14..6 14..7 13..8 0.039194 0.035447 0.046812 0.003416 0.094673 0.085950 0.069087 0.111297 0.112615 0.186038 0.142564 0.091010 0.317067 2.361394 0.884952 0.041015 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.33517 (1: 0.039194, (2: 0.046812, 3: 0.003416): 0.035447, ((4: 0.069087, 5: 0.111297): 0.085950, ((6: 0.142564, 7: 0.091010): 0.186038, 8: 0.317067): 0.112615): 0.094673); (D_melanogaster_CG2034-PB: 0.039194, (D_sechellia_CG2034-PB: 0.046812, D_simulans_CG2034-PB: 0.003416): 0.035447, ((D_yakuba_CG2034-PB: 0.069087, D_erecta_CG2034-PB: 0.111297): 0.085950, ((D_biarmipes_CG2034-PB: 0.142564, D_suzukii_CG2034-PB: 0.091010): 0.186038, D_eugracilis_CG2034-PB: 0.317067): 0.112615): 0.094673); Detailed output identifying parameters kappa (ts/tv) = 2.36139 dN/dS (w) for site classes (K=2) p: 0.88495 0.11505 w: 0.04102 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 9..1 0.039 601.8 163.2 0.1513 0.0059 0.0393 3.6 6.4 9..10 0.035 601.8 163.2 0.1513 0.0054 0.0356 3.2 5.8 10..2 0.047 601.8 163.2 0.1513 0.0071 0.0470 4.3 7.7 10..3 0.003 601.8 163.2 0.1513 0.0005 0.0034 0.3 0.6 9..11 0.095 601.8 163.2 0.1513 0.0144 0.0950 8.6 15.5 11..12 0.086 601.8 163.2 0.1513 0.0130 0.0862 7.9 14.1 12..4 0.069 601.8 163.2 0.1513 0.0105 0.0693 6.3 11.3 12..5 0.111 601.8 163.2 0.1513 0.0169 0.1116 10.2 18.2 11..13 0.113 601.8 163.2 0.1513 0.0171 0.1130 10.3 18.4 13..14 0.186 601.8 163.2 0.1513 0.0282 0.1866 17.0 30.4 14..6 0.143 601.8 163.2 0.1513 0.0216 0.1430 13.0 23.3 14..7 0.091 601.8 163.2 0.1513 0.0138 0.0913 8.3 14.9 13..8 0.317 601.8 163.2 0.1513 0.0481 0.3180 29.0 51.9 Time used: 0:14 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (2, 3), ((4, 5), ((6, 7), 8))); MP score: 263 lnL(ntime: 13 np: 18): -2331.588150 +0.000000 9..1 9..10 10..2 10..3 9..11 11..12 12..4 12..5 11..13 13..14 14..6 14..7 13..8 0.039848 0.036109 0.047619 0.003461 0.094605 0.088479 0.071686 0.116123 0.118358 0.191949 0.148605 0.092462 0.329915 2.406399 0.885674 0.110518 0.042111 6.483911 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.37922 (1: 0.039848, (2: 0.047619, 3: 0.003461): 0.036109, ((4: 0.071686, 5: 0.116123): 0.088479, ((6: 0.148605, 7: 0.092462): 0.191949, 8: 0.329915): 0.118358): 0.094605); (D_melanogaster_CG2034-PB: 0.039848, (D_sechellia_CG2034-PB: 0.047619, D_simulans_CG2034-PB: 0.003461): 0.036109, ((D_yakuba_CG2034-PB: 0.071686, D_erecta_CG2034-PB: 0.116123): 0.088479, ((D_biarmipes_CG2034-PB: 0.148605, D_suzukii_CG2034-PB: 0.092462): 0.191949, D_eugracilis_CG2034-PB: 0.329915): 0.118358): 0.094605); Detailed output identifying parameters kappa (ts/tv) = 2.40640 dN/dS (w) for site classes (K=3) p: 0.88567 0.11052 0.00381 w: 0.04211 1.00000 6.48391 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 9..1 0.040 601.5 163.5 0.1725 0.0066 0.0380 3.9 6.2 9..10 0.036 601.5 163.5 0.1725 0.0059 0.0345 3.6 5.6 10..2 0.048 601.5 163.5 0.1725 0.0078 0.0454 4.7 7.4 10..3 0.003 601.5 163.5 0.1725 0.0006 0.0033 0.3 0.5 9..11 0.095 601.5 163.5 0.1725 0.0156 0.0903 9.4 14.8 11..12 0.088 601.5 163.5 0.1725 0.0146 0.0844 8.8 13.8 12..4 0.072 601.5 163.5 0.1725 0.0118 0.0684 7.1 11.2 12..5 0.116 601.5 163.5 0.1725 0.0191 0.1108 11.5 18.1 11..13 0.118 601.5 163.5 0.1725 0.0195 0.1129 11.7 18.5 13..14 0.192 601.5 163.5 0.1725 0.0316 0.1832 19.0 29.9 14..6 0.149 601.5 163.5 0.1725 0.0245 0.1418 14.7 23.2 14..7 0.092 601.5 163.5 0.1725 0.0152 0.0882 9.2 14.4 13..8 0.330 601.5 163.5 0.1725 0.0543 0.3148 32.7 51.5 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG2034-PB) Pr(w>1) post mean +- SE for w 68 D 0.725 4.974 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG2034-PB) Pr(w>1) post mean +- SE for w 63 D 0.572 1.615 +- 1.272 68 D 0.790 2.249 +- 2.011 170 Q 0.609 1.811 +- 1.626 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.742 0.079 0.038 0.030 0.026 0.023 0.020 0.017 0.014 0.011 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.355 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.329 0.312 sum of density on p0-p1 = 1.000000 Time used: 0:40 Model 3: discrete (3 categories) TREE # 1: (1, (2, 3), ((4, 5), ((6, 7), 8))); MP score: 263 lnL(ntime: 13 np: 19): -2331.539283 +0.000000 9..1 9..10 10..2 10..3 9..11 11..12 12..4 12..5 11..13 13..14 14..6 14..7 13..8 0.038745 0.035325 0.046389 0.003582 0.093809 0.085395 0.068062 0.110621 0.111231 0.184809 0.142042 0.090165 0.312846 2.327552 0.725862 0.135304 0.034203 0.034203 0.769536 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.32302 (1: 0.038745, (2: 0.046389, 3: 0.003582): 0.035325, ((4: 0.068062, 5: 0.110621): 0.085395, ((6: 0.142042, 7: 0.090165): 0.184809, 8: 0.312846): 0.111231): 0.093809); (D_melanogaster_CG2034-PB: 0.038745, (D_sechellia_CG2034-PB: 0.046389, D_simulans_CG2034-PB: 0.003582): 0.035325, ((D_yakuba_CG2034-PB: 0.068062, D_erecta_CG2034-PB: 0.110621): 0.085395, ((D_biarmipes_CG2034-PB: 0.142042, D_suzukii_CG2034-PB: 0.090165): 0.184809, D_eugracilis_CG2034-PB: 0.312846): 0.111231): 0.093809); Detailed output identifying parameters kappa (ts/tv) = 2.32755 dN/dS (w) for site classes (K=3) p: 0.72586 0.13530 0.13883 w: 0.03420 0.03420 0.76954 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 9..1 0.039 602.1 162.9 0.1363 0.0055 0.0403 3.3 6.6 9..10 0.035 602.1 162.9 0.1363 0.0050 0.0368 3.0 6.0 10..2 0.046 602.1 162.9 0.1363 0.0066 0.0483 4.0 7.9 10..3 0.004 602.1 162.9 0.1363 0.0005 0.0037 0.3 0.6 9..11 0.094 602.1 162.9 0.1363 0.0133 0.0976 8.0 15.9 11..12 0.085 602.1 162.9 0.1363 0.0121 0.0889 7.3 14.5 12..4 0.068 602.1 162.9 0.1363 0.0097 0.0708 5.8 11.5 12..5 0.111 602.1 162.9 0.1363 0.0157 0.1151 9.4 18.8 11..13 0.111 602.1 162.9 0.1363 0.0158 0.1158 9.5 18.9 13..14 0.185 602.1 162.9 0.1363 0.0262 0.1924 15.8 31.3 14..6 0.142 602.1 162.9 0.1363 0.0202 0.1479 12.1 24.1 14..7 0.090 602.1 162.9 0.1363 0.0128 0.0939 7.7 15.3 13..8 0.313 602.1 162.9 0.1363 0.0444 0.3257 26.7 53.1 Naive Empirical Bayes (NEB) analysis Time used: 1:03 Model 7: beta (10 categories) TREE # 1: (1, (2, 3), ((4, 5), ((6, 7), 8))); MP score: 263 lnL(ntime: 13 np: 16): -2332.170787 +0.000000 9..1 9..10 10..2 10..3 9..11 11..12 12..4 12..5 11..13 13..14 14..6 14..7 13..8 0.038359 0.035423 0.046237 0.003666 0.093329 0.085132 0.067464 0.110369 0.110470 0.185502 0.142678 0.089465 0.310877 2.323978 0.136463 0.870281 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.31897 (1: 0.038359, (2: 0.046237, 3: 0.003666): 0.035423, ((4: 0.067464, 5: 0.110369): 0.085132, ((6: 0.142678, 7: 0.089465): 0.185502, 8: 0.310877): 0.110470): 0.093329); (D_melanogaster_CG2034-PB: 0.038359, (D_sechellia_CG2034-PB: 0.046237, D_simulans_CG2034-PB: 0.003666): 0.035423, ((D_yakuba_CG2034-PB: 0.067464, D_erecta_CG2034-PB: 0.110369): 0.085132, ((D_biarmipes_CG2034-PB: 0.142678, D_suzukii_CG2034-PB: 0.089465): 0.185502, D_eugracilis_CG2034-PB: 0.310877): 0.110470): 0.093329); Detailed output identifying parameters kappa (ts/tv) = 2.32398 Parameters in M7 (beta): p = 0.13646 q = 0.87028 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00005 0.00056 0.00356 0.01547 0.05238 0.14775 0.35928 0.75493 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 9..1 0.038 602.1 162.9 0.1334 0.0054 0.0402 3.2 6.6 9..10 0.035 602.1 162.9 0.1334 0.0050 0.0371 3.0 6.0 10..2 0.046 602.1 162.9 0.1334 0.0065 0.0485 3.9 7.9 10..3 0.004 602.1 162.9 0.1334 0.0005 0.0038 0.3 0.6 9..11 0.093 602.1 162.9 0.1334 0.0131 0.0979 7.9 15.9 11..12 0.085 602.1 162.9 0.1334 0.0119 0.0893 7.2 14.5 12..4 0.067 602.1 162.9 0.1334 0.0094 0.0707 5.7 11.5 12..5 0.110 602.1 162.9 0.1334 0.0154 0.1157 9.3 18.8 11..13 0.110 602.1 162.9 0.1334 0.0155 0.1158 9.3 18.9 13..14 0.186 602.1 162.9 0.1334 0.0259 0.1945 15.6 31.7 14..6 0.143 602.1 162.9 0.1334 0.0200 0.1496 12.0 24.4 14..7 0.089 602.1 162.9 0.1334 0.0125 0.0938 7.5 15.3 13..8 0.311 602.1 162.9 0.1334 0.0435 0.3259 26.2 53.1 Time used: 2:04 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (2, 3), ((4, 5), ((6, 7), 8))); MP score: 263 lnL(ntime: 13 np: 18): -2330.454256 +0.000000 9..1 9..10 10..2 10..3 9..11 11..12 12..4 12..5 11..13 13..14 14..6 14..7 13..8 0.039028 0.036070 0.047063 0.003726 0.095622 0.086922 0.070428 0.116944 0.119644 0.195324 0.150409 0.093160 0.331247 2.384772 0.992983 0.164580 1.173140 5.616041 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.38559 (1: 0.039028, (2: 0.047063, 3: 0.003726): 0.036070, ((4: 0.070428, 5: 0.116944): 0.086922, ((6: 0.150409, 7: 0.093160): 0.195324, 8: 0.331247): 0.119644): 0.095622); (D_melanogaster_CG2034-PB: 0.039028, (D_sechellia_CG2034-PB: 0.047063, D_simulans_CG2034-PB: 0.003726): 0.036070, ((D_yakuba_CG2034-PB: 0.070428, D_erecta_CG2034-PB: 0.116944): 0.086922, ((D_biarmipes_CG2034-PB: 0.150409, D_suzukii_CG2034-PB: 0.093160): 0.195324, D_eugracilis_CG2034-PB: 0.331247): 0.119644): 0.095622); Detailed output identifying parameters kappa (ts/tv) = 2.38477 Parameters in M8 (beta&w>1): p0 = 0.99298 p = 0.16458 q = 1.17314 (p1 = 0.00702) w = 5.61604 dN/dS (w) for site classes (K=11) p: 0.09930 0.09930 0.09930 0.09930 0.09930 0.09930 0.09930 0.09930 0.09930 0.09930 0.00702 w: 0.00000 0.00001 0.00017 0.00135 0.00622 0.02110 0.05855 0.14151 0.31148 0.65597 5.61604 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 9..1 0.039 601.7 163.3 0.1582 0.0061 0.0385 3.7 6.3 9..10 0.036 601.7 163.3 0.1582 0.0056 0.0356 3.4 5.8 10..2 0.047 601.7 163.3 0.1582 0.0073 0.0464 4.4 7.6 10..3 0.004 601.7 163.3 0.1582 0.0006 0.0037 0.3 0.6 9..11 0.096 601.7 163.3 0.1582 0.0149 0.0943 9.0 15.4 11..12 0.087 601.7 163.3 0.1582 0.0136 0.0857 8.2 14.0 12..4 0.070 601.7 163.3 0.1582 0.0110 0.0695 6.6 11.3 12..5 0.117 601.7 163.3 0.1582 0.0183 0.1154 11.0 18.8 11..13 0.120 601.7 163.3 0.1582 0.0187 0.1180 11.2 19.3 13..14 0.195 601.7 163.3 0.1582 0.0305 0.1927 18.3 31.5 14..6 0.150 601.7 163.3 0.1582 0.0235 0.1484 14.1 24.2 14..7 0.093 601.7 163.3 0.1582 0.0145 0.0919 8.7 15.0 13..8 0.331 601.7 163.3 0.1582 0.0517 0.3268 31.1 53.4 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG2034-PB) Pr(w>1) post mean +- SE for w 68 D 0.950 5.366 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG2034-PB) Pr(w>1) post mean +- SE for w 15 V 0.511 1.040 +- 0.649 63 D 0.861 1.540 +- 0.711 68 D 0.948 1.639 +- 0.732 69 S 0.648 1.246 +- 0.612 170 Q 0.857 1.543 +- 0.754 230 S 0.519 1.057 +- 0.682 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.005 0.039 0.107 0.175 0.218 0.232 0.225 ws: 0.892 0.077 0.015 0.006 0.003 0.002 0.002 0.001 0.001 0.001 Time used: 3:38
Model 1: NearlyNeutral -2332.085329 Model 2: PositiveSelection -2331.58815 Model 0: one-ratio -2363.002381 Model 3: discrete -2331.539283 Model 7: beta -2332.170787 Model 8: beta&w>1 -2330.454256 Model 0 vs 1 61.83410399999957 Model 2 vs 1 0.9943579999999201 Model 8 vs 7 3.4330620000000636