--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Nov 17 16:51:53 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/100/CG2034-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2621.36         -2634.89
2      -2621.59         -2637.33
--------------------------------------
TOTAL    -2621.47         -2636.72
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.779663    0.006734    0.629642    0.943847    0.773218   1203.55   1352.28    1.001
r(A<->C){all}   0.086651    0.000400    0.051370    0.128583    0.085229   1218.04   1230.31    1.000
r(A<->G){all}   0.238300    0.001321    0.173523    0.312639    0.235503    614.91    777.70    1.000
r(A<->T){all}   0.197501    0.001655    0.120352    0.277447    0.195508    929.44    932.23    1.000
r(C<->G){all}   0.044300    0.000146    0.020022    0.067380    0.043567    961.68   1064.80    1.000
r(C<->T){all}   0.324947    0.001799    0.242997    0.409177    0.323865    889.23    944.60    1.000
r(G<->T){all}   0.108302    0.000646    0.062211    0.160564    0.106249    673.98    728.17    1.000
pi(A){all}      0.221604    0.000168    0.196999    0.247555    0.221297   1155.00   1307.61    1.000
pi(C){all}      0.329344    0.000222    0.302974    0.360473    0.329315   1342.36   1359.13    1.000
pi(G){all}      0.278205    0.000209    0.252199    0.307758    0.277970   1081.96   1119.08    1.000
pi(T){all}      0.170846    0.000137    0.147577    0.192946    0.170569    936.55   1014.05    1.000
alpha{1,2}      0.134058    0.001498    0.052669    0.210920    0.134628   1108.09   1192.13    1.000
alpha{3}        2.319434    0.740613    1.004297    4.143426    2.182697    989.25   1180.87    1.000
pinvar{all}     0.188331    0.008083    0.004948    0.336468    0.192165    996.61   1205.45    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2332.085329
Model 2: PositiveSelection	-2331.58815
Model 0: one-ratio	-2363.002381
Model 3: discrete	-2331.539283
Model 7: beta	-2332.170787
Model 8: beta&w>1	-2330.454256


Model 0 vs 1	61.83410399999957

Model 2 vs 1	0.9943579999999201

Model 8 vs 7	3.4330620000000636
>C1
MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYANNNTGSTTDSNSTGFNVILPTLADLLCYQTPAFI
FGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCEYLAELVLRLESD
KLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLPAGASPKQPSPEA
EQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSEGNIIYTPDADDD
FDEEDPDEDLCIoooooooooooo
>C2
MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYANNNTGSTTDSNFTGFNVILPTLADLLCYQTPAFI
FGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCEYLAELVLRLETD
KLLSLISRKPGGGVTNRRYSCEVSKTQFKVTPLDGGRPAGASSKQPSPEA
EQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPEGNIIYTPDADDD
FDEEDPDEDLCIoooooooooooo
>C3
MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYANNNTGSTTDPNFTGFNVILPTLADLLCYQTPAFI
FGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCEYLAELVLRLESD
KLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLPAGASPKQPSPEA
EQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPEGNIIYTPDADDD
FDEEDPDEDLCIoooooooooooo
>C4
MLSNLVVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV
SLKHVATFEALITECANTKNNNTASSPRSKSTGFNVILPTLADLLCYQTP
AFIFGFLNRLRRSENVCRVFLWASPQHLQNPHADYILAGCEYLAELVLRL
ESDKLLSLISRKPGGGVSNRRYSCQVSKTSFQVTPLDGGLPAGASPKQPS
PESEQTPEPASSTFKIELDEDEVVARNALTLPYERTCEPSEGNIIYTPDA
DDDFDEEDPDEDLCIooooooooo
>C5
MLSNLLVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV
SLKHVATFEALIGECANHKNNNTGSIPGSKATGFNVILPTLADLLCYQTP
AFIFGFLNRLRRSENVCRVFLWASPQHLQNPHAEYILAGCEYLAELVLRL
ESDKLLSLISRKPGGAVSNKRYSCQVSKTFFQVTPLDGGLPAGGSPKQPS
PETEQTPEPASSTFKIELDEDEVMARNALTLPYERTCEPSEGNIIYTPDA
DDDFDEEDPDEDLCIooooooooo
>C6
MLSNLLVTKQKLVLVIDKLNRERIAPKFIGSLLHEQGQGTETIKALPTGV
SLKLVATFEALLSECANQNNNNNTAGTPGSGAGKPAGFNVILPTLADLLC
YQSPAFIFGFLNRLRRSEHVRRVFLWASPQHLQHPHAEYILAGCEYLAEL
VLRLETDKQLSLISRKPGGGVTNRRFACQISKTEFQVTPLDEGQPAGASP
KQSSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPTEGNIIY
TPDADDDFDEEDPDEDLCIooooo
>C7
MLSNLLVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGTETIKTLPTGI
SLKHVATFEALIAECANQNNTGKPSGFNVILPTLADLLCYQSPAFIFSFL
NRLRRSEHVRRVFLWASPQHLQHPHADYILAGCEYLAELVLRLETDKLLS
LISRKPGGGVSNRRFACQVSKTQFQVTPLDEGLPTGVSPKQPTPEAEQTP
EPASSTFKIELDEDEMVARNALTLPYERTSEPTEGNIIYTPDADDDFDEE
DPDEDLCIoooooooooooooooo
>C8
MLSNLVVTNQKVVLIIDELNRERIAPKFIGSLLHEQGQGTDTIKALPTGV
SLKHVATFESLIDECANHNNNNTPAGEVGDVDAVTPGSKSTGFNVILPTL
ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPHHLQHPHAAYILAGCE
YLAKLVLRLETDKLLSIISRKPGGGVTNRRFSCQVSKTQFLVTPVDGGLP
AGVSPKQPSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPSE
GNIIYTPDADDDFDEEDPDEDLCI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=290 

C1              MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
C2              MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
C3              MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
C4              MLSNLVVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV
C5              MLSNLLVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV
C6              MLSNLLVTKQKLVLVIDKLNRERIAPKFIGSLLHEQGQGTETIKALPTGV
C7              MLSNLLVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGTETIKTLPTGI
C8              MLSNLVVTNQKVVLIIDELNRERIAPKFIGSLLHEQGQGTDTIKALPTGV
                *****:**:**:**:**:*********************::***:****:

C1              SLKHVATFEALIDKYAN---NNTGS---------TTDSNSTGFNVILPTL
C2              SLKHVATFEALIDKYAN---NNTGS---------TTDSNFTGFNVILPTL
C3              SLKHVATFEALIDKYAN---NNTGS---------TTDPNFTGFNVILPTL
C4              SLKHVATFEALITECANTKNNNTAS---------SPRSKSTGFNVILPTL
C5              SLKHVATFEALIGECANHKNNNTGS---------IPGSKATGFNVILPTL
C6              SLKLVATFEALLSECANQNNNNNTAGTPG-----SGAGKPAGFNVILPTL
C7              SLKHVATFEALIAECANQNN----------------TGKPSGFNVILPTL
C8              SLKHVATFESLIDECANHNNNNTPAGEVGDVDAVTPGSKSTGFNVILPTL
                *** *****:*: : **                     : :*********

C1              ADLLCYQTPAFIFGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCE
C2              ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE
C3              ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE
C4              ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHADYILAGCE
C5              ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHAEYILAGCE
C6              ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPQHLQHPHAEYILAGCE
C7              ADLLCYQSPAFIFSFLNRLRRSEHVRRVFLWASPQHLQHPHADYILAGCE
C8              ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPHHLQHPHAAYILAGCE
                *******:*****.********::* ********:***.*** *******

C1              YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP
C2              YLAELVLRLETDKLLSLISRKPGGGVTNRRYSCEVSKTQFKVTPLDGGRP
C3              YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP
C4              YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCQVSKTSFQVTPLDGGLP
C5              YLAELVLRLESDKLLSLISRKPGGAVSNKRYSCQVSKTFFQVTPLDGGLP
C6              YLAELVLRLETDKQLSLISRKPGGGVTNRRFACQISKTEFQVTPLDEGQP
C7              YLAELVLRLETDKLLSLISRKPGGGVSNRRFACQVSKTQFQVTPLDEGLP
C8              YLAKLVLRLETDKLLSIISRKPGGGVTNRRFSCQVSKTQFLVTPVDGGLP
                ***:******:** **:*******.*:*:*::*::*** * ***:* * *

C1              AGASPKQPSPEAEQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSE
C2              AGASSKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE
C3              AGASPKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE
C4              AGASPKQPSPESEQTPEPASSTFKIELDEDEVVARNALTLPYERTCEPSE
C5              AGGSPKQPSPETEQTPEPASSTFKIELDEDEVMARNALTLPYERTCEPSE
C6              AGASPKQSSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPTE
C7              TGVSPKQPTPEAEQTPEPASSTFKIELDEDEMVARNALTLPYERTSEPTE
C8              AGVSPKQPSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPSE
                :* *.**.:**:***.***************::************.**.*

C1              GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo----
C2              GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo----
C3              GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo----
C4              GNIIYTPDADDDFDEEDPDEDLCIooooooooo-------
C5              GNIIYTPDADDDFDEEDPDEDLCIooooooooo-------
C6              GNIIYTPDADDDFDEEDPDEDLCIooooo-----------
C7              GNIIYTPDADDDFDEEDPDEDLCIoooooooooooooooo
C8              GNIIYTPDADDDFDEEDPDEDLCI----------------
                ************************                




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  274 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  274 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21128]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [21128]--->[18506]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/100/CG2034-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.464 Mb, Max= 31.039 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYAN---NNTGS---------TTDSNSTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCE
YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP
AGASPKQPSPEAEQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSE
GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo----
>C2
MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYAN---NNTGS---------TTDSNFTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE
YLAELVLRLETDKLLSLISRKPGGGVTNRRYSCEVSKTQFKVTPLDGGRP
AGASSKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE
GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo----
>C3
MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYAN---NNTGS---------TTDPNFTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE
YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP
AGASPKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE
GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo----
>C4
MLSNLVVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV
SLKHVATFEALITECANTKNNNTAS---------SPRSKSTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHADYILAGCE
YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCQVSKTSFQVTPLDGGLP
AGASPKQPSPESEQTPEPASSTFKIELDEDEVVARNALTLPYERTCEPSE
GNIIYTPDADDDFDEEDPDEDLCIooooooooo-------
>C5
MLSNLLVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV
SLKHVATFEALIGECANHKNNNTGS---------IPGSKATGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHAEYILAGCE
YLAELVLRLESDKLLSLISRKPGGAVSNKRYSCQVSKTFFQVTPLDGGLP
AGGSPKQPSPETEQTPEPASSTFKIELDEDEVMARNALTLPYERTCEPSE
GNIIYTPDADDDFDEEDPDEDLCIooooooooo-------
>C6
MLSNLLVTKQKLVLVIDKLNRERIAPKFIGSLLHEQGQGTETIKALPTGV
SLKLVATFEALLSECANQNNNNNTAGTPG-----SGAGKPAGFNVILPTL
ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPQHLQHPHAEYILAGCE
YLAELVLRLETDKQLSLISRKPGGGVTNRRFACQISKTEFQVTPLDEGQP
AGASPKQSSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPTE
GNIIYTPDADDDFDEEDPDEDLCIooooo-----------
>C7
MLSNLLVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGTETIKTLPTGI
SLKHVATFEALIAECANQNN----------------TGKPSGFNVILPTL
ADLLCYQSPAFIFSFLNRLRRSEHVRRVFLWASPQHLQHPHADYILAGCE
YLAELVLRLETDKLLSLISRKPGGGVSNRRFACQVSKTQFQVTPLDEGLP
TGVSPKQPTPEAEQTPEPASSTFKIELDEDEMVARNALTLPYERTSEPTE
GNIIYTPDADDDFDEEDPDEDLCIoooooooooooooooo
>C8
MLSNLVVTNQKVVLIIDELNRERIAPKFIGSLLHEQGQGTDTIKALPTGV
SLKHVATFESLIDECANHNNNNTPAGEVGDVDAVTPGSKSTGFNVILPTL
ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPHHLQHPHAAYILAGCE
YLAKLVLRLETDKLLSIISRKPGGGVTNRRFSCQVSKTQFLVTPVDGGLP
AGVSPKQPSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPSE
GNIIYTPDADDDFDEEDPDEDLCI----------------

FORMAT of file /tmp/tmp7865505796080635989aln Not Supported[FATAL:T-COFFEE]
>C1
MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYAN---NNTGS---------TTDSNSTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCE
YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP
AGASPKQPSPEAEQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSE
GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo----
>C2
MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYAN---NNTGS---------TTDSNFTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE
YLAELVLRLETDKLLSLISRKPGGGVTNRRYSCEVSKTQFKVTPLDGGRP
AGASSKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE
GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo----
>C3
MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYAN---NNTGS---------TTDPNFTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE
YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP
AGASPKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE
GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo----
>C4
MLSNLVVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV
SLKHVATFEALITECANTKNNNTAS---------SPRSKSTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHADYILAGCE
YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCQVSKTSFQVTPLDGGLP
AGASPKQPSPESEQTPEPASSTFKIELDEDEVVARNALTLPYERTCEPSE
GNIIYTPDADDDFDEEDPDEDLCIooooooooo-------
>C5
MLSNLLVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV
SLKHVATFEALIGECANHKNNNTGS---------IPGSKATGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHAEYILAGCE
YLAELVLRLESDKLLSLISRKPGGAVSNKRYSCQVSKTFFQVTPLDGGLP
AGGSPKQPSPETEQTPEPASSTFKIELDEDEVMARNALTLPYERTCEPSE
GNIIYTPDADDDFDEEDPDEDLCIooooooooo-------
>C6
MLSNLLVTKQKLVLVIDKLNRERIAPKFIGSLLHEQGQGTETIKALPTGV
SLKLVATFEALLSECANQNNNNNTAGTPG-----SGAGKPAGFNVILPTL
ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPQHLQHPHAEYILAGCE
YLAELVLRLETDKQLSLISRKPGGGVTNRRFACQISKTEFQVTPLDEGQP
AGASPKQSSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPTE
GNIIYTPDADDDFDEEDPDEDLCIooooo-----------
>C7
MLSNLLVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGTETIKTLPTGI
SLKHVATFEALIAECANQNN----------------TGKPSGFNVILPTL
ADLLCYQSPAFIFSFLNRLRRSEHVRRVFLWASPQHLQHPHADYILAGCE
YLAELVLRLETDKLLSLISRKPGGGVSNRRFACQVSKTQFQVTPLDEGLP
TGVSPKQPTPEAEQTPEPASSTFKIELDEDEMVARNALTLPYERTSEPTE
GNIIYTPDADDDFDEEDPDEDLCIoooooooooooooooo
>C8
MLSNLVVTNQKVVLIIDELNRERIAPKFIGSLLHEQGQGTDTIKALPTGV
SLKHVATFESLIDECANHNNNNTPAGEVGDVDAVTPGSKSTGFNVILPTL
ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPHHLQHPHAAYILAGCE
YLAKLVLRLETDKLLSIISRKPGGGVTNRRFSCQVSKTQFLVTPVDGGLP
AGVSPKQPSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPSE
GNIIYTPDADDDFDEEDPDEDLCI----------------
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:290 S:94 BS:290
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# PW_SEQ_DISTANCES 
BOT	    0    1	 96.72 C1	 C2	 96.72
TOP	    1    0	 96.72 C2	 C1	 96.72
BOT	    0    2	 97.81 C1	 C3	 97.81
TOP	    2    0	 97.81 C3	 C1	 97.81
BOT	    0    3	 92.62 C1	 C4	 92.62
TOP	    3    0	 92.62 C4	 C1	 92.62
BOT	    0    4	 90.77 C1	 C5	 90.77
TOP	    4    0	 90.77 C5	 C1	 90.77
BOT	    0    5	 85.02 C1	 C6	 85.02
TOP	    5    0	 85.02 C6	 C1	 85.02
BOT	    0    6	 88.39 C1	 C7	 88.39
TOP	    6    0	 88.39 C7	 C1	 88.39
BOT	    0    7	 89.31 C1	 C8	 89.31
TOP	    7    0	 89.31 C8	 C1	 89.31
BOT	    1    2	 98.18 C2	 C3	 98.18
TOP	    2    1	 98.18 C3	 C2	 98.18
BOT	    1    3	 90.77 C2	 C4	 90.77
TOP	    3    1	 90.77 C4	 C2	 90.77
BOT	    1    4	 89.30 C2	 C5	 89.30
TOP	    4    1	 89.30 C5	 C2	 89.30
BOT	    1    5	 85.77 C2	 C6	 85.77
TOP	    5    1	 85.77 C6	 C2	 85.77
BOT	    1    6	 88.01 C2	 C7	 88.01
TOP	    6    1	 88.01 C7	 C2	 88.01
BOT	    1    7	 89.69 C2	 C8	 89.69
TOP	    7    1	 89.69 C8	 C2	 89.69
BOT	    2    3	 91.88 C3	 C4	 91.88
TOP	    3    2	 91.88 C4	 C3	 91.88
BOT	    2    4	 90.41 C3	 C5	 90.41
TOP	    4    2	 90.41 C5	 C3	 90.41
BOT	    2    5	 85.39 C3	 C6	 85.39
TOP	    5    2	 85.39 C6	 C3	 85.39
BOT	    2    6	 88.76 C3	 C7	 88.76
TOP	    6    2	 88.76 C7	 C3	 88.76
BOT	    2    7	 89.31 C3	 C8	 89.31
TOP	    7    2	 89.31 C8	 C3	 89.31
BOT	    3    4	 94.89 C4	 C5	 94.89
TOP	    4    3	 94.89 C5	 C4	 94.89
BOT	    3    5	 86.67 C4	 C6	 86.67
TOP	    5    3	 86.67 C6	 C4	 86.67
BOT	    3    6	 89.14 C4	 C7	 89.14
TOP	    6    3	 89.14 C7	 C4	 89.14
BOT	    3    7	 89.43 C4	 C8	 89.43
TOP	    7    3	 89.43 C8	 C4	 89.43
BOT	    4    5	 85.56 C5	 C6	 85.56
TOP	    5    4	 85.56 C6	 C5	 85.56
BOT	    4    6	 88.01 C5	 C7	 88.01
TOP	    6    4	 88.01 C7	 C5	 88.01
BOT	    4    7	 88.30 C5	 C8	 88.30
TOP	    7    4	 88.30 C8	 C5	 88.30
BOT	    5    6	 92.02 C6	 C7	 92.02
TOP	    6    5	 92.02 C7	 C6	 92.02
BOT	    5    7	 86.62 C6	 C8	 86.62
TOP	    7    5	 86.62 C8	 C6	 86.62
BOT	    6    7	 89.53 C7	 C8	 89.53
TOP	    7    6	 89.53 C8	 C7	 89.53
AVG	 0	 C1	  *	 91.52
AVG	 1	 C2	  *	 91.21
AVG	 2	 C3	  *	 91.68
AVG	 3	 C4	  *	 90.77
AVG	 4	 C5	  *	 89.61
AVG	 5	 C6	  *	 86.72
AVG	 6	 C7	  *	 89.12
AVG	 7	 C8	  *	 88.89
TOT	 TOT	  *	 89.94
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCTCTCCAACCTGGTGGTGACCAAGCAGAAAGTGGTCCTCGTAATAGA
C2              ATGCTCTCCAACCTGGTGGTCACCAAGCAGAAAGTGGTCCTCATAATAGA
C3              ATGCTCTCCAACCTGGTGGTCACCAAGCAGAAAGTGGTCCTCATAATAGA
C4              ATGCTCTCCAACCTGGTGGTGACCAATCAGAAAGTGGTCCTCGTAATAGA
C5              ATGCTCTCCAACCTGTTGGTGACCAATCAGAAAGTGGTCCTCGTTATAGA
C6              ATGCTCTCCAACCTGCTGGTGACCAAACAAAAGCTGGTCCTCGTAATAGA
C7              ATGCTCTCCAACCTGCTGGTGACCAAACAAAAAGTGGTCCTCGTAATAGA
C8              ATGCTTTCAAATCTTGTGGTGACCAATCAAAAAGTGGTCCTCATAATAGA
                ***** **.** **  **** ***** **.**. ********.*:*****

C1              TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGTCTGCTGC
C2              TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
C3              TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
C4              TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGTCTGCTGC
C5              TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
C6              TAAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
C7              TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
C8              TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCTTGCTTC
                *.****************************************  **** *

C1              ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTGCCCACCGGCGTC
C2              ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTCCCCACCGGCGTC
C3              ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTCCCCACCGGCGTC
C4              ACGAGCAGGGACAGGGGGCGGAAACCATCAAGGCCCTGCCCACCGGCGTC
C5              ACGAGCAGGGACAGGGGGCGGAAACTATCAAGGCCCTGCCCACCGGCGTC
C6              ACGAGCAGGGCCAGGGGACGGAGACCATCAAGGCCCTGCCCACCGGCGTC
C7              ACGAACAGGGCCAGGGGACGGAGACCATCAAGACCCTGCCCACCGGCATC
C8              ACGAACAGGGACAGGGGACAGATACAATCAAGGCCTTGCCCACCGGCGTC
                ****.*****.******.*.** ** ******.** * *********.**

C1              AGCCTTAAGCACGTGGCCACCTTCGAGGCACTGATCGACAAGTACGCCAA
C2              AGCCTGAAGCACGTGGCCACCTTTGAGGCACTGATCGACAAGTACGCCAA
C3              AGCCTGAAGCACGTGGCCACCTTCGAGGCACTGATCGACAAGTACGCCAA
C4              AGCCTGAAGCACGTGGCCACCTTCGAGGCGCTGATCACCGAGTGCGCCAA
C5              AGTCTGAAGCACGTGGCCACCTTCGAGGCGCTGATTGGCGAGTGCGCCAA
C6              AGCCTCAAGCTCGTGGCCACCTTCGAGGCGCTGCTCTCGGAGTGCGCCAA
C7              AGCCTGAAGCACGTGGCCACCTTCGAGGCACTGATCGCCGAGTGCGCCAA
C8              AGTCTGAAGCACGTGGCCACCTTCGAATCGCTGATCGACGAGTGCGCCAA
                ** ** ****:************ **. *.***.*    .***.******

C1              C---------AACAACACTGGGAGT-------------------------
C2              C---------AACAACACTGGGAGT-------------------------
C3              C---------AACAACACTGGGAGT-------------------------
C4              CACCAAAAACAACAACACTGCGAGC-------------------------
C5              CCACAAAAACAACAACACTGGGAGC-------------------------
C6              CCAAAACAACAACAACAACACTGCGGGCACTCCGGGC-------------
C7              CCAAAACAAC----------------------------------------
C8              CCATAACAACAACAACACCCCTGCCGGAGAAGTGGGCGACGTGGATGCGG
                *                                                 

C1              --ACTACGGATTCCAACTCCACTGGCTTTAACGTCATCCTGCCAACATTG
C2              --ACTACGGATTCCAACTTCACTGGCTTTAACGTCATCCTGCCCACATTG
C3              --ACTACGGATCCCAACTTCACTGGCTTTAACGTCATCCTGCCCACATTG
C4              --AGTCCTCGCTCGAAATCCACTGGCTTCAACGTCATCCTGCCCACCTTG
C5              --ATTCCGGGATCCAAAGCCACTGGCTTCAACGTCATCCTGCCCACCTTG
C6              --TCAGGAGCAGGAAAGCCCGCCGGTTTCAACGTCATCCTGCCCACACTG
C7              --------ACAGGGAAACCCTCCGGCTTCAACGTCATCCTGCCCACACTG
C8              TTACTCCGGGATCGAAATCTACCGGCTTCAACGTCATCCTGCCCACCTTG
                              **     * ** ** **************.**. **

C1              GCAGACCTGCTGTGCTACCAGACGCCTGCTTTCATATTTGGCTTCCTCAA
C2              GCCGACCTGCTGTGCTACCAGACGCCCGCTTTCATATTTGGCTTTCTCAA
C3              GCCGACCTGCTGTGCTACCAGACGCCCGCTTTCATATTTGGCTTCCTCAA
C4              GCCGATCTGCTGTGCTACCAGACGCCCGCTTTCATCTTTGGCTTCCTCAA
C5              GCCGACCTGCTGTGCTACCAGACGCCCGCCTTCATCTTTGGCTTCCTCAA
C6              GCCGACCTGCTGTGCTACCAGTCGCCCGCCTTCATCTTTGGCTTCCTCAA
C7              GCCGACCTGCTGTGCTACCAGTCGCCCGCCTTTATCTTTAGCTTCCTCAA
C8              GCTGACCTGCTGTGCTATCAGTCGCCCGCTTTTATTTTTGGCTTCCTTAA
                ** ** *********** ***:**** ** ** ** ***.**** ** **

C1              CCGCCTACGCCGCTCGGACAATGTGCGTCGGGTTTTCCTTTGGGCCTCCC
C2              CCGCCTACGACGCTCGGAAAATGTGCGTCGGGTGTTCCTTTGGGCCTCCC
C3              CCGCCTACGACGCTCGGAAAATGTGCGTCGGGTGTTCCTTTGGGCCTCCC
C4              CCGCCTGCGGCGCTCGGAGAATGTGTGCCGTGTGTTCCTGTGGGCCTCCC
C5              CCGCCTGCGGCGCTCGGAGAACGTGTGCCGCGTGTTCCTGTGGGCCTCCC
C6              CCGCCTGCGTCGTTCGGAGCACGTGCGTCGTGTGTTCCTCTGGGCCTCCC
C7              CCGCCTGCGTCGCTCGGAGCACGTGCGTCGTGTGTTCCTCTGGGCCTCCC
C8              CCGCCTACGTCGCTCGGAGCATGTGCGTCGAGTGTTCCTCTGGGCTTCCC
                ******.** ** ***** .* *** * ** ** ***** ***** ****

C1              CGCAGCACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG
C2              CGCAACACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG
C3              CGCAGCACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG
C4              CGCAGCACCTACAGAATCCCCATGCCGACTACATCCTGGCGGGCTGCGAG
C5              CACAACACTTACAGAATCCCCATGCCGAATACATCCTGGCTGGCTGCGAG
C6              CGCAGCACCTGCAGCATCCGCATGCGGAGTACATCCTGGCTGGCTGCGAG
C7              CGCAGCACCTCCAGCATCCCCATGCCGACTACATCCTGGCTGGCTGCGAG
C8              CGCACCATCTGCAGCATCCTCATGCTGCCTACATTCTGGCTGGCTGCGAA
                *.** **  * *** **** ***** *. ***** ***** ********.

C1              TACCTGGCCGAGCTGGTCCTCCGACTGGAATCGGACAAACTACTCTCGCT
C2              TACCTGGCCGAGCTGGTCCTCCGACTGGAAACGGACAAACTACTCTCGCT
C3              TACCTGGCCGAGCTGGTCCTCCGACTGGAATCGGACAAACTACTCTCGCT
C4              TACCTGGCCGAGTTGGTCCTACGACTAGAATCCGACAAATTACTCTCACT
C5              TACCTGGCCGAGTTGGTCCTACGACTGGAATCCGACAAATTACTCTCGCT
C6              TACCTGGCGGAGTTGGTCCTTCGCCTGGAGACGGACAAGCAACTATCGCT
C7              TACCTGGCGGAGCTGGTGCTTCGCCTGGAGACGGACAAGCTACTATCACT
C8              TACTTGGCCAAGTTGGTGCTCCGCTTGGAAACAGACAAGCTACTGTCCAT
                *** **** .** **** ** **. *.**.:* *****. :*** ** .*

C1              GATATCACGCAAGCCGGGCGGAGGGGTGTCCAACAGGCGCTACTCCTGCG
C2              GATATCACGCAAGCCGGGTGGAGGGGTGACCAACAGGCGCTACTCCTGCG
C3              GATATCACGCAAGCCGGGCGGAGGGGTGTCCAACAGGCGCTACTCCTGCG
C4              GATTTCAAGAAAGCCGGGCGGTGGGGTGTCCAACAGGCGCTACTCCTGCC
C5              GATTTCACGCAAGCCGGGCGGTGCGGTGTCCAACAAGCGCTACTCCTGCC
C6              GATATCGCGTAAACCCGGTGGCGGAGTGACCAACAGGCGCTTCGCCTGCC
C7              GATATCGCGCAAACCCGGTGGCGGGGTGTCCAACAGGCGGTTCGCCTGCC
C8              AATATCACGCAAGCCGGGCGGAGGAGTTACAAACAGACGCTTCTCATGCC
                .**:**..* **.** ** ** * .** :*.****..** *:* *.*** 

C1              AAGTCAGCAAAACCCAGTTCAAGGTGACGCCGCTGGACGGAGGACTGCCT
C2              AAGTCAGCAAAACCCAATTTAAGGTGACGCCGCTTGACGGAGGACGTCCT
C3              AAGTCAGCAAAACCCAGTTCAAGGTGACGCCGCTGGACGGAGGACTTCCT
C4              AAGTCAGCAAAACCTCTTTCCAGGTAACGCCGCTGGACGGAGGACTACCT
C5              AAGTCAGCAAAACCTTTTTCCAGGTGACGCCGCTGGACGGAGGGCTACCT
C6              AGATCAGCAAGACCGAGTTCCAGGTGACGCCGCTGGACGAAGGACAGCCC
C7              AGGTCAGCAAGACCCAGTTCCAGGTGACGCCGCTTGACGAAGGGCTGCCC
C8              AGGTCAGCAAAACCCAGTTCCTGGTGACGCCGGTGGACGGAGGACTCCCG
                *..*******.***   ** .:***.****** * ****.***.*  ** 

C1              GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCACAGA
C2              GCAGGTGCCTCCTCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCCCAGA
C3              GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCCCAGA
C4              GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAATCGGAGCAGACCCCAGA
C5              GCAGGTGGCTCCCCCAAGCAGCCCTCGCCCGAGACGGAGCAGACCCCAGA
C6              GCAGGAGCCTCACCCAAACAGTCTTCCCCGGAGGCGGAGCAAACCCCAGA
C7              ACAGGTGTCTCACCCAAACAGCCTACCCCGGAGGCGGAGCAAACCCCAGA
C8              GCAGGTGTCTCTCCCAAGCAGCCCTCGCCAGAGGCAGAGCAAACCCCAGA
                .****:* ***  ****.*** * :* ** **. *.*****.***.****

C1              GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAAGTGTTGG
C2              GCCGGCCAGCAGCACCTTTAAAATCGAGCTTGACGAGGATGAAGTGCTGG
C3              GCCGGCCAGCAGCACCTTTAAAATCGAGCTTGACGAGGATGAAGTGCTGG
C4              GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAAGTGGTGG
C5              GCCGGCCAGCAGCACCTTCAAAATCGAACTTGACGAGGATGAAGTGATGG
C6              GCCGGCCAGCAGCACCTTCAAAATCGAGCTCGACGAGGACGAGGTGGTGG
C7              GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAGATGGTGG
C8              ACCGGCCAGCAGCACCTTTAAGATCGAGCTCGACGAGGATGAAGTGGTTG
                .***************** **.*****.** ******** **..** * *

C1              CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGTCTGAG
C2              CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGCCTGAG
C3              CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGCCTGAG
C4              CCCGCAATGCACTCACCCTTCCATACGAACGCACATGCGAACCGTCTGAG
C5              CCCGCAATGCACTCACCCTGCCATACGAACGCACGTGCGAGCCGTCTGAG
C6              CCCGCAATGCACTCACCCTGCCATACGAACGCACCAGCGAGCCGACCGAG
C7              CCCGCAATGCACTCACCCTGCCATATGAACGCACCAGCGAGCCGACTGAG
C8              CTCGCAATGCACTTACCCTGCCATACGAACGCACAAGCGAGCCGTCCGAG
                * *********** ***** ***** ******** : ***.*** * ***

C1              GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA
C2              GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA
C3              GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA
C4              GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA
C5              GGAAACATAATATACACGCCCGATGCCGACGATGATTTCGACGAGGAGGA
C6              GGCAACATTATATACACACCCGATGCCGACGACGACTTCGACGAGGAGGA
C7              GGCAACATCATATACACACCCGATGCTGACGACGACTTCGATGAGGAGGA
C8              GGAAACATTATATACACGCCCGATGCCGACGACGACTTTGATGAGGAGGA
                **.***** ********.******** ***** ** ** ** ********

C1              TCCGGACGAGGATCTGTGCATC----------------------------
C2              TCCGGACGAGGATCTGTGCATC----------------------------
C3              TCCGGACGAGGATCTGTGCATC----------------------------
C4              TCCGGACGAGGATCTGTGCATC----------------------------
C5              TCCGGACGAGGATCTGTGCATC----------------------------
C6              TCCGGACGAGGATCTGTGCATC----------------------------
C7              TCCGGACGAGGATCTGTGCATC----------------------------
C8              TCCTGACGAGGATCTGTGCATC----------------------------
                *** ******************                            

C1              --------------------
C2              --------------------
C3              --------------------
C4              --------------------
C5              --------------------
C6              --------------------
C7              --------------------
C8              --------------------
                                    



>C1
ATGCTCTCCAACCTGGTGGTGACCAAGCAGAAAGTGGTCCTCGTAATAGA
TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGTCTGCTGC
ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTGCCCACCGGCGTC
AGCCTTAAGCACGTGGCCACCTTCGAGGCACTGATCGACAAGTACGCCAA
C---------AACAACACTGGGAGT-------------------------
--ACTACGGATTCCAACTCCACTGGCTTTAACGTCATCCTGCCAACATTG
GCAGACCTGCTGTGCTACCAGACGCCTGCTTTCATATTTGGCTTCCTCAA
CCGCCTACGCCGCTCGGACAATGTGCGTCGGGTTTTCCTTTGGGCCTCCC
CGCAGCACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG
TACCTGGCCGAGCTGGTCCTCCGACTGGAATCGGACAAACTACTCTCGCT
GATATCACGCAAGCCGGGCGGAGGGGTGTCCAACAGGCGCTACTCCTGCG
AAGTCAGCAAAACCCAGTTCAAGGTGACGCCGCTGGACGGAGGACTGCCT
GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCACAGA
GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAAGTGTTGG
CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGTCTGAG
GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA
TCCGGACGAGGATCTGTGCATC----------------------------
--------------------
>C2
ATGCTCTCCAACCTGGTGGTCACCAAGCAGAAAGTGGTCCTCATAATAGA
TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTCCCCACCGGCGTC
AGCCTGAAGCACGTGGCCACCTTTGAGGCACTGATCGACAAGTACGCCAA
C---------AACAACACTGGGAGT-------------------------
--ACTACGGATTCCAACTTCACTGGCTTTAACGTCATCCTGCCCACATTG
GCCGACCTGCTGTGCTACCAGACGCCCGCTTTCATATTTGGCTTTCTCAA
CCGCCTACGACGCTCGGAAAATGTGCGTCGGGTGTTCCTTTGGGCCTCCC
CGCAACACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG
TACCTGGCCGAGCTGGTCCTCCGACTGGAAACGGACAAACTACTCTCGCT
GATATCACGCAAGCCGGGTGGAGGGGTGACCAACAGGCGCTACTCCTGCG
AAGTCAGCAAAACCCAATTTAAGGTGACGCCGCTTGACGGAGGACGTCCT
GCAGGTGCCTCCTCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCCCAGA
GCCGGCCAGCAGCACCTTTAAAATCGAGCTTGACGAGGATGAAGTGCTGG
CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGCCTGAG
GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA
TCCGGACGAGGATCTGTGCATC----------------------------
--------------------
>C3
ATGCTCTCCAACCTGGTGGTCACCAAGCAGAAAGTGGTCCTCATAATAGA
TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTCCCCACCGGCGTC
AGCCTGAAGCACGTGGCCACCTTCGAGGCACTGATCGACAAGTACGCCAA
C---------AACAACACTGGGAGT-------------------------
--ACTACGGATCCCAACTTCACTGGCTTTAACGTCATCCTGCCCACATTG
GCCGACCTGCTGTGCTACCAGACGCCCGCTTTCATATTTGGCTTCCTCAA
CCGCCTACGACGCTCGGAAAATGTGCGTCGGGTGTTCCTTTGGGCCTCCC
CGCAGCACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG
TACCTGGCCGAGCTGGTCCTCCGACTGGAATCGGACAAACTACTCTCGCT
GATATCACGCAAGCCGGGCGGAGGGGTGTCCAACAGGCGCTACTCCTGCG
AAGTCAGCAAAACCCAGTTCAAGGTGACGCCGCTGGACGGAGGACTTCCT
GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCCCAGA
GCCGGCCAGCAGCACCTTTAAAATCGAGCTTGACGAGGATGAAGTGCTGG
CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGCCTGAG
GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA
TCCGGACGAGGATCTGTGCATC----------------------------
--------------------
>C4
ATGCTCTCCAACCTGGTGGTGACCAATCAGAAAGTGGTCCTCGTAATAGA
TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGTCTGCTGC
ACGAGCAGGGACAGGGGGCGGAAACCATCAAGGCCCTGCCCACCGGCGTC
AGCCTGAAGCACGTGGCCACCTTCGAGGCGCTGATCACCGAGTGCGCCAA
CACCAAAAACAACAACACTGCGAGC-------------------------
--AGTCCTCGCTCGAAATCCACTGGCTTCAACGTCATCCTGCCCACCTTG
GCCGATCTGCTGTGCTACCAGACGCCCGCTTTCATCTTTGGCTTCCTCAA
CCGCCTGCGGCGCTCGGAGAATGTGTGCCGTGTGTTCCTGTGGGCCTCCC
CGCAGCACCTACAGAATCCCCATGCCGACTACATCCTGGCGGGCTGCGAG
TACCTGGCCGAGTTGGTCCTACGACTAGAATCCGACAAATTACTCTCACT
GATTTCAAGAAAGCCGGGCGGTGGGGTGTCCAACAGGCGCTACTCCTGCC
AAGTCAGCAAAACCTCTTTCCAGGTAACGCCGCTGGACGGAGGACTACCT
GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAATCGGAGCAGACCCCAGA
GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAAGTGGTGG
CCCGCAATGCACTCACCCTTCCATACGAACGCACATGCGAACCGTCTGAG
GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA
TCCGGACGAGGATCTGTGCATC----------------------------
--------------------
>C5
ATGCTCTCCAACCTGTTGGTGACCAATCAGAAAGTGGTCCTCGTTATAGA
TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
ACGAGCAGGGACAGGGGGCGGAAACTATCAAGGCCCTGCCCACCGGCGTC
AGTCTGAAGCACGTGGCCACCTTCGAGGCGCTGATTGGCGAGTGCGCCAA
CCACAAAAACAACAACACTGGGAGC-------------------------
--ATTCCGGGATCCAAAGCCACTGGCTTCAACGTCATCCTGCCCACCTTG
GCCGACCTGCTGTGCTACCAGACGCCCGCCTTCATCTTTGGCTTCCTCAA
CCGCCTGCGGCGCTCGGAGAACGTGTGCCGCGTGTTCCTGTGGGCCTCCC
CACAACACTTACAGAATCCCCATGCCGAATACATCCTGGCTGGCTGCGAG
TACCTGGCCGAGTTGGTCCTACGACTGGAATCCGACAAATTACTCTCGCT
GATTTCACGCAAGCCGGGCGGTGCGGTGTCCAACAAGCGCTACTCCTGCC
AAGTCAGCAAAACCTTTTTCCAGGTGACGCCGCTGGACGGAGGGCTACCT
GCAGGTGGCTCCCCCAAGCAGCCCTCGCCCGAGACGGAGCAGACCCCAGA
GCCGGCCAGCAGCACCTTCAAAATCGAACTTGACGAGGATGAAGTGATGG
CCCGCAATGCACTCACCCTGCCATACGAACGCACGTGCGAGCCGTCTGAG
GGAAACATAATATACACGCCCGATGCCGACGATGATTTCGACGAGGAGGA
TCCGGACGAGGATCTGTGCATC----------------------------
--------------------
>C6
ATGCTCTCCAACCTGCTGGTGACCAAACAAAAGCTGGTCCTCGTAATAGA
TAAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
ACGAGCAGGGCCAGGGGACGGAGACCATCAAGGCCCTGCCCACCGGCGTC
AGCCTCAAGCTCGTGGCCACCTTCGAGGCGCTGCTCTCGGAGTGCGCCAA
CCAAAACAACAACAACAACACTGCGGGCACTCCGGGC-------------
--TCAGGAGCAGGAAAGCCCGCCGGTTTCAACGTCATCCTGCCCACACTG
GCCGACCTGCTGTGCTACCAGTCGCCCGCCTTCATCTTTGGCTTCCTCAA
CCGCCTGCGTCGTTCGGAGCACGTGCGTCGTGTGTTCCTCTGGGCCTCCC
CGCAGCACCTGCAGCATCCGCATGCGGAGTACATCCTGGCTGGCTGCGAG
TACCTGGCGGAGTTGGTCCTTCGCCTGGAGACGGACAAGCAACTATCGCT
GATATCGCGTAAACCCGGTGGCGGAGTGACCAACAGGCGCTTCGCCTGCC
AGATCAGCAAGACCGAGTTCCAGGTGACGCCGCTGGACGAAGGACAGCCC
GCAGGAGCCTCACCCAAACAGTCTTCCCCGGAGGCGGAGCAAACCCCAGA
GCCGGCCAGCAGCACCTTCAAAATCGAGCTCGACGAGGACGAGGTGGTGG
CCCGCAATGCACTCACCCTGCCATACGAACGCACCAGCGAGCCGACCGAG
GGCAACATTATATACACACCCGATGCCGACGACGACTTCGACGAGGAGGA
TCCGGACGAGGATCTGTGCATC----------------------------
--------------------
>C7
ATGCTCTCCAACCTGCTGGTGACCAAACAAAAAGTGGTCCTCGTAATAGA
TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
ACGAACAGGGCCAGGGGACGGAGACCATCAAGACCCTGCCCACCGGCATC
AGCCTGAAGCACGTGGCCACCTTCGAGGCACTGATCGCCGAGTGCGCCAA
CCAAAACAAC----------------------------------------
--------ACAGGGAAACCCTCCGGCTTCAACGTCATCCTGCCCACACTG
GCCGACCTGCTGTGCTACCAGTCGCCCGCCTTTATCTTTAGCTTCCTCAA
CCGCCTGCGTCGCTCGGAGCACGTGCGTCGTGTGTTCCTCTGGGCCTCCC
CGCAGCACCTCCAGCATCCCCATGCCGACTACATCCTGGCTGGCTGCGAG
TACCTGGCGGAGCTGGTGCTTCGCCTGGAGACGGACAAGCTACTATCACT
GATATCGCGCAAACCCGGTGGCGGGGTGTCCAACAGGCGGTTCGCCTGCC
AGGTCAGCAAGACCCAGTTCCAGGTGACGCCGCTTGACGAAGGGCTGCCC
ACAGGTGTCTCACCCAAACAGCCTACCCCGGAGGCGGAGCAAACCCCAGA
GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAGATGGTGG
CCCGCAATGCACTCACCCTGCCATATGAACGCACCAGCGAGCCGACTGAG
GGCAACATCATATACACACCCGATGCTGACGACGACTTCGATGAGGAGGA
TCCGGACGAGGATCTGTGCATC----------------------------
--------------------
>C8
ATGCTTTCAAATCTTGTGGTGACCAATCAAAAAGTGGTCCTCATAATAGA
TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCTTGCTTC
ACGAACAGGGACAGGGGACAGATACAATCAAGGCCTTGCCCACCGGCGTC
AGTCTGAAGCACGTGGCCACCTTCGAATCGCTGATCGACGAGTGCGCCAA
CCATAACAACAACAACACCCCTGCCGGAGAAGTGGGCGACGTGGATGCGG
TTACTCCGGGATCGAAATCTACCGGCTTCAACGTCATCCTGCCCACCTTG
GCTGACCTGCTGTGCTATCAGTCGCCCGCTTTTATTTTTGGCTTCCTTAA
CCGCCTACGTCGCTCGGAGCATGTGCGTCGAGTGTTCCTCTGGGCTTCCC
CGCACCATCTGCAGCATCCTCATGCTGCCTACATTCTGGCTGGCTGCGAA
TACTTGGCCAAGTTGGTGCTCCGCTTGGAAACAGACAAGCTACTGTCCAT
AATATCACGCAAGCCGGGCGGAGGAGTTACAAACAGACGCTTCTCATGCC
AGGTCAGCAAAACCCAGTTCCTGGTGACGCCGGTGGACGGAGGACTCCCG
GCAGGTGTCTCTCCCAAGCAGCCCTCGCCAGAGGCAGAGCAAACCCCAGA
ACCGGCCAGCAGCACCTTTAAGATCGAGCTCGACGAGGATGAAGTGGTTG
CTCGCAATGCACTTACCCTGCCATACGAACGCACAAGCGAGCCGTCCGAG
GGAAACATTATATACACGCCCGATGCCGACGACGACTTTGATGAGGAGGA
TCCTGACGAGGATCTGTGCATC----------------------------
--------------------
>C1
MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYANoooNNTGSoooooooooTTDSNSTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCE
YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP
AGASPKQPSPEAEQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSE
GNIIYTPDADDDFDEEDPDEDLCI
>C2
MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYANoooNNTGSoooooooooTTDSNFTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE
YLAELVLRLETDKLLSLISRKPGGGVTNRRYSCEVSKTQFKVTPLDGGRP
AGASSKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE
GNIIYTPDADDDFDEEDPDEDLCI
>C3
MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYANoooNNTGSoooooooooTTDPNFTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE
YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP
AGASPKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE
GNIIYTPDADDDFDEEDPDEDLCI
>C4
MLSNLVVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV
SLKHVATFEALITECANTKNNNTASoooooooooSPRSKSTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHADYILAGCE
YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCQVSKTSFQVTPLDGGLP
AGASPKQPSPESEQTPEPASSTFKIELDEDEVVARNALTLPYERTCEPSE
GNIIYTPDADDDFDEEDPDEDLCI
>C5
MLSNLLVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV
SLKHVATFEALIGECANHKNNNTGSoooooooooIPGSKATGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHAEYILAGCE
YLAELVLRLESDKLLSLISRKPGGAVSNKRYSCQVSKTFFQVTPLDGGLP
AGGSPKQPSPETEQTPEPASSTFKIELDEDEVMARNALTLPYERTCEPSE
GNIIYTPDADDDFDEEDPDEDLCI
>C6
MLSNLLVTKQKLVLVIDKLNRERIAPKFIGSLLHEQGQGTETIKALPTGV
SLKLVATFEALLSECANQNNNNNTAGTPGoooooSGAGKPAGFNVILPTL
ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPQHLQHPHAEYILAGCE
YLAELVLRLETDKQLSLISRKPGGGVTNRRFACQISKTEFQVTPLDEGQP
AGASPKQSSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPTE
GNIIYTPDADDDFDEEDPDEDLCI
>C7
MLSNLLVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGTETIKTLPTGI
SLKHVATFEALIAECANQNNooooooooooooooooTGKPSGFNVILPTL
ADLLCYQSPAFIFSFLNRLRRSEHVRRVFLWASPQHLQHPHADYILAGCE
YLAELVLRLETDKLLSLISRKPGGGVSNRRFACQVSKTQFQVTPLDEGLP
TGVSPKQPTPEAEQTPEPASSTFKIELDEDEMVARNALTLPYERTSEPTE
GNIIYTPDADDDFDEEDPDEDLCI
>C8
MLSNLVVTNQKVVLIIDELNRERIAPKFIGSLLHEQGQGTDTIKALPTGV
SLKHVATFESLIDECANHNNNNTPAGEVGDVDAVTPGSKSTGFNVILPTL
ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPHHLQHPHAAYILAGCE
YLAKLVLRLETDKLLSIISRKPGGGVTNRRFSCQVSKTQFLVTPVDGGLP
AGVSPKQPSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPSE
GNIIYTPDADDDFDEEDPDEDLCI


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 8 taxa and 870 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Taxon 7 -> C7
      Taxon 8 -> C8
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1479400883
      Setting output file names to "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 140741199
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 3981457565
      Seed = 469448605
      Swapseed = 1479400883
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 56 unique site patterns
      Division 2 has 36 unique site patterns
      Division 3 has 104 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3268.577141 -- -24.349928
         Chain 2 -- -3446.439625 -- -24.349928
         Chain 3 -- -3415.570185 -- -24.349928
         Chain 4 -- -3458.823588 -- -24.349928

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3336.231911 -- -24.349928
         Chain 2 -- -3344.521840 -- -24.349928
         Chain 3 -- -3426.310172 -- -24.349928
         Chain 4 -- -3403.005038 -- -24.349928


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3268.577] (-3446.440) (-3415.570) (-3458.824) * [-3336.232] (-3344.522) (-3426.310) (-3403.005) 
        500 -- (-2711.413) (-2725.525) (-2702.928) [-2699.636] * [-2702.823] (-2710.149) (-2720.761) (-2693.588) -- 0:33:19
       1000 -- (-2709.595) (-2681.145) (-2695.013) [-2653.516] * [-2660.907] (-2687.263) (-2713.936) (-2691.264) -- 0:16:39
       1500 -- (-2685.243) (-2674.219) (-2650.685) [-2625.041] * (-2662.296) (-2656.766) (-2685.064) [-2651.478] -- 0:11:05
       2000 -- (-2660.240) (-2633.873) [-2632.266] (-2622.156) * (-2646.251) [-2633.481] (-2662.964) (-2626.633) -- 0:08:19
       2500 -- (-2640.847) [-2626.459] (-2627.800) (-2626.520) * (-2630.031) (-2625.737) (-2646.187) [-2628.327] -- 0:06:39
       3000 -- (-2631.281) [-2620.596] (-2626.742) (-2621.942) * (-2633.874) (-2623.124) (-2639.768) [-2628.117] -- 0:11:04
       3500 -- (-2626.333) [-2617.496] (-2621.602) (-2627.733) * (-2633.853) [-2627.597] (-2639.181) (-2622.930) -- 0:09:29
       4000 -- (-2622.517) (-2628.070) (-2625.537) [-2624.533] * (-2635.113) [-2633.048] (-2629.145) (-2626.411) -- 0:08:18
       4500 -- (-2627.055) (-2631.977) [-2626.157] (-2630.351) * (-2632.744) (-2624.915) (-2620.493) [-2625.110] -- 0:07:22
       5000 -- (-2621.735) (-2629.095) (-2628.373) [-2627.849] * (-2631.562) (-2623.836) [-2628.007] (-2625.570) -- 0:06:38

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-2632.341) (-2626.985) [-2631.808] (-2627.853) * [-2623.554] (-2628.407) (-2630.795) (-2627.886) -- 0:09:02
       6000 -- (-2622.438) [-2621.269] (-2629.987) (-2624.944) * (-2623.765) [-2628.387] (-2623.361) (-2628.207) -- 0:08:17
       6500 -- (-2626.153) (-2628.652) [-2624.524] (-2619.880) * (-2632.290) [-2631.143] (-2624.353) (-2632.764) -- 0:07:38
       7000 -- (-2641.543) [-2626.524] (-2631.538) (-2622.515) * (-2623.856) [-2628.695] (-2620.660) (-2625.532) -- 0:07:05
       7500 -- [-2623.891] (-2626.378) (-2629.266) (-2634.512) * (-2630.093) (-2625.204) [-2627.534] (-2630.277) -- 0:06:37
       8000 -- (-2626.623) (-2631.576) [-2636.297] (-2633.994) * [-2628.492] (-2637.145) (-2629.427) (-2632.336) -- 0:08:16
       8500 -- (-2621.575) [-2625.556] (-2635.990) (-2626.899) * (-2623.462) [-2630.860] (-2628.060) (-2623.226) -- 0:07:46
       9000 -- (-2629.879) (-2622.636) (-2631.312) [-2627.990] * (-2626.604) [-2620.152] (-2635.297) (-2624.151) -- 0:07:20
       9500 -- (-2627.416) (-2627.346) (-2629.049) [-2626.946] * (-2628.803) (-2626.186) (-2631.054) [-2625.732] -- 0:06:57
      10000 -- (-2630.287) [-2622.469] (-2628.504) (-2636.649) * (-2631.946) (-2631.178) (-2622.882) [-2627.223] -- 0:06:36

      Average standard deviation of split frequencies: 0.000000

      10500 -- [-2628.440] (-2623.874) (-2631.024) (-2636.113) * (-2626.567) (-2631.637) (-2626.891) [-2629.538] -- 0:07:51
      11000 -- (-2626.481) (-2635.430) [-2625.963] (-2622.236) * (-2631.798) (-2628.297) (-2627.105) [-2629.452] -- 0:07:29
      11500 -- (-2625.095) (-2626.234) (-2622.650) [-2627.298] * (-2629.671) [-2623.725] (-2626.239) (-2623.144) -- 0:07:09
      12000 -- (-2632.492) (-2620.783) [-2626.369] (-2621.633) * (-2623.147) (-2630.979) [-2630.182] (-2631.391) -- 0:06:51
      12500 -- (-2633.060) (-2625.786) [-2622.293] (-2626.125) * [-2626.547] (-2633.103) (-2632.824) (-2628.827) -- 0:06:35
      13000 -- (-2625.536) [-2623.422] (-2631.161) (-2630.737) * [-2620.614] (-2623.435) (-2626.328) (-2626.571) -- 0:07:35
      13500 -- [-2624.451] (-2624.264) (-2623.056) (-2630.900) * (-2626.504) [-2620.731] (-2633.394) (-2627.749) -- 0:07:18
      14000 -- (-2624.512) [-2631.021] (-2621.148) (-2626.565) * (-2632.002) [-2627.228] (-2639.815) (-2631.073) -- 0:07:02
      14500 -- [-2622.553] (-2620.765) (-2620.629) (-2633.258) * (-2622.726) (-2623.591) [-2627.282] (-2638.261) -- 0:06:47
      15000 -- (-2631.012) (-2641.535) (-2622.047) [-2630.074] * (-2627.057) (-2624.574) (-2626.568) [-2622.453] -- 0:06:34

      Average standard deviation of split frequencies: 0.000000

      15500 -- [-2623.984] (-2624.888) (-2623.653) (-2625.487) * (-2623.358) (-2631.118) (-2628.377) [-2622.294] -- 0:07:24
      16000 -- (-2627.927) (-2623.311) (-2626.625) [-2622.674] * (-2620.366) (-2630.730) (-2627.000) [-2626.921] -- 0:07:10
      16500 -- (-2625.245) (-2629.604) (-2629.358) [-2624.318] * [-2621.891] (-2619.336) (-2631.736) (-2625.509) -- 0:06:57
      17000 -- [-2623.616] (-2632.826) (-2628.744) (-2629.959) * (-2630.499) (-2627.017) [-2622.111] (-2626.490) -- 0:06:44
      17500 -- [-2621.967] (-2622.069) (-2627.539) (-2622.461) * (-2626.780) (-2625.956) (-2633.252) [-2625.865] -- 0:06:33
      18000 -- [-2625.944] (-2623.545) (-2630.198) (-2630.490) * [-2629.657] (-2631.897) (-2628.227) (-2629.239) -- 0:07:16
      18500 -- (-2629.013) (-2623.604) [-2622.719] (-2626.431) * [-2627.013] (-2628.958) (-2634.266) (-2623.325) -- 0:07:04
      19000 -- (-2627.102) [-2621.443] (-2620.940) (-2628.051) * (-2625.197) (-2628.514) (-2632.182) [-2624.534] -- 0:06:53
      19500 -- (-2622.256) (-2635.396) [-2625.674] (-2630.359) * (-2629.018) (-2628.015) (-2635.002) [-2625.255] -- 0:06:42
      20000 -- (-2627.507) (-2634.022) [-2623.602] (-2623.964) * (-2627.419) (-2631.619) [-2625.071] (-2622.446) -- 0:06:32

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-2629.741) (-2634.952) [-2623.585] (-2630.986) * (-2628.697) (-2623.392) (-2624.143) [-2621.110] -- 0:07:10
      21000 -- (-2624.893) (-2625.574) [-2622.102] (-2618.354) * (-2627.331) (-2625.924) [-2618.890] (-2625.085) -- 0:06:59
      21500 -- (-2625.332) (-2637.076) [-2625.467] (-2622.023) * (-2624.206) (-2620.826) [-2626.777] (-2624.845) -- 0:06:49
      22000 -- (-2628.963) [-2625.793] (-2624.994) (-2623.687) * (-2629.370) (-2626.463) (-2620.976) [-2624.265] -- 0:06:40
      22500 -- (-2620.866) (-2633.428) [-2623.697] (-2621.108) * (-2635.706) (-2624.866) (-2630.945) [-2622.500] -- 0:06:31
      23000 -- (-2627.737) (-2628.553) (-2625.755) [-2633.364] * (-2635.466) [-2624.258] (-2627.191) (-2626.720) -- 0:07:04
      23500 -- (-2627.524) [-2626.299] (-2623.552) (-2624.948) * [-2621.167] (-2626.906) (-2621.917) (-2630.839) -- 0:06:55
      24000 -- (-2626.264) [-2623.634] (-2624.094) (-2624.558) * (-2625.000) [-2622.496] (-2620.971) (-2632.989) -- 0:06:46
      24500 -- (-2627.112) (-2626.800) [-2619.186] (-2628.498) * [-2626.400] (-2621.496) (-2620.521) (-2628.519) -- 0:06:38
      25000 -- (-2627.480) (-2644.099) [-2621.292] (-2621.651) * [-2631.459] (-2617.731) (-2628.250) (-2624.739) -- 0:06:30

      Average standard deviation of split frequencies: 0.000000

      25500 -- (-2626.582) [-2621.930] (-2625.843) (-2626.197) * [-2624.731] (-2621.868) (-2630.037) (-2635.629) -- 0:07:00
      26000 -- (-2630.490) [-2622.621] (-2622.692) (-2627.663) * (-2627.886) (-2636.521) (-2634.123) [-2630.397] -- 0:06:52
      26500 -- (-2630.699) [-2622.241] (-2624.625) (-2624.315) * (-2630.762) [-2621.914] (-2633.115) (-2623.509) -- 0:06:44
      27000 -- (-2628.826) (-2632.273) (-2623.301) [-2624.028] * (-2628.614) [-2619.852] (-2639.773) (-2621.259) -- 0:06:36
      27500 -- [-2624.552] (-2626.972) (-2625.426) (-2628.556) * [-2621.467] (-2630.000) (-2631.232) (-2631.955) -- 0:06:29
      28000 -- (-2626.339) (-2634.271) (-2632.058) [-2619.885] * [-2624.561] (-2625.343) (-2624.498) (-2621.120) -- 0:06:56
      28500 -- [-2628.218] (-2629.410) (-2632.825) (-2624.826) * (-2626.253) [-2635.055] (-2633.702) (-2633.167) -- 0:06:49
      29000 -- (-2628.095) (-2625.275) (-2629.123) [-2624.191] * (-2635.252) (-2623.433) (-2625.449) [-2621.802] -- 0:06:41
      29500 -- (-2630.206) (-2628.480) [-2623.502] (-2627.688) * [-2625.629] (-2625.548) (-2629.686) (-2627.077) -- 0:06:34
      30000 -- [-2626.627] (-2625.481) (-2627.418) (-2620.392) * [-2623.729] (-2622.875) (-2633.247) (-2621.277) -- 0:06:28

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-2629.457) (-2626.810) (-2620.601) [-2618.286] * (-2634.616) (-2633.584) [-2623.558] (-2623.898) -- 0:06:53
      31000 -- (-2625.328) [-2627.675] (-2629.402) (-2624.540) * (-2635.350) [-2619.348] (-2621.267) (-2621.739) -- 0:06:46
      31500 -- [-2624.458] (-2629.012) (-2629.557) (-2629.581) * (-2628.389) (-2631.131) (-2628.181) [-2627.482] -- 0:06:39
      32000 -- (-2629.037) (-2627.923) (-2621.666) [-2628.653] * [-2630.950] (-2627.823) (-2625.667) (-2629.393) -- 0:06:33
      32500 -- (-2623.552) (-2634.657) [-2621.575] (-2625.470) * (-2622.068) [-2624.475] (-2627.735) (-2641.457) -- 0:06:27
      33000 -- (-2624.122) (-2632.125) (-2620.683) [-2626.437] * (-2623.887) (-2632.510) (-2631.391) [-2626.915] -- 0:06:50
      33500 -- (-2622.153) (-2624.939) (-2629.803) [-2628.424] * (-2627.990) [-2623.043] (-2633.905) (-2629.931) -- 0:06:43
      34000 -- (-2620.831) [-2623.575] (-2620.670) (-2632.850) * (-2622.329) (-2623.877) (-2629.714) [-2626.857] -- 0:06:37
      34500 -- (-2628.803) [-2622.800] (-2625.361) (-2633.540) * (-2627.829) [-2627.239] (-2622.377) (-2627.363) -- 0:06:31
      35000 -- (-2626.505) (-2625.259) (-2627.243) [-2625.689] * (-2627.401) (-2623.923) (-2631.185) [-2620.812] -- 0:06:26

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-2633.033) (-2627.832) [-2624.801] (-2631.853) * (-2626.484) [-2618.963] (-2631.322) (-2629.826) -- 0:06:47
      36000 -- (-2626.512) (-2635.248) [-2621.828] (-2626.149) * [-2622.479] (-2620.714) (-2624.271) (-2628.722) -- 0:06:41
      36500 -- [-2624.200] (-2636.433) (-2629.753) (-2625.544) * (-2633.659) (-2623.995) (-2628.123) [-2624.644] -- 0:06:35
      37000 -- (-2626.082) [-2631.599] (-2624.697) (-2625.258) * (-2629.758) [-2624.799] (-2625.449) (-2626.284) -- 0:06:30
      37500 -- (-2622.559) (-2641.702) (-2633.793) [-2625.924] * (-2627.712) [-2621.311] (-2628.921) (-2622.055) -- 0:06:25
      38000 -- (-2623.505) (-2641.673) [-2627.958] (-2624.415) * (-2628.183) (-2623.629) [-2622.552] (-2625.476) -- 0:06:45
      38500 -- (-2625.078) (-2628.103) [-2627.750] (-2623.751) * (-2633.853) (-2632.204) (-2631.554) [-2620.512] -- 0:06:39
      39000 -- (-2626.259) [-2629.808] (-2632.575) (-2624.386) * (-2630.905) (-2627.212) [-2624.983] (-2622.732) -- 0:06:34
      39500 -- (-2628.501) (-2625.339) (-2627.162) [-2630.319] * (-2628.122) (-2625.135) [-2627.925] (-2625.527) -- 0:06:29
      40000 -- [-2619.626] (-2629.176) (-2627.803) (-2623.975) * (-2637.957) (-2625.010) [-2629.809] (-2628.641) -- 0:06:24

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-2623.313) [-2625.365] (-2621.894) (-2637.446) * [-2624.309] (-2623.960) (-2629.219) (-2624.095) -- 0:06:42
      41000 -- [-2622.975] (-2626.589) (-2624.048) (-2625.613) * (-2626.375) (-2622.682) (-2633.102) [-2628.912] -- 0:06:37
      41500 -- (-2633.046) [-2624.667] (-2630.833) (-2626.452) * (-2619.143) (-2628.199) (-2626.280) [-2625.450] -- 0:06:32
      42000 -- (-2620.764) [-2617.378] (-2632.573) (-2625.547) * (-2633.435) (-2632.298) [-2621.093] (-2628.828) -- 0:06:27
      42500 -- [-2626.992] (-2627.612) (-2627.572) (-2634.076) * (-2626.305) (-2631.438) (-2626.311) [-2629.652] -- 0:06:23
      43000 -- (-2626.654) (-2630.614) (-2625.740) [-2625.603] * [-2622.817] (-2628.391) (-2625.489) (-2622.266) -- 0:06:40
      43500 -- (-2625.277) (-2626.113) [-2623.369] (-2627.238) * (-2632.882) (-2633.816) (-2628.430) [-2622.997] -- 0:06:35
      44000 -- [-2624.610] (-2629.785) (-2627.605) (-2626.004) * (-2638.081) (-2626.764) [-2628.341] (-2621.525) -- 0:06:31
      44500 -- (-2626.545) [-2621.535] (-2629.751) (-2628.572) * [-2629.134] (-2625.997) (-2620.738) (-2623.564) -- 0:06:26
      45000 -- (-2622.669) [-2626.676] (-2623.862) (-2621.291) * (-2627.060) [-2627.128] (-2630.219) (-2625.472) -- 0:06:22

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-2626.415) [-2628.988] (-2622.214) (-2637.705) * (-2626.782) (-2633.343) (-2628.686) [-2622.623] -- 0:06:38
      46000 -- (-2623.745) (-2626.626) [-2623.210] (-2621.091) * [-2622.652] (-2626.360) (-2637.806) (-2626.773) -- 0:06:34
      46500 -- (-2624.150) (-2630.348) [-2627.811] (-2620.218) * [-2620.818] (-2626.548) (-2625.386) (-2626.231) -- 0:06:29
      47000 -- (-2622.610) (-2627.112) [-2618.854] (-2622.938) * (-2623.705) [-2625.292] (-2629.908) (-2632.204) -- 0:06:25
      47500 -- (-2626.191) [-2631.586] (-2626.404) (-2627.273) * [-2623.245] (-2631.700) (-2638.708) (-2629.079) -- 0:06:21
      48000 -- (-2623.575) (-2632.303) [-2626.371] (-2627.662) * (-2628.818) (-2627.518) (-2626.278) [-2621.270] -- 0:06:36
      48500 -- (-2625.152) [-2626.040] (-2625.576) (-2628.416) * (-2621.251) (-2632.152) [-2636.466] (-2624.542) -- 0:06:32
      49000 -- (-2631.820) (-2621.931) [-2621.899] (-2624.028) * (-2626.059) (-2625.444) [-2623.881] (-2628.219) -- 0:06:28
      49500 -- (-2632.754) (-2628.033) [-2624.862] (-2626.447) * (-2633.417) (-2620.411) [-2623.882] (-2628.363) -- 0:06:24
      50000 -- (-2624.723) [-2623.699] (-2636.096) (-2625.062) * [-2624.007] (-2623.344) (-2626.866) (-2620.844) -- 0:06:20

      Average standard deviation of split frequencies: 0.000000

      50500 -- (-2630.061) (-2626.737) [-2633.835] (-2623.896) * (-2632.823) (-2638.616) (-2629.366) [-2623.036] -- 0:06:34
      51000 -- (-2632.196) (-2628.817) (-2626.797) [-2628.693] * [-2626.950] (-2628.015) (-2638.553) (-2629.159) -- 0:06:30
      51500 -- [-2623.305] (-2622.890) (-2630.728) (-2628.907) * (-2626.638) (-2624.443) [-2627.113] (-2632.136) -- 0:06:26
      52000 -- (-2624.238) (-2624.318) (-2633.488) [-2620.404] * [-2624.763] (-2637.421) (-2622.874) (-2629.106) -- 0:06:22
      52500 -- [-2629.137] (-2620.861) (-2631.632) (-2628.324) * (-2633.789) (-2631.680) [-2630.044] (-2636.143) -- 0:06:19
      53000 -- (-2624.808) (-2628.658) [-2633.894] (-2628.024) * (-2628.431) [-2632.018] (-2623.918) (-2623.154) -- 0:06:33
      53500 -- (-2621.389) (-2630.023) [-2632.126] (-2628.676) * (-2627.468) (-2625.015) (-2628.689) [-2622.487] -- 0:06:29
      54000 -- (-2627.254) (-2630.092) [-2627.458] (-2632.565) * (-2638.424) [-2620.705] (-2622.361) (-2624.194) -- 0:06:25
      54500 -- [-2632.224] (-2632.812) (-2634.363) (-2630.434) * (-2632.140) (-2629.492) (-2634.390) [-2621.514] -- 0:06:21
      55000 -- [-2623.407] (-2635.966) (-2628.968) (-2623.393) * (-2627.352) [-2622.372] (-2625.332) (-2626.830) -- 0:06:35

      Average standard deviation of split frequencies: 0.000000

      55500 -- (-2634.793) [-2629.937] (-2632.522) (-2622.523) * (-2633.883) (-2626.441) [-2623.587] (-2631.989) -- 0:06:31
      56000 -- [-2633.479] (-2625.466) (-2626.678) (-2624.917) * (-2627.566) (-2626.868) [-2628.025] (-2623.310) -- 0:06:27
      56500 -- (-2630.541) (-2631.530) (-2632.887) [-2623.930] * (-2630.480) (-2629.538) [-2633.438] (-2628.467) -- 0:06:24
      57000 -- (-2624.484) (-2627.771) (-2635.869) [-2624.890] * (-2632.561) (-2632.686) [-2624.776] (-2624.524) -- 0:06:20
      57500 -- (-2629.659) (-2634.191) (-2625.358) [-2624.136] * (-2629.592) (-2626.897) (-2627.100) [-2624.137] -- 0:06:33
      58000 -- (-2629.028) (-2626.564) (-2624.669) [-2622.007] * (-2632.452) (-2630.427) (-2623.087) [-2629.943] -- 0:06:29
      58500 -- (-2629.092) (-2623.527) (-2628.274) [-2625.271] * (-2629.186) (-2624.051) [-2622.154] (-2620.896) -- 0:06:26
      59000 -- (-2632.579) (-2629.858) (-2626.049) [-2629.450] * [-2618.221] (-2620.576) (-2621.092) (-2624.959) -- 0:06:22
      59500 -- [-2624.670] (-2624.553) (-2627.096) (-2628.374) * [-2619.335] (-2626.946) (-2633.705) (-2629.357) -- 0:06:19
      60000 -- [-2623.971] (-2633.878) (-2630.325) (-2630.953) * (-2635.816) [-2631.680] (-2631.119) (-2625.961) -- 0:06:31

      Average standard deviation of split frequencies: 0.000000

      60500 -- (-2629.224) (-2628.746) [-2627.091] (-2628.135) * (-2629.851) (-2637.317) (-2628.452) [-2625.377] -- 0:06:28
      61000 -- (-2629.822) (-2624.498) [-2623.496] (-2634.733) * [-2627.023] (-2630.244) (-2635.756) (-2624.040) -- 0:06:24
      61500 -- (-2627.993) (-2629.332) (-2627.548) [-2626.381] * (-2620.678) [-2627.328] (-2630.163) (-2632.522) -- 0:06:21
      62000 -- [-2624.197] (-2621.371) (-2631.394) (-2625.625) * (-2623.202) (-2626.934) [-2622.792] (-2636.867) -- 0:06:18
      62500 -- [-2622.249] (-2627.005) (-2628.032) (-2627.681) * [-2627.008] (-2631.367) (-2627.942) (-2636.052) -- 0:06:30
      63000 -- (-2631.306) [-2622.413] (-2632.957) (-2627.251) * [-2629.635] (-2631.142) (-2626.732) (-2632.349) -- 0:06:26
      63500 -- [-2630.878] (-2631.693) (-2629.848) (-2628.647) * (-2619.927) (-2636.853) (-2628.677) [-2627.531] -- 0:06:23
      64000 -- (-2623.509) [-2632.840] (-2625.935) (-2633.835) * [-2620.112] (-2627.658) (-2628.543) (-2629.536) -- 0:06:20
      64500 -- (-2626.743) (-2626.511) [-2623.000] (-2626.341) * [-2621.772] (-2638.519) (-2636.149) (-2631.750) -- 0:06:17
      65000 -- (-2622.396) (-2632.141) (-2622.436) [-2627.445] * (-2623.154) (-2627.912) [-2631.319] (-2631.373) -- 0:06:28

      Average standard deviation of split frequencies: 0.000000

      65500 -- (-2629.434) (-2629.881) (-2625.708) [-2631.136] * [-2626.532] (-2634.112) (-2631.468) (-2632.946) -- 0:06:25
      66000 -- (-2625.582) (-2625.844) [-2632.306] (-2632.323) * [-2627.161] (-2623.619) (-2623.012) (-2630.009) -- 0:06:22
      66500 -- (-2620.018) [-2623.954] (-2632.441) (-2631.079) * [-2624.002] (-2624.286) (-2622.224) (-2626.475) -- 0:06:19
      67000 -- (-2625.039) (-2623.623) (-2625.861) [-2629.485] * (-2625.641) (-2624.327) [-2618.974] (-2634.692) -- 0:06:15
      67500 -- [-2622.008] (-2624.761) (-2617.730) (-2620.519) * (-2623.993) (-2626.088) [-2618.197] (-2630.317) -- 0:06:26
      68000 -- (-2623.453) (-2629.454) [-2620.894] (-2622.501) * (-2624.119) [-2618.562] (-2626.196) (-2623.585) -- 0:06:23
      68500 -- (-2624.852) (-2631.477) [-2623.113] (-2633.243) * (-2623.154) (-2620.712) (-2628.546) [-2626.550] -- 0:06:20
      69000 -- [-2622.386] (-2636.563) (-2631.651) (-2625.364) * (-2622.180) [-2623.312] (-2625.355) (-2624.914) -- 0:06:17
      69500 -- (-2626.679) (-2641.504) (-2621.520) [-2624.037] * (-2626.768) (-2629.009) (-2627.688) [-2622.738] -- 0:06:14
      70000 -- [-2623.143] (-2636.068) (-2622.670) (-2621.003) * (-2624.333) (-2628.348) [-2626.134] (-2627.486) -- 0:06:25

      Average standard deviation of split frequencies: 0.000000

      70500 -- (-2625.378) (-2632.398) (-2631.924) [-2628.795] * [-2625.961] (-2624.271) (-2625.976) (-2630.552) -- 0:06:22
      71000 -- (-2624.311) (-2623.896) [-2628.157] (-2621.974) * (-2628.355) (-2630.754) (-2621.370) [-2625.048] -- 0:06:19
      71500 -- (-2624.581) (-2631.000) (-2632.966) [-2624.563] * [-2626.097] (-2620.997) (-2626.975) (-2625.930) -- 0:06:16
      72000 -- (-2627.647) [-2625.454] (-2624.361) (-2628.155) * (-2631.400) (-2635.214) [-2624.505] (-2627.699) -- 0:06:13
      72500 -- (-2626.051) (-2623.163) (-2632.223) [-2625.155] * (-2626.485) [-2621.508] (-2626.283) (-2627.049) -- 0:06:23
      73000 -- (-2629.946) (-2629.315) [-2620.674] (-2630.762) * (-2627.285) (-2623.361) [-2626.966] (-2625.129) -- 0:06:20
      73500 -- (-2625.654) (-2628.366) (-2630.915) [-2625.692] * (-2627.611) (-2631.176) (-2632.196) [-2623.705] -- 0:06:18
      74000 -- (-2619.619) (-2627.185) (-2629.255) [-2625.640] * (-2659.668) (-2634.151) (-2623.230) [-2626.188] -- 0:06:15
      74500 -- [-2626.734] (-2624.819) (-2631.698) (-2620.140) * (-2625.821) [-2628.782] (-2626.116) (-2628.188) -- 0:06:12
      75000 -- [-2628.504] (-2628.032) (-2629.192) (-2632.109) * (-2627.761) (-2627.762) [-2621.503] (-2630.554) -- 0:06:22

      Average standard deviation of split frequencies: 0.000000

      75500 -- [-2625.828] (-2632.178) (-2628.286) (-2627.897) * (-2630.122) [-2626.231] (-2630.663) (-2635.798) -- 0:06:19
      76000 -- [-2627.598] (-2626.895) (-2619.406) (-2627.222) * (-2630.271) (-2633.785) (-2623.963) [-2628.294] -- 0:06:16
      76500 -- (-2626.320) (-2625.156) (-2626.408) [-2625.545] * (-2628.240) (-2628.970) (-2628.817) [-2622.494] -- 0:06:14
      77000 -- (-2634.128) (-2625.420) (-2629.047) [-2630.494] * (-2624.906) [-2627.785] (-2626.131) (-2626.423) -- 0:06:11
      77500 -- (-2622.683) (-2625.341) [-2623.909] (-2625.745) * (-2625.522) (-2628.988) (-2628.152) [-2627.352] -- 0:06:20
      78000 -- (-2638.754) (-2632.592) [-2630.403] (-2626.852) * [-2628.410] (-2631.808) (-2628.619) (-2627.441) -- 0:06:18
      78500 -- [-2624.522] (-2623.952) (-2634.326) (-2629.176) * (-2626.571) (-2624.629) (-2623.971) [-2627.346] -- 0:06:15
      79000 -- (-2621.611) (-2623.778) (-2628.117) [-2621.540] * (-2622.272) (-2620.241) [-2624.018] (-2626.098) -- 0:06:13
      79500 -- (-2630.943) (-2623.982) (-2643.520) [-2625.707] * (-2621.765) [-2624.624] (-2619.965) (-2625.626) -- 0:06:10
      80000 -- (-2631.602) [-2625.880] (-2632.025) (-2628.500) * (-2629.870) (-2634.056) (-2622.320) [-2627.525] -- 0:06:19

      Average standard deviation of split frequencies: 0.000000

      80500 -- (-2633.466) (-2631.188) [-2624.456] (-2629.190) * [-2624.381] (-2627.960) (-2625.837) (-2631.231) -- 0:06:16
      81000 -- [-2626.180] (-2633.517) (-2625.965) (-2631.774) * (-2626.757) [-2635.277] (-2636.314) (-2622.503) -- 0:06:14
      81500 -- (-2626.225) (-2627.941) (-2628.657) [-2627.723] * (-2631.355) [-2629.345] (-2624.833) (-2626.979) -- 0:06:11
      82000 -- (-2630.883) (-2618.910) (-2623.954) [-2627.435] * (-2631.652) (-2633.256) [-2624.460] (-2621.490) -- 0:06:09
      82500 -- (-2626.475) (-2633.683) [-2625.302] (-2623.471) * (-2633.425) (-2629.776) [-2623.244] (-2622.997) -- 0:06:18
      83000 -- (-2619.716) [-2628.337] (-2626.292) (-2624.052) * (-2628.405) [-2624.813] (-2632.012) (-2627.438) -- 0:06:15
      83500 -- (-2622.107) [-2623.819] (-2629.137) (-2632.148) * (-2621.877) [-2629.041] (-2625.472) (-2626.189) -- 0:06:13
      84000 -- (-2626.304) (-2623.160) (-2628.524) [-2624.605] * (-2622.404) (-2627.907) [-2619.704] (-2631.971) -- 0:06:10
      84500 -- (-2632.583) (-2630.677) (-2624.832) [-2625.783] * (-2634.710) [-2626.509] (-2626.716) (-2628.921) -- 0:06:08
      85000 -- (-2625.174) (-2622.794) [-2628.183] (-2623.561) * (-2629.925) (-2634.244) (-2631.371) [-2630.766] -- 0:06:16

      Average standard deviation of split frequencies: 0.000000

      85500 -- (-2627.615) [-2624.867] (-2633.879) (-2625.239) * (-2629.036) [-2625.079] (-2631.478) (-2623.398) -- 0:06:14
      86000 -- [-2625.353] (-2625.320) (-2636.345) (-2623.568) * (-2624.999) (-2621.913) (-2623.766) [-2619.888] -- 0:06:11
      86500 -- [-2623.894] (-2622.575) (-2625.238) (-2622.429) * [-2627.378] (-2627.091) (-2637.396) (-2634.211) -- 0:06:09
      87000 -- (-2628.856) [-2619.937] (-2626.625) (-2631.354) * (-2629.154) [-2623.340] (-2628.690) (-2638.267) -- 0:06:07
      87500 -- (-2627.396) (-2628.489) (-2630.125) [-2629.757] * (-2633.135) (-2627.764) [-2630.115] (-2637.091) -- 0:06:15
      88000 -- (-2626.959) (-2627.260) [-2621.924] (-2627.040) * (-2625.039) [-2627.691] (-2627.244) (-2630.973) -- 0:06:13
      88500 -- (-2628.220) (-2631.471) [-2625.346] (-2633.175) * (-2626.658) (-2631.817) (-2627.688) [-2620.694] -- 0:06:10
      89000 -- (-2634.158) (-2629.192) [-2624.355] (-2626.881) * [-2626.513] (-2622.954) (-2629.846) (-2627.800) -- 0:06:08
      89500 -- (-2628.664) (-2623.831) [-2621.874] (-2636.938) * (-2623.668) [-2623.203] (-2631.139) (-2631.160) -- 0:06:06
      90000 -- (-2625.843) (-2627.536) (-2628.486) [-2623.616] * (-2629.179) (-2624.883) [-2623.785] (-2632.018) -- 0:06:14

      Average standard deviation of split frequencies: 0.000000

      90500 -- (-2627.283) (-2630.740) [-2624.647] (-2619.596) * (-2624.007) [-2626.475] (-2630.307) (-2627.934) -- 0:06:11
      91000 -- (-2625.042) (-2630.057) (-2628.221) [-2621.704] * (-2620.171) [-2623.946] (-2624.901) (-2635.086) -- 0:06:09
      91500 -- (-2633.523) (-2628.364) (-2621.667) [-2623.245] * [-2625.295] (-2632.551) (-2629.830) (-2624.608) -- 0:06:07
      92000 -- [-2625.156] (-2629.700) (-2630.655) (-2631.162) * [-2622.159] (-2625.516) (-2622.362) (-2625.584) -- 0:06:05
      92500 -- [-2627.815] (-2634.213) (-2626.329) (-2627.143) * (-2624.153) (-2623.472) [-2624.917] (-2630.898) -- 0:06:12
      93000 -- [-2629.411] (-2622.232) (-2635.255) (-2628.197) * [-2622.710] (-2623.972) (-2624.123) (-2625.428) -- 0:06:10
      93500 -- (-2621.308) (-2629.305) (-2632.733) [-2624.720] * (-2626.040) [-2624.570] (-2631.167) (-2627.908) -- 0:06:08
      94000 -- [-2623.688] (-2634.460) (-2627.458) (-2626.063) * (-2621.268) (-2634.034) [-2627.291] (-2635.841) -- 0:06:06
      94500 -- [-2628.883] (-2625.047) (-2625.327) (-2625.230) * [-2628.064] (-2630.403) (-2625.177) (-2621.970) -- 0:06:04
      95000 -- [-2633.434] (-2625.315) (-2625.375) (-2629.303) * (-2631.458) (-2630.309) (-2623.713) [-2624.085] -- 0:06:11

      Average standard deviation of split frequencies: 0.000000

      95500 -- [-2625.168] (-2630.926) (-2625.765) (-2633.095) * (-2631.598) (-2634.598) [-2621.804] (-2628.619) -- 0:06:09
      96000 -- (-2628.312) [-2624.819] (-2625.793) (-2626.157) * [-2622.871] (-2627.124) (-2624.675) (-2626.812) -- 0:06:07
      96500 -- [-2628.791] (-2632.757) (-2631.284) (-2644.219) * (-2626.783) (-2626.800) (-2630.619) [-2626.979] -- 0:06:05
      97000 -- (-2623.520) [-2631.074] (-2629.756) (-2626.569) * (-2632.257) (-2625.287) [-2627.221] (-2627.193) -- 0:06:03
      97500 -- [-2623.040] (-2626.421) (-2630.433) (-2633.597) * (-2637.383) [-2625.629] (-2620.757) (-2627.236) -- 0:06:10
      98000 -- [-2626.770] (-2630.036) (-2629.737) (-2628.924) * (-2638.557) (-2621.899) [-2619.099] (-2621.415) -- 0:06:08
      98500 -- [-2624.006] (-2622.324) (-2625.332) (-2628.070) * (-2632.424) (-2626.856) [-2623.292] (-2626.530) -- 0:06:06
      99000 -- [-2623.373] (-2625.311) (-2623.253) (-2623.486) * (-2622.990) (-2630.755) (-2625.595) [-2624.804] -- 0:06:04
      99500 -- (-2619.497) (-2621.959) (-2620.126) [-2620.583] * (-2624.104) (-2628.256) (-2629.335) [-2632.639] -- 0:06:02
      100000 -- (-2628.502) (-2621.462) [-2617.612] (-2618.723) * [-2624.477] (-2631.293) (-2624.585) (-2622.544) -- 0:06:09

      Average standard deviation of split frequencies: 0.000000

      100500 -- (-2626.967) [-2628.309] (-2631.055) (-2625.974) * (-2627.082) (-2638.219) [-2623.071] (-2626.382) -- 0:06:06
      101000 -- (-2624.177) (-2627.549) (-2626.345) [-2625.381] * [-2628.224] (-2640.088) (-2630.496) (-2635.342) -- 0:06:04
      101500 -- (-2629.708) [-2623.532] (-2632.810) (-2625.471) * (-2631.592) [-2626.794] (-2628.925) (-2631.076) -- 0:06:02
      102000 -- (-2626.037) [-2624.579] (-2628.161) (-2628.221) * (-2624.803) (-2630.425) [-2625.337] (-2628.056) -- 0:06:00
      102500 -- (-2629.329) (-2630.340) [-2626.033] (-2630.195) * (-2627.564) (-2624.566) [-2623.828] (-2629.162) -- 0:06:07
      103000 -- (-2626.912) (-2631.771) [-2621.954] (-2631.231) * (-2625.402) (-2627.687) (-2622.835) [-2630.936] -- 0:06:05
      103500 -- (-2623.661) [-2627.944] (-2619.551) (-2633.896) * (-2624.800) [-2622.834] (-2624.802) (-2627.696) -- 0:06:03
      104000 -- (-2637.571) (-2634.200) [-2623.279] (-2622.451) * [-2620.363] (-2626.025) (-2629.947) (-2629.180) -- 0:06:01
      104500 -- (-2625.012) (-2624.265) (-2624.526) [-2628.237] * [-2628.787] (-2630.220) (-2633.218) (-2631.158) -- 0:05:59
      105000 -- (-2628.092) [-2625.227] (-2623.559) (-2631.785) * (-2625.672) (-2630.916) (-2626.429) [-2628.275] -- 0:06:06

      Average standard deviation of split frequencies: 0.000000

      105500 -- (-2628.240) (-2626.841) [-2619.803] (-2621.241) * (-2620.466) (-2629.132) (-2621.882) [-2624.640] -- 0:06:04
      106000 -- (-2622.562) (-2628.942) [-2620.873] (-2630.320) * (-2623.277) [-2624.769] (-2632.045) (-2627.504) -- 0:06:02
      106500 -- [-2627.418] (-2628.543) (-2627.753) (-2628.932) * (-2635.402) [-2632.892] (-2626.797) (-2631.945) -- 0:06:00
      107000 -- [-2620.582] (-2632.246) (-2640.287) (-2621.813) * (-2634.622) (-2624.641) (-2627.010) [-2633.278] -- 0:05:58
      107500 -- (-2630.144) (-2634.973) (-2629.943) [-2625.670] * (-2630.690) [-2622.588] (-2637.934) (-2630.711) -- 0:06:05
      108000 -- (-2627.611) (-2620.160) (-2623.859) [-2623.703] * [-2620.505] (-2623.598) (-2628.404) (-2628.492) -- 0:06:03
      108500 -- (-2626.866) [-2621.514] (-2627.714) (-2626.203) * [-2620.132] (-2628.538) (-2623.873) (-2630.451) -- 0:06:01
      109000 -- (-2625.937) (-2627.710) [-2624.481] (-2619.648) * (-2621.964) (-2626.820) (-2630.917) [-2634.901] -- 0:05:59
      109500 -- (-2627.432) [-2624.191] (-2632.308) (-2628.242) * (-2625.883) [-2623.911] (-2626.862) (-2622.512) -- 0:06:05
      110000 -- (-2626.675) (-2641.928) (-2625.796) [-2628.294] * (-2625.183) (-2628.498) [-2628.956] (-2623.797) -- 0:06:04

      Average standard deviation of split frequencies: 0.000000

      110500 -- [-2629.180] (-2622.353) (-2629.656) (-2624.151) * (-2632.039) (-2626.249) [-2628.906] (-2625.287) -- 0:06:02
      111000 -- (-2628.376) (-2636.877) (-2622.511) [-2623.090] * (-2626.929) (-2629.382) [-2622.996] (-2623.904) -- 0:06:00
      111500 -- (-2627.452) (-2633.446) (-2630.705) [-2630.493] * [-2625.475] (-2627.985) (-2626.669) (-2621.279) -- 0:05:58
      112000 -- (-2626.412) (-2636.283) (-2625.797) [-2624.407] * [-2624.017] (-2625.647) (-2622.115) (-2628.220) -- 0:06:04
      112500 -- (-2622.294) (-2628.764) (-2629.334) [-2624.000] * [-2628.653] (-2639.331) (-2631.111) (-2631.913) -- 0:06:02
      113000 -- (-2622.449) (-2637.325) [-2622.259] (-2629.422) * [-2630.926] (-2636.889) (-2622.319) (-2625.398) -- 0:06:01
      113500 -- (-2626.080) [-2631.190] (-2618.059) (-2635.334) * (-2628.192) (-2633.917) (-2628.332) [-2627.682] -- 0:05:59
      114000 -- (-2624.445) (-2630.139) (-2623.733) [-2619.712] * [-2631.950] (-2624.896) (-2626.024) (-2636.799) -- 0:05:57
      114500 -- (-2627.929) [-2619.903] (-2626.282) (-2623.643) * (-2629.024) (-2627.612) [-2624.044] (-2629.728) -- 0:06:03
      115000 -- (-2627.225) (-2624.831) (-2639.770) [-2625.371] * [-2627.711] (-2628.631) (-2628.555) (-2628.711) -- 0:06:01

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-2623.320) (-2626.809) (-2626.744) [-2626.448] * (-2635.104) [-2633.047] (-2623.898) (-2628.075) -- 0:05:59
      116000 -- (-2622.278) (-2626.851) (-2636.141) [-2623.717] * (-2634.101) [-2626.738] (-2620.866) (-2625.772) -- 0:05:58
      116500 -- [-2623.621] (-2635.569) (-2643.579) (-2628.708) * (-2625.204) [-2624.997] (-2621.990) (-2630.083) -- 0:05:56
      117000 -- (-2625.818) (-2623.510) (-2639.740) [-2624.205] * (-2627.789) (-2625.052) (-2629.094) [-2627.623] -- 0:06:02
      117500 -- [-2619.371] (-2632.460) (-2633.257) (-2628.895) * [-2624.355] (-2623.230) (-2625.874) (-2626.154) -- 0:06:00
      118000 -- (-2618.994) (-2631.231) (-2629.865) [-2624.740] * (-2623.655) (-2629.312) [-2636.007] (-2629.898) -- 0:05:58
      118500 -- (-2627.894) [-2631.150] (-2636.373) (-2625.650) * [-2619.372] (-2625.301) (-2624.675) (-2641.183) -- 0:05:57
      119000 -- [-2625.650] (-2633.695) (-2629.159) (-2642.429) * (-2632.216) [-2625.077] (-2619.521) (-2625.532) -- 0:05:55
      119500 -- (-2622.840) (-2627.036) (-2629.104) [-2628.327] * (-2632.246) [-2623.192] (-2626.043) (-2625.177) -- 0:06:01
      120000 -- (-2623.401) (-2623.869) [-2628.576] (-2623.632) * (-2624.512) [-2630.850] (-2625.123) (-2625.879) -- 0:05:59

      Average standard deviation of split frequencies: 0.000000

      120500 -- (-2626.956) [-2622.437] (-2626.715) (-2628.179) * [-2626.055] (-2629.331) (-2631.363) (-2625.264) -- 0:05:57
      121000 -- [-2627.653] (-2622.479) (-2627.087) (-2632.808) * (-2638.842) (-2633.530) (-2625.434) [-2630.826] -- 0:05:55
      121500 -- (-2625.778) [-2622.755] (-2629.662) (-2625.966) * [-2629.723] (-2626.840) (-2630.908) (-2630.789) -- 0:05:54
      122000 -- (-2625.652) [-2634.145] (-2620.868) (-2622.324) * (-2622.736) (-2626.495) [-2623.820] (-2625.517) -- 0:05:59
      122500 -- [-2619.508] (-2623.767) (-2631.159) (-2621.338) * (-2639.053) (-2626.101) [-2631.774] (-2624.599) -- 0:05:58
      123000 -- (-2618.536) (-2624.161) (-2626.587) [-2620.723] * (-2621.488) (-2626.765) [-2627.477] (-2628.092) -- 0:05:56
      123500 -- (-2627.973) (-2625.101) [-2622.332] (-2621.063) * (-2629.342) (-2627.879) [-2623.371] (-2622.170) -- 0:05:54
      124000 -- (-2623.102) (-2626.487) [-2626.624] (-2622.606) * (-2628.834) (-2622.442) [-2620.675] (-2628.188) -- 0:05:53
      124500 -- (-2635.193) (-2632.460) [-2623.358] (-2623.467) * (-2625.493) (-2628.802) (-2623.048) [-2626.900] -- 0:05:58
      125000 -- (-2621.517) (-2630.762) (-2622.438) [-2625.046] * (-2639.003) (-2622.345) [-2625.680] (-2636.741) -- 0:05:57

      Average standard deviation of split frequencies: 0.000000

      125500 -- [-2629.021] (-2626.428) (-2628.689) (-2631.971) * (-2623.322) [-2625.316] (-2625.189) (-2631.723) -- 0:05:55
      126000 -- (-2628.368) (-2622.722) (-2635.492) [-2619.863] * [-2620.619] (-2634.830) (-2625.148) (-2627.812) -- 0:05:53
      126500 -- (-2636.889) (-2631.603) (-2628.131) [-2626.359] * (-2623.805) (-2627.683) (-2625.809) [-2622.742] -- 0:05:52
      127000 -- [-2624.041] (-2634.051) (-2627.497) (-2623.729) * (-2624.488) (-2638.374) [-2625.064] (-2631.482) -- 0:05:57
      127500 -- (-2628.118) [-2620.833] (-2627.874) (-2633.857) * [-2622.279] (-2631.803) (-2624.389) (-2632.881) -- 0:05:55
      128000 -- (-2626.680) (-2627.843) (-2628.028) [-2631.747] * (-2621.077) (-2626.224) (-2625.889) [-2628.473] -- 0:05:54
      128500 -- (-2622.750) [-2622.510] (-2638.517) (-2637.360) * (-2622.058) [-2624.853] (-2626.517) (-2638.234) -- 0:05:52
      129000 -- (-2624.167) [-2630.762] (-2635.150) (-2632.264) * [-2625.723] (-2623.566) (-2630.230) (-2621.621) -- 0:05:51
      129500 -- (-2634.224) [-2622.319] (-2625.554) (-2628.680) * (-2627.012) (-2623.956) [-2622.325] (-2620.011) -- 0:05:56
      130000 -- (-2627.407) (-2626.000) [-2624.027] (-2621.803) * [-2629.905] (-2630.130) (-2628.070) (-2626.278) -- 0:05:54

      Average standard deviation of split frequencies: 0.000000

      130500 -- [-2626.321] (-2631.957) (-2622.367) (-2624.245) * (-2631.123) (-2621.949) [-2624.204] (-2641.880) -- 0:05:53
      131000 -- (-2625.849) (-2625.170) [-2623.012] (-2629.046) * (-2625.349) [-2621.022] (-2625.623) (-2622.207) -- 0:05:51
      131500 -- (-2626.276) [-2626.227] (-2621.508) (-2620.613) * (-2625.444) [-2624.081] (-2628.560) (-2628.286) -- 0:05:50
      132000 -- (-2626.552) (-2623.026) (-2623.227) [-2629.492] * (-2628.604) [-2630.863] (-2629.234) (-2633.053) -- 0:05:55
      132500 -- [-2625.151] (-2622.233) (-2623.547) (-2630.959) * [-2624.598] (-2626.109) (-2632.684) (-2629.668) -- 0:05:53
      133000 -- [-2624.547] (-2623.032) (-2624.300) (-2631.616) * (-2636.014) [-2621.905] (-2631.927) (-2630.685) -- 0:05:52
      133500 -- (-2636.307) (-2624.777) [-2624.753] (-2621.789) * [-2624.711] (-2623.932) (-2623.062) (-2629.070) -- 0:05:50
      134000 -- (-2633.017) [-2623.036] (-2624.508) (-2632.386) * [-2628.200] (-2620.736) (-2620.799) (-2627.325) -- 0:05:48
      134500 -- (-2642.092) (-2625.510) [-2624.042] (-2623.631) * (-2628.478) (-2625.775) [-2629.834] (-2631.751) -- 0:05:53
      135000 -- [-2626.028] (-2623.136) (-2626.026) (-2620.580) * [-2625.424] (-2631.712) (-2628.645) (-2623.402) -- 0:05:52

      Average standard deviation of split frequencies: 0.000000

      135500 -- [-2623.376] (-2629.326) (-2620.054) (-2625.204) * (-2620.886) [-2624.290] (-2622.229) (-2629.028) -- 0:05:50
      136000 -- (-2622.960) (-2627.129) [-2622.864] (-2626.086) * (-2625.927) (-2624.790) (-2626.196) [-2623.889] -- 0:05:49
      136500 -- (-2623.987) (-2634.150) [-2616.927] (-2624.055) * [-2628.655] (-2622.580) (-2630.085) (-2633.293) -- 0:05:47
      137000 -- (-2627.000) (-2630.255) (-2626.059) [-2625.327] * [-2625.932] (-2636.025) (-2627.081) (-2625.747) -- 0:05:52
      137500 -- (-2626.348) [-2623.000] (-2626.130) (-2628.083) * (-2625.835) (-2623.907) (-2622.566) [-2624.262] -- 0:05:51
      138000 -- [-2623.104] (-2628.903) (-2626.100) (-2624.070) * [-2623.488] (-2632.766) (-2624.657) (-2624.032) -- 0:05:49
      138500 -- (-2630.718) (-2629.269) (-2626.610) [-2625.801] * (-2631.157) [-2625.535] (-2627.148) (-2624.010) -- 0:05:48
      139000 -- (-2630.488) (-2630.243) (-2631.054) [-2623.639] * (-2621.792) (-2633.686) (-2625.797) [-2620.861] -- 0:05:46
      139500 -- (-2626.416) [-2629.878] (-2628.355) (-2625.694) * (-2623.708) (-2624.435) [-2626.500] (-2624.747) -- 0:05:51
      140000 -- (-2628.834) (-2630.459) [-2634.681] (-2633.885) * [-2630.762] (-2626.397) (-2627.961) (-2622.549) -- 0:05:50

      Average standard deviation of split frequencies: 0.000000

      140500 -- (-2630.562) (-2628.020) [-2623.270] (-2634.837) * (-2629.710) [-2627.729] (-2621.500) (-2622.309) -- 0:05:48
      141000 -- [-2621.209] (-2633.394) (-2622.080) (-2632.654) * [-2621.274] (-2623.934) (-2630.422) (-2625.165) -- 0:05:47
      141500 -- (-2627.550) [-2623.596] (-2628.085) (-2630.278) * (-2622.479) [-2636.090] (-2627.960) (-2629.883) -- 0:05:45
      142000 -- (-2625.638) (-2638.077) (-2627.842) [-2627.251] * (-2623.204) [-2623.330] (-2629.259) (-2621.061) -- 0:05:50
      142500 -- [-2629.479] (-2626.995) (-2622.887) (-2638.352) * (-2625.447) (-2622.223) [-2625.691] (-2626.287) -- 0:05:49
      143000 -- (-2623.324) (-2630.878) [-2622.603] (-2634.512) * (-2630.438) (-2636.018) [-2621.827] (-2626.775) -- 0:05:47
      143500 -- (-2628.946) (-2621.991) (-2633.460) [-2627.111] * [-2626.314] (-2623.074) (-2626.283) (-2629.367) -- 0:05:46
      144000 -- (-2629.515) (-2630.124) [-2625.394] (-2624.914) * (-2627.460) (-2623.925) [-2622.343] (-2625.565) -- 0:05:44
      144500 -- (-2624.668) (-2632.154) [-2631.091] (-2621.540) * (-2621.085) [-2623.354] (-2623.479) (-2623.143) -- 0:05:49
      145000 -- [-2625.367] (-2630.825) (-2627.051) (-2624.717) * (-2621.552) (-2621.141) [-2626.910] (-2623.493) -- 0:05:47

      Average standard deviation of split frequencies: 0.000000

      145500 -- (-2621.206) (-2632.114) (-2628.884) [-2632.149] * (-2623.867) (-2633.360) (-2620.735) [-2630.010] -- 0:05:46
      146000 -- (-2623.115) (-2641.715) (-2622.684) [-2623.175] * (-2631.927) (-2632.551) (-2622.856) [-2629.795] -- 0:05:45
      146500 -- (-2632.362) [-2631.586] (-2624.980) (-2627.561) * [-2622.113] (-2629.862) (-2626.857) (-2629.611) -- 0:05:43
      147000 -- (-2633.585) (-2627.968) [-2626.359] (-2628.666) * (-2629.626) [-2627.337] (-2623.833) (-2629.892) -- 0:05:48
      147500 -- (-2639.856) (-2623.598) [-2626.552] (-2636.471) * (-2624.495) [-2634.811] (-2627.608) (-2631.734) -- 0:05:46
      148000 -- [-2625.590] (-2629.345) (-2623.391) (-2630.106) * (-2630.906) (-2624.557) [-2619.859] (-2627.293) -- 0:05:45
      148500 -- (-2626.702) [-2628.740] (-2630.638) (-2630.644) * [-2632.678] (-2631.517) (-2623.967) (-2625.083) -- 0:05:44
      149000 -- (-2625.264) [-2629.522] (-2628.555) (-2626.380) * [-2622.094] (-2632.650) (-2631.812) (-2623.504) -- 0:05:42
      149500 -- (-2628.247) [-2622.248] (-2632.370) (-2622.155) * (-2623.868) (-2627.948) [-2629.020] (-2624.118) -- 0:05:47
      150000 -- (-2632.720) [-2631.282] (-2627.789) (-2621.054) * (-2620.286) (-2623.106) (-2623.114) [-2621.236] -- 0:05:45

      Average standard deviation of split frequencies: 0.000000

      150500 -- (-2618.718) (-2620.738) [-2624.992] (-2622.634) * [-2620.988] (-2626.755) (-2631.798) (-2629.279) -- 0:05:44
      151000 -- (-2619.621) [-2625.335] (-2635.444) (-2629.804) * (-2621.035) [-2625.101] (-2630.505) (-2624.569) -- 0:05:42
      151500 -- (-2625.420) (-2617.790) (-2637.751) [-2625.674] * [-2624.077] (-2621.340) (-2635.635) (-2623.956) -- 0:05:41
      152000 -- (-2629.555) (-2627.241) (-2629.408) [-2628.600] * (-2628.307) (-2626.484) (-2628.143) [-2624.808] -- 0:05:45
      152500 -- [-2628.015] (-2626.352) (-2634.058) (-2633.279) * (-2624.829) [-2626.852] (-2622.272) (-2626.404) -- 0:05:44
      153000 -- (-2627.615) (-2623.894) (-2633.406) [-2632.730] * (-2630.303) [-2622.164] (-2625.099) (-2622.125) -- 0:05:43
      153500 -- [-2632.870] (-2634.632) (-2631.312) (-2628.611) * (-2622.716) [-2627.477] (-2622.322) (-2634.792) -- 0:05:41
      154000 -- [-2633.644] (-2626.901) (-2625.311) (-2632.209) * [-2623.669] (-2625.764) (-2626.058) (-2627.934) -- 0:05:46
      154500 -- (-2626.333) [-2622.606] (-2623.292) (-2631.309) * [-2626.624] (-2631.740) (-2626.330) (-2623.366) -- 0:05:44
      155000 -- (-2633.525) (-2623.168) [-2623.871] (-2630.855) * (-2635.536) [-2620.205] (-2627.798) (-2624.238) -- 0:05:43

      Average standard deviation of split frequencies: 0.000000

      155500 -- (-2631.807) [-2622.632] (-2630.754) (-2628.592) * [-2631.035] (-2629.870) (-2632.348) (-2622.085) -- 0:05:42
      156000 -- (-2628.794) [-2625.396] (-2628.536) (-2627.184) * (-2634.845) (-2629.170) (-2636.060) [-2629.993] -- 0:05:40
      156500 -- [-2627.390] (-2637.441) (-2631.739) (-2621.115) * (-2622.628) (-2622.279) (-2628.246) [-2626.546] -- 0:05:44
      157000 -- (-2632.111) (-2631.858) [-2623.357] (-2629.825) * (-2628.559) (-2629.417) [-2620.605] (-2621.861) -- 0:05:43
      157500 -- (-2626.353) (-2625.959) [-2623.809] (-2629.259) * [-2629.746] (-2625.140) (-2625.489) (-2627.733) -- 0:05:42
      158000 -- [-2626.190] (-2622.343) (-2629.046) (-2619.664) * (-2625.834) (-2625.048) [-2625.828] (-2627.669) -- 0:05:41
      158500 -- (-2626.889) [-2618.447] (-2623.753) (-2630.917) * (-2624.157) (-2625.390) [-2624.957] (-2626.428) -- 0:05:39
      159000 -- [-2619.367] (-2630.544) (-2627.333) (-2626.251) * [-2623.200] (-2628.602) (-2628.329) (-2633.663) -- 0:05:43
      159500 -- [-2626.118] (-2635.868) (-2626.208) (-2631.027) * (-2620.115) (-2632.366) (-2619.842) [-2627.790] -- 0:05:42
      160000 -- (-2632.409) (-2622.667) [-2634.810] (-2627.023) * (-2626.465) (-2629.744) [-2624.157] (-2627.734) -- 0:05:41

      Average standard deviation of split frequencies: 0.000000

      160500 -- [-2626.675] (-2622.212) (-2640.889) (-2626.862) * [-2624.328] (-2628.401) (-2629.055) (-2627.709) -- 0:05:39
      161000 -- (-2623.995) [-2630.722] (-2630.183) (-2629.682) * (-2626.036) [-2630.924] (-2619.673) (-2627.606) -- 0:05:38
      161500 -- [-2623.725] (-2630.420) (-2632.850) (-2633.468) * (-2624.272) (-2624.674) [-2626.666] (-2623.791) -- 0:05:42
      162000 -- (-2627.012) [-2622.050] (-2624.151) (-2634.104) * [-2629.459] (-2626.021) (-2621.882) (-2627.414) -- 0:05:41
      162500 -- [-2627.135] (-2633.454) (-2620.221) (-2624.690) * (-2624.695) (-2622.348) (-2624.221) [-2629.813] -- 0:05:40
      163000 -- (-2626.289) (-2630.661) (-2621.658) [-2622.285] * (-2622.635) (-2621.668) (-2626.554) [-2627.407] -- 0:05:38
      163500 -- (-2631.394) (-2620.062) (-2624.836) [-2619.000] * [-2623.053] (-2622.736) (-2627.310) (-2624.572) -- 0:05:37
      164000 -- (-2625.841) (-2624.681) (-2624.685) [-2626.327] * (-2626.588) (-2629.047) (-2624.725) [-2624.516] -- 0:05:41
      164500 -- (-2636.313) (-2622.847) (-2628.603) [-2623.997] * (-2625.451) (-2631.759) (-2627.621) [-2621.548] -- 0:05:40
      165000 -- (-2623.095) [-2630.313] (-2636.613) (-2628.773) * [-2629.375] (-2632.966) (-2634.987) (-2633.509) -- 0:05:39

      Average standard deviation of split frequencies: 0.000000

      165500 -- [-2628.114] (-2632.703) (-2626.094) (-2627.265) * (-2635.587) [-2623.165] (-2636.115) (-2633.528) -- 0:05:37
      166000 -- (-2626.338) (-2625.765) (-2621.638) [-2623.525] * (-2626.577) (-2623.710) [-2628.509] (-2632.419) -- 0:05:36
      166500 -- (-2619.900) [-2625.600] (-2630.007) (-2625.164) * (-2634.380) (-2625.916) [-2624.317] (-2636.304) -- 0:05:40
      167000 -- (-2624.746) (-2618.322) [-2622.899] (-2623.472) * [-2630.120] (-2631.911) (-2629.810) (-2632.367) -- 0:05:39
      167500 -- [-2622.053] (-2631.048) (-2620.594) (-2630.291) * (-2630.917) [-2624.589] (-2625.806) (-2629.480) -- 0:05:37
      168000 -- (-2628.473) [-2626.004] (-2631.157) (-2628.831) * (-2623.172) [-2622.881] (-2625.549) (-2630.467) -- 0:05:36
      168500 -- (-2621.461) [-2624.287] (-2637.295) (-2621.463) * (-2625.513) (-2625.480) (-2636.774) [-2626.889] -- 0:05:35
      169000 -- (-2631.345) (-2628.835) (-2630.545) [-2622.540] * [-2622.452] (-2629.827) (-2633.682) (-2637.020) -- 0:05:39
      169500 -- (-2624.060) (-2632.279) (-2631.513) [-2631.234] * (-2626.542) [-2627.730] (-2635.806) (-2626.912) -- 0:05:38
      170000 -- [-2624.884] (-2624.481) (-2631.365) (-2625.314) * (-2627.048) [-2621.843] (-2630.656) (-2627.094) -- 0:05:36

      Average standard deviation of split frequencies: 0.000000

      170500 -- [-2619.212] (-2625.431) (-2623.328) (-2629.426) * [-2624.696] (-2626.595) (-2623.758) (-2627.215) -- 0:05:35
      171000 -- [-2631.721] (-2627.274) (-2628.349) (-2628.269) * [-2624.888] (-2621.866) (-2634.627) (-2630.955) -- 0:05:34
      171500 -- [-2630.628] (-2622.366) (-2628.610) (-2624.319) * (-2624.979) (-2630.159) [-2626.575] (-2626.929) -- 0:05:38
      172000 -- [-2619.135] (-2628.736) (-2627.458) (-2626.733) * (-2623.335) (-2632.880) [-2624.404] (-2629.557) -- 0:05:36
      172500 -- (-2624.697) (-2621.464) (-2627.847) [-2626.589] * (-2628.771) (-2631.707) [-2625.696] (-2637.498) -- 0:05:35
      173000 -- (-2627.512) (-2624.465) [-2622.798] (-2625.378) * (-2629.593) (-2624.621) (-2626.093) [-2632.211] -- 0:05:34
      173500 -- (-2627.205) (-2622.236) [-2626.997] (-2628.112) * (-2623.540) [-2626.684] (-2623.107) (-2633.779) -- 0:05:33
      174000 -- (-2630.866) (-2621.203) (-2624.640) [-2619.338] * (-2626.340) [-2624.731] (-2631.126) (-2631.223) -- 0:05:37
      174500 -- [-2625.068] (-2628.338) (-2628.213) (-2622.284) * (-2623.456) (-2622.614) [-2625.610] (-2635.547) -- 0:05:35
      175000 -- (-2626.656) [-2621.453] (-2630.182) (-2624.479) * [-2621.981] (-2625.646) (-2624.608) (-2630.782) -- 0:05:34

      Average standard deviation of split frequencies: 0.000000

      175500 -- (-2633.259) (-2626.385) (-2623.647) [-2620.458] * (-2626.826) (-2624.524) (-2624.069) [-2623.516] -- 0:05:33
      176000 -- [-2621.566] (-2624.254) (-2629.705) (-2628.843) * [-2623.001] (-2622.764) (-2623.520) (-2620.871) -- 0:05:32
      176500 -- [-2622.450] (-2630.768) (-2628.687) (-2626.612) * (-2632.287) (-2625.701) (-2630.014) [-2624.019] -- 0:05:35
      177000 -- (-2629.131) [-2623.301] (-2635.232) (-2626.183) * [-2628.757] (-2626.535) (-2638.166) (-2626.616) -- 0:05:34
      177500 -- [-2623.112] (-2621.646) (-2633.619) (-2623.605) * [-2624.905] (-2623.263) (-2631.214) (-2628.405) -- 0:05:33
      178000 -- (-2624.946) [-2624.275] (-2634.023) (-2629.525) * (-2628.149) (-2634.392) (-2626.286) [-2625.161] -- 0:05:32
      178500 -- (-2620.741) (-2627.114) [-2635.992] (-2622.755) * (-2625.914) (-2629.296) [-2624.093] (-2630.873) -- 0:05:31
      179000 -- (-2621.950) (-2625.450) (-2634.118) [-2624.002] * (-2627.135) (-2621.885) [-2629.130] (-2622.488) -- 0:05:34
      179500 -- (-2625.725) (-2627.422) [-2627.516] (-2630.663) * (-2626.713) (-2619.841) (-2630.935) [-2630.907] -- 0:05:33
      180000 -- (-2630.449) [-2625.087] (-2623.661) (-2622.125) * [-2630.640] (-2630.548) (-2624.332) (-2627.157) -- 0:05:32

      Average standard deviation of split frequencies: 0.000000

      180500 -- (-2632.599) [-2626.945] (-2628.583) (-2627.846) * (-2628.772) (-2626.692) (-2628.751) [-2620.166] -- 0:05:31
      181000 -- (-2627.738) [-2627.884] (-2631.930) (-2625.633) * (-2634.744) [-2630.992] (-2626.923) (-2631.576) -- 0:05:30
      181500 -- (-2627.196) (-2628.144) (-2627.152) [-2625.503] * (-2639.923) [-2627.088] (-2627.351) (-2632.220) -- 0:05:33
      182000 -- (-2625.615) [-2624.294] (-2628.869) (-2628.635) * (-2630.399) [-2628.504] (-2630.244) (-2637.767) -- 0:05:32
      182500 -- (-2627.972) (-2632.243) (-2627.612) [-2619.453] * (-2622.770) (-2626.543) [-2622.592] (-2642.370) -- 0:05:31
      183000 -- (-2624.510) (-2623.970) [-2626.625] (-2632.615) * (-2627.090) (-2634.215) (-2619.873) [-2635.356] -- 0:05:30
      183500 -- (-2628.916) [-2618.506] (-2625.559) (-2628.459) * (-2624.771) [-2626.334] (-2631.626) (-2639.350) -- 0:05:29
      184000 -- (-2621.425) (-2625.455) (-2630.173) [-2630.948] * (-2623.653) [-2625.411] (-2626.817) (-2624.015) -- 0:05:32
      184500 -- (-2621.005) (-2622.860) [-2624.154] (-2621.571) * [-2623.738] (-2626.146) (-2636.730) (-2635.522) -- 0:05:31
      185000 -- (-2631.410) (-2624.886) (-2627.020) [-2623.235] * [-2616.665] (-2621.503) (-2621.142) (-2623.799) -- 0:05:30

      Average standard deviation of split frequencies: 0.000000

      185500 -- (-2624.557) (-2621.884) [-2619.666] (-2624.758) * [-2621.662] (-2627.443) (-2633.693) (-2626.645) -- 0:05:29
      186000 -- [-2621.485] (-2625.170) (-2626.668) (-2626.755) * (-2624.144) [-2626.730] (-2632.964) (-2626.574) -- 0:05:28
      186500 -- [-2626.054] (-2621.119) (-2633.273) (-2625.896) * [-2618.773] (-2624.142) (-2629.472) (-2634.314) -- 0:05:31
      187000 -- (-2634.037) (-2627.492) [-2624.307] (-2631.795) * (-2626.115) [-2625.177] (-2625.715) (-2626.934) -- 0:05:30
      187500 -- (-2632.803) [-2622.441] (-2624.386) (-2628.932) * (-2627.516) (-2627.032) (-2623.303) [-2629.680] -- 0:05:29
      188000 -- (-2637.605) (-2627.607) (-2630.031) [-2630.123] * [-2627.625] (-2625.438) (-2636.602) (-2625.869) -- 0:05:28
      188500 -- (-2629.691) (-2623.658) (-2626.744) [-2622.688] * (-2621.595) [-2629.659] (-2625.752) (-2632.239) -- 0:05:27
      189000 -- (-2627.448) (-2632.614) [-2624.532] (-2624.334) * (-2628.241) (-2624.679) (-2623.892) [-2628.762] -- 0:05:30
      189500 -- (-2621.966) [-2633.784] (-2626.107) (-2621.543) * (-2637.391) [-2620.447] (-2626.508) (-2622.644) -- 0:05:29
      190000 -- (-2626.025) (-2632.109) (-2630.633) [-2631.861] * (-2623.280) (-2625.812) [-2627.414] (-2630.589) -- 0:05:28

      Average standard deviation of split frequencies: 0.000000

      190500 -- (-2625.506) (-2628.104) (-2629.496) [-2633.496] * [-2630.071] (-2622.423) (-2632.283) (-2627.551) -- 0:05:27
      191000 -- (-2631.566) (-2625.125) (-2628.869) [-2619.997] * (-2628.610) [-2629.051] (-2638.340) (-2623.558) -- 0:05:26
      191500 -- (-2625.156) (-2627.473) (-2634.125) [-2626.932] * (-2625.168) [-2629.440] (-2625.834) (-2632.610) -- 0:05:29
      192000 -- [-2625.948] (-2626.103) (-2624.716) (-2622.702) * (-2625.357) (-2620.693) (-2623.058) [-2625.210] -- 0:05:28
      192500 -- (-2625.659) (-2629.080) (-2626.050) [-2630.598] * (-2625.983) [-2623.434] (-2624.962) (-2630.444) -- 0:05:27
      193000 -- (-2627.347) (-2623.375) (-2634.778) [-2629.521] * (-2625.821) [-2621.482] (-2631.438) (-2628.167) -- 0:05:26
      193500 -- (-2623.931) (-2631.787) (-2629.338) [-2632.817] * (-2629.017) [-2630.386] (-2624.325) (-2623.381) -- 0:05:25
      194000 -- [-2626.385] (-2623.554) (-2631.849) (-2630.075) * (-2631.901) (-2627.033) (-2626.375) [-2628.341] -- 0:05:28
      194500 -- [-2630.238] (-2629.487) (-2634.891) (-2631.550) * (-2631.847) (-2626.090) [-2624.879] (-2626.553) -- 0:05:27
      195000 -- [-2627.353] (-2625.262) (-2633.329) (-2631.367) * (-2626.526) (-2624.316) (-2620.741) [-2627.923] -- 0:05:26

      Average standard deviation of split frequencies: 0.000000

      195500 -- [-2626.719] (-2623.900) (-2637.192) (-2634.066) * (-2625.997) (-2631.165) (-2623.077) [-2631.806] -- 0:05:25
      196000 -- (-2625.843) [-2624.538] (-2636.993) (-2632.458) * [-2626.560] (-2622.843) (-2629.106) (-2626.085) -- 0:05:24
      196500 -- (-2623.689) (-2630.990) [-2629.849] (-2627.321) * (-2629.731) [-2621.985] (-2620.774) (-2620.069) -- 0:05:27
      197000 -- (-2628.891) (-2625.679) [-2627.434] (-2631.634) * [-2632.024] (-2619.314) (-2621.832) (-2627.933) -- 0:05:26
      197500 -- (-2625.695) [-2623.064] (-2628.783) (-2629.229) * (-2624.597) [-2626.962] (-2618.312) (-2623.709) -- 0:05:25
      198000 -- (-2629.320) (-2625.698) (-2622.317) [-2628.402] * (-2633.618) [-2622.032] (-2622.069) (-2633.153) -- 0:05:24
      198500 -- (-2639.169) (-2626.680) (-2631.803) [-2623.537] * (-2628.868) [-2630.088] (-2625.738) (-2622.354) -- 0:05:23
      199000 -- (-2622.862) (-2635.047) [-2623.023] (-2622.307) * (-2625.606) [-2623.783] (-2628.041) (-2623.708) -- 0:05:26
      199500 -- (-2629.114) [-2623.290] (-2625.634) (-2619.255) * (-2626.045) (-2628.111) [-2625.406] (-2627.384) -- 0:05:25
      200000 -- (-2626.357) (-2632.368) (-2626.679) [-2630.193] * (-2627.108) (-2631.203) [-2623.004] (-2623.684) -- 0:05:24

      Average standard deviation of split frequencies: 0.000000

      200500 -- [-2623.821] (-2636.816) (-2632.332) (-2628.667) * (-2626.582) (-2627.028) [-2628.895] (-2625.785) -- 0:05:22
      201000 -- [-2627.530] (-2637.906) (-2623.803) (-2629.579) * [-2626.355] (-2621.310) (-2634.399) (-2623.161) -- 0:05:21
      201500 -- (-2633.832) (-2634.199) [-2627.998] (-2622.129) * (-2618.258) (-2627.248) (-2631.715) [-2628.554] -- 0:05:24
      202000 -- (-2632.976) (-2627.042) [-2628.455] (-2630.583) * (-2623.817) (-2628.714) (-2628.945) [-2629.400] -- 0:05:23
      202500 -- (-2624.098) (-2630.901) [-2624.478] (-2623.601) * [-2625.751] (-2632.597) (-2633.557) (-2631.256) -- 0:05:22
      203000 -- (-2622.275) [-2630.792] (-2628.727) (-2627.435) * (-2624.541) [-2628.504] (-2625.565) (-2633.373) -- 0:05:21
      203500 -- (-2631.076) (-2624.940) (-2627.315) [-2626.812] * [-2621.434] (-2628.873) (-2627.475) (-2624.097) -- 0:05:20
      204000 -- (-2625.371) [-2619.632] (-2631.155) (-2624.810) * (-2628.573) (-2625.640) (-2628.059) [-2627.905] -- 0:05:23
      204500 -- [-2624.859] (-2630.810) (-2635.349) (-2629.804) * (-2626.075) (-2627.234) (-2623.665) [-2628.420] -- 0:05:22
      205000 -- (-2631.794) (-2627.793) (-2623.435) [-2623.416] * (-2627.693) [-2631.371] (-2629.158) (-2628.111) -- 0:05:21

      Average standard deviation of split frequencies: 0.000000

      205500 -- (-2633.824) [-2622.654] (-2622.572) (-2625.955) * [-2624.620] (-2627.916) (-2625.513) (-2627.821) -- 0:05:20
      206000 -- (-2628.467) [-2619.773] (-2635.797) (-2626.295) * (-2624.760) (-2626.575) (-2622.490) [-2623.833] -- 0:05:19
      206500 -- (-2628.069) [-2624.255] (-2631.385) (-2629.859) * (-2622.339) (-2627.411) (-2623.689) [-2630.002] -- 0:05:22
      207000 -- (-2623.720) (-2631.183) (-2633.533) [-2624.571] * (-2628.905) (-2627.552) [-2628.076] (-2623.404) -- 0:05:21
      207500 -- [-2623.882] (-2630.949) (-2629.836) (-2623.055) * (-2627.048) [-2628.803] (-2632.626) (-2626.939) -- 0:05:20
      208000 -- [-2625.297] (-2633.088) (-2627.785) (-2632.164) * [-2624.987] (-2631.315) (-2631.312) (-2629.890) -- 0:05:19
      208500 -- [-2624.659] (-2631.465) (-2626.703) (-2626.210) * (-2624.535) (-2624.513) (-2628.907) [-2624.899] -- 0:05:18
      209000 -- (-2629.474) (-2624.518) [-2619.639] (-2628.538) * (-2631.814) (-2625.814) (-2630.923) [-2618.675] -- 0:05:21
      209500 -- (-2629.732) (-2622.074) [-2619.063] (-2624.103) * (-2627.937) (-2630.513) (-2628.141) [-2628.650] -- 0:05:20
      210000 -- (-2623.572) (-2624.962) [-2626.589] (-2631.733) * (-2634.258) [-2624.078] (-2628.623) (-2634.547) -- 0:05:19

      Average standard deviation of split frequencies: 0.000000

      210500 -- (-2622.722) (-2630.046) [-2633.610] (-2632.844) * (-2629.013) (-2629.641) (-2628.592) [-2630.740] -- 0:05:18
      211000 -- [-2624.638] (-2630.101) (-2625.608) (-2627.935) * [-2627.487] (-2623.694) (-2627.728) (-2631.646) -- 0:05:17
      211500 -- [-2625.480] (-2626.627) (-2627.083) (-2626.003) * (-2626.419) (-2623.014) (-2625.550) [-2621.842] -- 0:05:20
      212000 -- (-2624.692) (-2625.757) [-2626.660] (-2628.743) * (-2629.807) (-2623.620) (-2633.457) [-2623.337] -- 0:05:19
      212500 -- (-2632.078) [-2623.430] (-2638.169) (-2621.069) * [-2620.338] (-2628.314) (-2631.144) (-2624.283) -- 0:05:18
      213000 -- [-2628.428] (-2622.405) (-2623.465) (-2627.238) * [-2623.271] (-2626.310) (-2622.620) (-2623.598) -- 0:05:17
      213500 -- (-2622.272) [-2631.465] (-2627.708) (-2623.530) * (-2629.544) [-2624.434] (-2627.667) (-2631.674) -- 0:05:16
      214000 -- (-2623.074) [-2621.529] (-2629.883) (-2630.511) * (-2628.316) [-2623.303] (-2630.170) (-2627.473) -- 0:05:19
      214500 -- (-2623.550) (-2626.928) [-2625.631] (-2628.639) * [-2632.517] (-2624.725) (-2636.027) (-2630.213) -- 0:05:18
      215000 -- (-2623.792) [-2623.636] (-2625.710) (-2623.955) * (-2630.372) [-2622.740] (-2624.017) (-2627.580) -- 0:05:17

      Average standard deviation of split frequencies: 0.000000

      215500 -- (-2626.998) (-2635.561) [-2618.534] (-2628.580) * [-2623.444] (-2626.968) (-2622.552) (-2621.281) -- 0:05:16
      216000 -- (-2627.949) (-2627.416) [-2621.196] (-2624.905) * (-2631.036) (-2625.749) (-2625.752) [-2627.002] -- 0:05:15
      216500 -- (-2626.977) (-2625.767) [-2620.005] (-2631.888) * (-2620.921) (-2623.605) (-2630.682) [-2628.292] -- 0:05:18
      217000 -- (-2631.367) (-2625.802) [-2624.057] (-2629.083) * [-2630.392] (-2627.906) (-2626.697) (-2632.098) -- 0:05:17
      217500 -- [-2621.496] (-2631.047) (-2623.411) (-2623.836) * (-2637.938) (-2626.146) (-2621.260) [-2627.318] -- 0:05:16
      218000 -- (-2622.266) [-2622.079] (-2630.238) (-2634.001) * (-2634.336) (-2624.032) (-2635.024) [-2627.088] -- 0:05:15
      218500 -- (-2627.537) (-2617.819) (-2629.609) [-2629.158] * (-2629.890) [-2621.897] (-2628.955) (-2627.179) -- 0:05:14
      219000 -- [-2624.687] (-2622.802) (-2625.117) (-2620.198) * (-2625.217) (-2634.509) [-2625.380] (-2630.604) -- 0:05:17
      219500 -- (-2631.502) (-2624.669) [-2625.336] (-2621.620) * [-2626.119] (-2623.413) (-2622.695) (-2624.878) -- 0:05:16
      220000 -- [-2627.132] (-2630.124) (-2629.694) (-2620.363) * (-2623.547) [-2626.017] (-2633.784) (-2622.636) -- 0:05:15

      Average standard deviation of split frequencies: 0.000000

      220500 -- (-2625.060) (-2622.499) [-2622.119] (-2624.521) * (-2624.059) (-2622.655) (-2643.292) [-2628.420] -- 0:05:14
      221000 -- (-2631.581) [-2623.169] (-2618.571) (-2628.373) * (-2635.114) (-2630.010) (-2625.212) [-2626.673] -- 0:05:13
      221500 -- (-2622.145) (-2622.252) (-2624.900) [-2623.421] * (-2625.983) (-2624.503) (-2623.196) [-2625.782] -- 0:05:16
      222000 -- (-2619.571) (-2621.962) (-2622.669) [-2620.116] * [-2626.682] (-2628.131) (-2626.449) (-2642.604) -- 0:05:15
      222500 -- (-2631.052) (-2626.699) [-2622.504] (-2628.442) * (-2625.839) [-2629.649] (-2629.678) (-2621.934) -- 0:05:14
      223000 -- [-2622.174] (-2631.695) (-2626.247) (-2625.866) * (-2627.082) (-2629.016) (-2628.381) [-2621.365] -- 0:05:13
      223500 -- [-2620.416] (-2631.800) (-2619.999) (-2635.459) * (-2633.716) (-2630.514) [-2623.984] (-2625.065) -- 0:05:12
      224000 -- (-2623.409) (-2624.869) (-2626.005) [-2629.141] * [-2625.814] (-2623.763) (-2623.484) (-2622.952) -- 0:05:15
      224500 -- (-2630.425) (-2627.901) [-2634.728] (-2630.639) * (-2632.085) [-2621.508] (-2628.550) (-2630.034) -- 0:05:14
      225000 -- (-2628.297) [-2619.561] (-2631.204) (-2629.183) * [-2626.225] (-2624.860) (-2625.474) (-2624.863) -- 0:05:13

      Average standard deviation of split frequencies: 0.000000

      225500 -- (-2639.229) [-2627.121] (-2624.964) (-2627.265) * (-2635.834) [-2625.603] (-2631.252) (-2629.678) -- 0:05:12
      226000 -- (-2630.050) (-2625.313) [-2623.219] (-2629.273) * (-2633.043) (-2625.625) (-2633.276) [-2629.367] -- 0:05:11
      226500 -- (-2631.276) [-2624.823] (-2623.713) (-2626.195) * (-2625.787) [-2622.492] (-2627.334) (-2621.817) -- 0:05:14
      227000 -- (-2631.908) (-2619.187) [-2623.831] (-2635.143) * (-2637.332) (-2634.969) (-2632.516) [-2628.901] -- 0:05:13
      227500 -- [-2622.740] (-2623.094) (-2626.984) (-2629.919) * (-2628.679) [-2621.290] (-2625.028) (-2627.394) -- 0:05:12
      228000 -- (-2623.367) (-2626.616) (-2624.504) [-2632.175] * (-2627.180) (-2628.761) (-2627.354) [-2628.107] -- 0:05:11
      228500 -- (-2632.276) (-2628.769) [-2625.098] (-2628.938) * (-2622.904) (-2626.607) [-2624.638] (-2620.594) -- 0:05:10
      229000 -- (-2633.413) [-2623.600] (-2624.171) (-2627.097) * (-2621.544) (-2626.380) (-2625.396) [-2623.326] -- 0:05:13
      229500 -- (-2625.747) [-2622.920] (-2631.043) (-2630.558) * (-2629.118) [-2622.637] (-2621.982) (-2623.405) -- 0:05:12
      230000 -- (-2628.342) (-2626.779) [-2621.570] (-2626.335) * [-2629.449] (-2621.475) (-2629.104) (-2624.195) -- 0:05:11

      Average standard deviation of split frequencies: 0.000000

      230500 -- (-2627.570) [-2626.309] (-2620.548) (-2628.261) * (-2626.186) (-2631.576) [-2621.955] (-2621.610) -- 0:05:10
      231000 -- (-2624.933) [-2622.465] (-2633.286) (-2633.711) * (-2627.354) (-2635.622) (-2624.128) [-2623.489] -- 0:05:09
      231500 -- (-2633.694) (-2632.013) [-2629.651] (-2629.835) * (-2624.221) (-2626.731) [-2622.833] (-2620.072) -- 0:05:12
      232000 -- (-2623.263) (-2636.531) (-2626.797) [-2626.705] * (-2622.764) (-2632.247) (-2628.707) [-2629.006] -- 0:05:11
      232500 -- (-2626.283) (-2631.216) (-2621.120) [-2622.503] * (-2624.439) [-2627.284] (-2630.321) (-2637.360) -- 0:05:10
      233000 -- (-2625.689) [-2627.096] (-2631.973) (-2626.261) * (-2626.920) (-2625.465) [-2624.588] (-2628.611) -- 0:05:09
      233500 -- (-2628.362) (-2632.583) (-2632.298) [-2624.448] * (-2625.494) (-2624.768) [-2627.889] (-2624.233) -- 0:05:11
      234000 -- (-2632.313) [-2629.688] (-2626.470) (-2624.459) * (-2625.745) (-2632.604) [-2627.019] (-2624.508) -- 0:05:10
      234500 -- (-2623.116) (-2627.301) (-2631.145) [-2625.386] * (-2624.026) (-2627.955) [-2618.735] (-2619.523) -- 0:05:10
      235000 -- (-2620.635) (-2632.816) [-2630.287] (-2627.451) * (-2624.371) [-2622.304] (-2619.905) (-2630.852) -- 0:05:09

      Average standard deviation of split frequencies: 0.000000

      235500 -- (-2623.542) (-2626.617) (-2626.592) [-2624.269] * (-2625.033) (-2632.206) (-2623.994) [-2629.765] -- 0:05:08
      236000 -- (-2627.338) [-2625.509] (-2630.315) (-2623.827) * (-2626.062) (-2628.393) [-2621.027] (-2637.314) -- 0:05:10
      236500 -- [-2622.562] (-2627.243) (-2629.036) (-2639.156) * (-2633.107) (-2625.044) (-2632.008) [-2628.996] -- 0:05:09
      237000 -- [-2624.939] (-2625.832) (-2633.150) (-2625.999) * (-2625.071) (-2626.502) (-2627.191) [-2623.312] -- 0:05:09
      237500 -- [-2622.176] (-2627.504) (-2636.018) (-2625.982) * [-2625.116] (-2627.268) (-2633.308) (-2629.819) -- 0:05:08
      238000 -- [-2624.033] (-2625.943) (-2635.854) (-2624.795) * (-2629.659) [-2624.562] (-2622.908) (-2630.298) -- 0:05:07
      238500 -- [-2620.326] (-2625.955) (-2629.001) (-2626.849) * [-2623.078] (-2621.915) (-2627.752) (-2627.157) -- 0:05:09
      239000 -- (-2625.735) (-2634.021) [-2620.960] (-2625.874) * (-2625.112) (-2625.052) (-2636.611) [-2625.476] -- 0:05:08
      239500 -- (-2626.024) (-2631.975) [-2625.265] (-2624.490) * (-2635.619) (-2632.426) [-2620.694] (-2620.142) -- 0:05:08
      240000 -- (-2636.913) (-2626.887) (-2631.849) [-2631.011] * (-2625.579) (-2624.976) [-2619.864] (-2631.734) -- 0:05:07

      Average standard deviation of split frequencies: 0.000000

      240500 -- [-2624.970] (-2625.986) (-2635.268) (-2622.560) * (-2625.397) (-2623.411) [-2621.106] (-2625.999) -- 0:05:09
      241000 -- (-2634.779) [-2629.017] (-2626.169) (-2630.960) * (-2622.123) (-2622.442) (-2626.301) [-2625.537] -- 0:05:08
      241500 -- (-2631.393) (-2628.157) (-2628.540) [-2622.525] * (-2627.464) (-2623.019) [-2623.116] (-2633.319) -- 0:05:07
      242000 -- (-2639.795) [-2625.408] (-2626.976) (-2624.334) * [-2619.459] (-2622.670) (-2626.850) (-2624.554) -- 0:05:06
      242500 -- (-2625.065) [-2632.538] (-2623.804) (-2623.770) * (-2627.639) (-2623.806) [-2627.694] (-2628.060) -- 0:05:06
      243000 -- [-2622.119] (-2629.818) (-2624.806) (-2623.732) * (-2629.693) [-2623.342] (-2624.160) (-2622.816) -- 0:05:08
      243500 -- (-2624.666) (-2630.381) (-2621.785) [-2621.961] * [-2624.721] (-2625.532) (-2637.379) (-2628.769) -- 0:05:07
      244000 -- (-2622.933) [-2619.532] (-2621.683) (-2627.827) * (-2626.030) (-2633.894) (-2631.975) [-2620.298] -- 0:05:06
      244500 -- [-2627.813] (-2622.556) (-2625.390) (-2620.810) * (-2624.983) [-2625.404] (-2622.707) (-2629.192) -- 0:05:05
      245000 -- (-2630.524) (-2626.418) (-2630.438) [-2623.674] * (-2625.626) (-2620.894) [-2628.711] (-2623.300) -- 0:05:05

      Average standard deviation of split frequencies: 0.000000

      245500 -- (-2630.280) (-2625.407) [-2625.775] (-2627.892) * [-2624.675] (-2627.504) (-2633.089) (-2625.151) -- 0:05:07
      246000 -- (-2633.252) [-2620.387] (-2635.986) (-2624.585) * [-2632.986] (-2621.590) (-2623.043) (-2633.748) -- 0:05:06
      246500 -- (-2630.475) [-2626.432] (-2628.525) (-2626.617) * [-2633.275] (-2629.831) (-2630.014) (-2634.948) -- 0:05:05
      247000 -- (-2623.828) [-2624.542] (-2624.910) (-2626.183) * (-2632.267) (-2630.300) [-2629.625] (-2625.000) -- 0:05:04
      247500 -- (-2627.368) [-2625.001] (-2625.556) (-2624.492) * (-2629.001) (-2627.679) (-2624.237) [-2625.564] -- 0:05:04
      248000 -- [-2629.201] (-2625.960) (-2628.159) (-2632.834) * (-2622.232) [-2632.522] (-2619.548) (-2624.859) -- 0:05:06
      248500 -- (-2628.332) [-2635.044] (-2624.731) (-2628.635) * (-2627.133) (-2625.605) [-2620.724] (-2623.425) -- 0:05:05
      249000 -- (-2625.732) (-2622.298) (-2624.260) [-2621.684] * [-2623.017] (-2633.483) (-2623.146) (-2624.716) -- 0:05:04
      249500 -- (-2624.416) [-2621.787] (-2629.618) (-2626.276) * (-2621.890) (-2627.509) [-2626.093] (-2631.067) -- 0:05:03
      250000 -- [-2627.077] (-2622.415) (-2623.216) (-2629.175) * (-2618.465) [-2628.961] (-2624.519) (-2626.938) -- 0:05:03

      Average standard deviation of split frequencies: 0.000000

      250500 -- (-2621.225) (-2630.429) [-2622.628] (-2635.538) * (-2625.476) (-2632.456) [-2626.870] (-2629.695) -- 0:05:05
      251000 -- (-2629.520) (-2631.479) [-2632.621] (-2626.373) * (-2624.291) (-2624.260) [-2625.882] (-2631.853) -- 0:05:04
      251500 -- (-2622.325) (-2627.264) [-2625.313] (-2627.352) * (-2625.296) (-2622.931) (-2626.234) [-2622.926] -- 0:05:03
      252000 -- (-2629.340) [-2635.147] (-2625.357) (-2629.645) * [-2626.980] (-2620.680) (-2627.465) (-2625.048) -- 0:05:02
      252500 -- (-2638.544) (-2626.780) [-2622.092] (-2627.974) * (-2627.007) (-2631.811) (-2621.390) [-2626.838] -- 0:05:01
      253000 -- (-2628.435) (-2622.483) [-2618.723] (-2628.813) * (-2632.557) (-2628.673) [-2620.019] (-2627.131) -- 0:05:04
      253500 -- (-2621.549) (-2624.554) (-2629.830) [-2625.444] * [-2635.025] (-2630.390) (-2624.300) (-2631.809) -- 0:05:03
      254000 -- (-2626.902) (-2623.754) (-2629.466) [-2622.706] * (-2636.102) (-2625.501) [-2620.376] (-2635.545) -- 0:05:02
      254500 -- (-2622.287) (-2627.977) [-2630.149] (-2624.539) * (-2634.203) [-2621.563] (-2628.012) (-2631.484) -- 0:05:01
      255000 -- (-2624.622) (-2628.634) [-2627.875] (-2622.894) * [-2622.156] (-2622.251) (-2630.380) (-2624.662) -- 0:05:00

      Average standard deviation of split frequencies: 0.000000

      255500 -- [-2620.198] (-2627.274) (-2625.372) (-2626.050) * (-2627.284) (-2622.780) [-2624.497] (-2626.647) -- 0:05:03
      256000 -- (-2621.779) (-2633.083) [-2623.945] (-2621.269) * (-2626.438) (-2620.820) [-2625.526] (-2636.433) -- 0:05:02
      256500 -- [-2625.362] (-2624.862) (-2630.944) (-2626.013) * (-2625.599) (-2626.357) [-2620.802] (-2631.427) -- 0:05:01
      257000 -- (-2632.485) (-2623.161) [-2627.954] (-2628.422) * (-2626.647) (-2624.650) (-2622.962) [-2626.423] -- 0:05:00
      257500 -- (-2624.263) (-2632.195) (-2629.848) [-2622.426] * (-2627.672) (-2631.438) [-2625.682] (-2631.836) -- 0:04:59
      258000 -- (-2630.470) (-2629.292) [-2629.870] (-2623.659) * [-2624.430] (-2634.185) (-2635.632) (-2636.362) -- 0:05:01
      258500 -- (-2620.319) (-2630.307) [-2625.693] (-2624.512) * (-2621.988) (-2627.857) [-2624.555] (-2638.685) -- 0:05:01
      259000 -- (-2628.364) (-2641.855) [-2620.437] (-2620.899) * (-2629.555) (-2635.657) (-2624.245) [-2625.131] -- 0:05:00
      259500 -- (-2623.852) (-2625.413) [-2628.958] (-2626.000) * (-2628.351) [-2621.296] (-2620.044) (-2634.052) -- 0:04:59
      260000 -- (-2624.902) [-2622.698] (-2632.060) (-2630.883) * (-2631.618) [-2623.790] (-2624.177) (-2626.352) -- 0:04:58

      Average standard deviation of split frequencies: 0.000000

      260500 -- (-2635.969) (-2626.850) [-2619.044] (-2627.313) * [-2627.318] (-2631.977) (-2621.589) (-2623.653) -- 0:05:00
      261000 -- [-2625.253] (-2628.266) (-2622.373) (-2628.339) * (-2622.557) [-2627.136] (-2628.739) (-2640.527) -- 0:05:00
      261500 -- (-2625.165) (-2619.008) [-2618.438] (-2620.398) * (-2629.738) (-2622.027) [-2627.125] (-2624.587) -- 0:04:59
      262000 -- [-2631.138] (-2626.515) (-2627.855) (-2629.169) * [-2625.684] (-2623.689) (-2624.726) (-2632.763) -- 0:04:58
      262500 -- (-2625.461) (-2623.777) (-2619.224) [-2631.515] * (-2637.770) (-2627.397) [-2625.909] (-2623.625) -- 0:04:57
      263000 -- (-2626.257) (-2623.887) (-2625.044) [-2630.318] * (-2631.620) (-2629.763) (-2627.895) [-2628.065] -- 0:04:59
      263500 -- (-2629.602) [-2624.924] (-2628.578) (-2630.686) * [-2626.358] (-2629.497) (-2631.219) (-2628.912) -- 0:04:59
      264000 -- (-2629.873) [-2621.337] (-2621.507) (-2627.387) * (-2619.083) (-2631.281) (-2625.902) [-2619.941] -- 0:04:58
      264500 -- [-2628.647] (-2623.567) (-2626.058) (-2625.986) * (-2622.424) (-2624.887) (-2629.856) [-2622.530] -- 0:04:57
      265000 -- (-2627.313) [-2632.750] (-2628.415) (-2622.339) * (-2628.212) (-2623.157) (-2620.406) [-2623.864] -- 0:04:56

      Average standard deviation of split frequencies: 0.000000

      265500 -- [-2623.961] (-2632.067) (-2623.468) (-2627.875) * (-2631.804) [-2625.453] (-2625.140) (-2623.747) -- 0:04:58
      266000 -- (-2622.870) (-2626.928) [-2632.486] (-2621.399) * (-2627.330) (-2630.875) (-2626.821) [-2626.045] -- 0:04:58
      266500 -- (-2633.107) [-2632.164] (-2629.835) (-2625.272) * (-2628.492) [-2631.507] (-2631.337) (-2628.183) -- 0:04:57
      267000 -- (-2625.955) (-2631.113) [-2626.743] (-2626.611) * [-2628.026] (-2623.033) (-2629.609) (-2634.267) -- 0:04:56
      267500 -- (-2621.243) (-2626.608) (-2628.938) [-2634.463] * [-2629.218] (-2625.252) (-2638.315) (-2622.780) -- 0:04:55
      268000 -- (-2630.605) [-2627.521] (-2623.704) (-2627.602) * [-2629.140] (-2622.286) (-2632.785) (-2626.980) -- 0:04:57
      268500 -- (-2627.071) [-2624.460] (-2626.811) (-2636.458) * [-2625.550] (-2627.077) (-2628.323) (-2622.687) -- 0:04:56
      269000 -- [-2628.548] (-2625.060) (-2624.932) (-2637.381) * (-2625.331) (-2627.911) (-2626.706) [-2623.200] -- 0:04:56
      269500 -- [-2626.939] (-2622.980) (-2630.586) (-2626.410) * (-2623.125) [-2622.237] (-2629.359) (-2625.136) -- 0:04:55
      270000 -- (-2632.732) (-2623.640) [-2623.233] (-2626.529) * (-2632.192) (-2631.613) (-2626.526) [-2625.467] -- 0:04:54

      Average standard deviation of split frequencies: 0.000000

      270500 -- (-2631.781) (-2626.882) [-2623.474] (-2624.265) * (-2621.803) (-2621.276) [-2625.394] (-2629.110) -- 0:04:56
      271000 -- (-2635.177) (-2630.171) (-2625.551) [-2628.376] * [-2632.080] (-2629.007) (-2628.260) (-2630.535) -- 0:04:55
      271500 -- (-2632.720) [-2624.298] (-2624.125) (-2625.893) * (-2629.537) (-2621.880) (-2633.382) [-2619.713] -- 0:04:55
      272000 -- (-2622.251) [-2628.440] (-2628.811) (-2626.760) * [-2626.460] (-2628.745) (-2626.119) (-2630.191) -- 0:04:54
      272500 -- (-2630.279) (-2635.622) [-2627.010] (-2622.049) * (-2627.083) (-2627.599) [-2629.173] (-2626.785) -- 0:04:53
      273000 -- [-2627.346] (-2622.117) (-2631.484) (-2629.880) * (-2624.547) (-2622.167) [-2619.519] (-2626.120) -- 0:04:55
      273500 -- (-2632.670) (-2630.852) (-2628.024) [-2632.296] * (-2629.712) (-2627.453) (-2627.453) [-2624.123] -- 0:04:54
      274000 -- (-2629.989) (-2625.896) (-2629.337) [-2623.808] * (-2626.302) (-2636.362) [-2622.364] (-2635.306) -- 0:04:54
      274500 -- (-2626.097) (-2627.430) [-2624.347] (-2624.712) * (-2636.093) (-2622.979) (-2626.317) [-2624.522] -- 0:04:53
      275000 -- (-2627.845) (-2625.185) (-2627.064) [-2625.730] * (-2625.695) [-2628.176] (-2634.755) (-2624.386) -- 0:04:52

      Average standard deviation of split frequencies: 0.000000

      275500 -- (-2625.020) (-2624.583) (-2626.238) [-2629.594] * (-2626.801) (-2624.945) [-2626.182] (-2626.570) -- 0:04:54
      276000 -- (-2627.257) (-2626.290) [-2625.888] (-2623.977) * (-2628.419) (-2635.288) [-2623.961] (-2630.497) -- 0:04:53
      276500 -- [-2626.131] (-2630.344) (-2625.835) (-2631.168) * (-2626.294) [-2629.024] (-2623.913) (-2639.378) -- 0:04:53
      277000 -- (-2626.617) (-2633.584) [-2626.019] (-2627.474) * (-2629.510) (-2625.410) [-2622.329] (-2630.440) -- 0:04:52
      277500 -- [-2626.143] (-2628.943) (-2630.133) (-2630.104) * (-2624.705) [-2622.617] (-2627.236) (-2624.740) -- 0:04:51
      278000 -- [-2620.537] (-2622.049) (-2628.592) (-2629.914) * (-2624.484) [-2622.707] (-2625.041) (-2634.117) -- 0:04:53
      278500 -- (-2628.903) (-2623.924) [-2629.085] (-2630.778) * (-2620.962) (-2632.068) (-2637.506) [-2626.033] -- 0:04:52
      279000 -- (-2626.402) (-2634.258) (-2631.869) [-2619.972] * (-2625.740) (-2627.293) [-2623.232] (-2627.537) -- 0:04:52
      279500 -- [-2630.205] (-2625.336) (-2623.974) (-2627.231) * (-2628.216) (-2625.217) [-2619.209] (-2629.196) -- 0:04:51
      280000 -- (-2631.782) (-2631.437) [-2628.254] (-2631.751) * (-2629.983) (-2627.066) [-2624.540] (-2631.629) -- 0:04:50

      Average standard deviation of split frequencies: 0.000000

      280500 -- (-2624.422) (-2624.218) (-2628.729) [-2621.063] * [-2631.568] (-2621.330) (-2636.606) (-2625.350) -- 0:04:52
      281000 -- (-2624.024) (-2628.219) [-2622.146] (-2624.358) * (-2633.693) (-2626.748) [-2626.509] (-2622.962) -- 0:04:51
      281500 -- (-2627.630) (-2622.490) [-2623.919] (-2627.706) * (-2624.373) [-2629.282] (-2625.951) (-2624.314) -- 0:04:50
      282000 -- (-2625.803) (-2626.541) (-2628.086) [-2625.003] * (-2625.121) (-2624.110) [-2624.277] (-2631.245) -- 0:04:50
      282500 -- (-2626.323) (-2621.381) (-2630.506) [-2634.773] * (-2623.471) [-2623.868] (-2628.146) (-2623.659) -- 0:04:49
      283000 -- (-2625.096) [-2629.295] (-2628.115) (-2621.428) * (-2631.675) (-2625.258) [-2625.992] (-2626.326) -- 0:04:51
      283500 -- (-2628.887) (-2627.762) [-2629.985] (-2625.525) * [-2627.644] (-2622.860) (-2629.113) (-2628.789) -- 0:04:50
      284000 -- (-2623.601) (-2630.842) (-2623.226) [-2626.493] * (-2626.284) (-2629.943) (-2625.622) [-2621.823] -- 0:04:49
      284500 -- (-2625.258) (-2629.735) [-2624.381] (-2628.584) * (-2622.290) [-2620.806] (-2640.120) (-2624.869) -- 0:04:49
      285000 -- (-2632.796) (-2625.308) [-2624.234] (-2623.295) * (-2623.309) [-2620.289] (-2633.600) (-2623.359) -- 0:04:48

      Average standard deviation of split frequencies: 0.000000

      285500 -- (-2635.226) (-2620.912) [-2624.236] (-2628.578) * [-2622.109] (-2624.468) (-2629.911) (-2629.459) -- 0:04:50
      286000 -- (-2626.039) (-2623.772) [-2623.914] (-2625.763) * (-2626.326) (-2628.104) [-2628.971] (-2628.871) -- 0:04:49
      286500 -- (-2624.849) (-2628.044) (-2634.708) [-2622.718] * (-2621.642) [-2621.369] (-2630.583) (-2621.420) -- 0:04:48
      287000 -- (-2628.026) (-2622.487) [-2625.887] (-2626.127) * (-2621.613) (-2625.068) (-2626.837) [-2622.855] -- 0:04:48
      287500 -- (-2626.990) (-2627.609) (-2631.474) [-2624.770] * (-2634.240) [-2620.345] (-2623.503) (-2622.861) -- 0:04:47
      288000 -- [-2628.776] (-2627.436) (-2628.524) (-2623.907) * (-2631.409) (-2620.100) (-2626.094) [-2628.501] -- 0:04:49
      288500 -- [-2622.383] (-2627.530) (-2631.068) (-2628.552) * (-2628.972) (-2621.179) (-2633.506) [-2623.935] -- 0:04:48
      289000 -- [-2624.534] (-2631.397) (-2626.404) (-2627.723) * (-2636.249) (-2629.892) (-2624.240) [-2625.828] -- 0:04:47
      289500 -- (-2618.466) (-2626.909) [-2629.217] (-2624.311) * (-2635.580) [-2625.775] (-2622.728) (-2625.814) -- 0:04:47
      290000 -- (-2631.196) [-2622.490] (-2626.382) (-2624.414) * [-2626.411] (-2617.651) (-2626.078) (-2623.924) -- 0:04:46

      Average standard deviation of split frequencies: 0.000000

      290500 -- (-2633.584) [-2621.549] (-2621.954) (-2630.735) * (-2629.787) (-2622.810) [-2625.614] (-2616.151) -- 0:04:48
      291000 -- (-2621.350) (-2634.626) [-2621.391] (-2628.543) * [-2628.391] (-2623.815) (-2621.670) (-2633.367) -- 0:04:47
      291500 -- (-2634.379) (-2626.857) [-2624.168] (-2633.507) * (-2621.671) (-2625.459) [-2622.795] (-2620.902) -- 0:04:46
      292000 -- (-2629.795) [-2623.755] (-2629.465) (-2637.682) * (-2623.123) (-2624.998) (-2628.335) [-2622.540] -- 0:04:46
      292500 -- (-2628.807) [-2626.924] (-2627.905) (-2625.401) * (-2624.745) (-2621.031) (-2622.032) [-2621.012] -- 0:04:45
      293000 -- (-2630.248) [-2623.683] (-2630.014) (-2628.169) * [-2620.581] (-2633.136) (-2624.661) (-2623.422) -- 0:04:47
      293500 -- [-2624.117] (-2618.233) (-2630.317) (-2635.088) * (-2626.820) (-2622.616) (-2626.705) [-2627.251] -- 0:04:46
      294000 -- (-2622.184) [-2624.640] (-2632.269) (-2629.182) * (-2625.997) (-2623.600) [-2626.298] (-2623.962) -- 0:04:45
      294500 -- [-2630.616] (-2624.807) (-2625.794) (-2621.335) * (-2624.447) (-2625.522) (-2622.983) [-2631.524] -- 0:04:45
      295000 -- (-2622.097) (-2621.590) (-2622.931) [-2633.246] * (-2633.609) (-2621.801) [-2622.588] (-2628.147) -- 0:04:44

      Average standard deviation of split frequencies: 0.000000

      295500 -- (-2629.507) [-2622.001] (-2628.982) (-2629.866) * (-2630.046) [-2620.408] (-2622.122) (-2622.636) -- 0:04:46
      296000 -- [-2626.891] (-2631.977) (-2633.653) (-2625.540) * (-2623.368) (-2621.933) [-2626.820] (-2634.979) -- 0:04:45
      296500 -- (-2631.003) [-2623.632] (-2628.347) (-2625.990) * (-2632.716) [-2617.698] (-2627.418) (-2621.928) -- 0:04:44
      297000 -- (-2623.281) [-2626.590] (-2628.358) (-2629.784) * (-2625.996) [-2620.927] (-2632.369) (-2625.635) -- 0:04:44
      297500 -- (-2630.704) (-2627.003) [-2625.958] (-2630.240) * (-2630.452) [-2622.454] (-2629.518) (-2625.857) -- 0:04:43
      298000 -- (-2627.585) (-2621.137) [-2627.127] (-2625.354) * (-2623.533) (-2631.679) (-2624.497) [-2623.305] -- 0:04:45
      298500 -- (-2627.283) (-2621.119) [-2627.494] (-2622.135) * (-2625.596) (-2632.088) (-2631.738) [-2624.221] -- 0:04:44
      299000 -- (-2625.931) [-2626.045] (-2627.015) (-2631.173) * (-2623.090) (-2639.095) [-2633.300] (-2624.377) -- 0:04:43
      299500 -- (-2626.641) (-2621.942) [-2632.303] (-2634.377) * [-2619.734] (-2635.015) (-2625.501) (-2629.590) -- 0:04:43
      300000 -- [-2623.709] (-2626.010) (-2633.622) (-2636.973) * [-2619.249] (-2642.103) (-2629.056) (-2622.006) -- 0:04:42

      Average standard deviation of split frequencies: 0.000000

      300500 -- (-2628.361) [-2629.789] (-2630.282) (-2624.390) * (-2625.245) (-2638.550) (-2624.178) [-2623.437] -- 0:04:43
      301000 -- [-2627.873] (-2629.405) (-2625.407) (-2628.338) * (-2623.234) (-2630.934) (-2628.459) [-2626.005] -- 0:04:43
      301500 -- (-2621.131) (-2632.636) [-2624.420] (-2631.430) * (-2638.533) (-2625.368) (-2624.851) [-2623.812] -- 0:04:42
      302000 -- (-2622.807) [-2625.363] (-2622.685) (-2625.779) * (-2633.264) [-2622.655] (-2628.672) (-2625.994) -- 0:04:41
      302500 -- (-2630.822) [-2628.283] (-2633.894) (-2629.996) * (-2627.589) (-2624.974) [-2628.687] (-2620.751) -- 0:04:41
      303000 -- (-2632.647) (-2621.609) [-2624.613] (-2634.738) * [-2629.364] (-2623.855) (-2629.601) (-2619.963) -- 0:04:42
      303500 -- (-2625.106) [-2629.235] (-2628.955) (-2628.174) * (-2626.626) [-2622.767] (-2627.779) (-2624.456) -- 0:04:42
      304000 -- (-2623.902) [-2627.087] (-2636.080) (-2637.064) * (-2636.434) (-2622.923) [-2620.197] (-2630.556) -- 0:04:41
      304500 -- (-2628.347) (-2624.999) [-2630.321] (-2627.559) * (-2622.443) (-2628.078) (-2624.729) [-2622.130] -- 0:04:40
      305000 -- [-2622.719] (-2622.132) (-2622.204) (-2630.572) * (-2624.684) (-2624.732) (-2627.910) [-2621.695] -- 0:04:40

      Average standard deviation of split frequencies: 0.000000

      305500 -- [-2632.019] (-2630.261) (-2623.595) (-2619.267) * (-2622.255) (-2622.910) [-2620.775] (-2629.354) -- 0:04:41
      306000 -- (-2636.483) [-2624.929] (-2624.776) (-2625.623) * (-2622.849) (-2630.148) (-2631.558) [-2623.423] -- 0:04:41
      306500 -- (-2622.342) (-2626.723) (-2626.469) [-2626.740] * (-2621.521) [-2627.742] (-2625.330) (-2628.124) -- 0:04:40
      307000 -- (-2624.221) (-2630.825) [-2621.545] (-2618.979) * (-2634.564) (-2624.114) (-2632.203) [-2621.836] -- 0:04:39
      307500 -- [-2620.817] (-2629.266) (-2624.997) (-2627.171) * (-2631.856) (-2624.060) [-2630.893] (-2630.479) -- 0:04:39
      308000 -- [-2621.583] (-2624.467) (-2624.599) (-2631.049) * (-2630.964) [-2624.782] (-2624.296) (-2626.997) -- 0:04:40
      308500 -- (-2620.164) [-2629.866] (-2635.185) (-2629.802) * (-2625.310) (-2632.081) [-2622.916] (-2630.595) -- 0:04:40
      309000 -- (-2625.411) (-2628.036) (-2631.622) [-2622.293] * (-2624.789) (-2626.343) (-2626.659) [-2624.067] -- 0:04:39
      309500 -- (-2624.190) (-2629.609) (-2625.403) [-2618.904] * [-2628.381] (-2622.362) (-2624.198) (-2623.022) -- 0:04:38
      310000 -- (-2623.877) (-2637.345) [-2629.254] (-2620.878) * (-2626.280) (-2626.146) (-2620.461) [-2624.730] -- 0:04:38

      Average standard deviation of split frequencies: 0.000000

      310500 -- (-2625.330) (-2632.852) [-2631.107] (-2628.151) * [-2623.296] (-2628.264) (-2629.795) (-2624.203) -- 0:04:39
      311000 -- (-2625.618) (-2633.961) (-2626.024) [-2621.503] * (-2627.166) (-2628.914) [-2628.496] (-2626.113) -- 0:04:39
      311500 -- (-2634.080) [-2627.329] (-2632.954) (-2629.137) * (-2623.869) (-2624.390) [-2633.509] (-2631.201) -- 0:04:38
      312000 -- (-2630.880) (-2624.846) (-2626.389) [-2620.010] * (-2630.655) (-2627.738) (-2623.466) [-2625.585] -- 0:04:37
      312500 -- (-2630.860) (-2629.903) [-2626.402] (-2625.257) * (-2629.126) (-2625.793) (-2629.102) [-2622.478] -- 0:04:37
      313000 -- (-2630.441) [-2627.428] (-2625.826) (-2630.498) * (-2621.902) (-2624.753) (-2620.299) [-2629.992] -- 0:04:38
      313500 -- (-2625.156) [-2623.571] (-2623.111) (-2623.440) * (-2627.465) (-2627.342) [-2622.837] (-2626.029) -- 0:04:38
      314000 -- [-2623.685] (-2624.910) (-2635.792) (-2623.769) * (-2624.161) [-2630.361] (-2624.214) (-2626.269) -- 0:04:37
      314500 -- (-2629.404) (-2629.242) (-2633.935) [-2622.558] * (-2626.804) [-2624.581] (-2634.524) (-2630.060) -- 0:04:38
      315000 -- (-2630.017) [-2621.617] (-2630.640) (-2626.667) * [-2621.807] (-2624.710) (-2627.281) (-2622.613) -- 0:04:38

      Average standard deviation of split frequencies: 0.000000

      315500 -- [-2623.234] (-2631.837) (-2627.397) (-2637.396) * [-2628.524] (-2623.290) (-2634.968) (-2625.472) -- 0:04:37
      316000 -- [-2617.335] (-2628.491) (-2629.846) (-2630.225) * (-2626.127) (-2621.860) [-2623.866] (-2626.767) -- 0:04:37
      316500 -- [-2625.001] (-2632.040) (-2624.308) (-2626.692) * (-2628.076) (-2633.152) (-2623.890) [-2630.969] -- 0:04:36
      317000 -- (-2626.484) (-2627.716) (-2625.258) [-2622.639] * [-2626.944] (-2635.560) (-2633.838) (-2625.992) -- 0:04:37
      317500 -- (-2630.786) (-2624.668) [-2626.531] (-2625.334) * [-2629.106] (-2635.837) (-2628.952) (-2623.302) -- 0:04:37
      318000 -- (-2626.774) (-2622.699) [-2630.546] (-2629.770) * [-2626.079] (-2625.310) (-2630.932) (-2627.709) -- 0:04:36
      318500 -- [-2629.879] (-2630.525) (-2624.501) (-2627.653) * [-2626.349] (-2628.086) (-2628.758) (-2623.932) -- 0:04:36
      319000 -- (-2629.961) (-2628.142) (-2622.289) [-2627.393] * [-2631.157] (-2634.067) (-2626.816) (-2626.280) -- 0:04:35
      319500 -- (-2621.952) (-2625.406) (-2622.220) [-2630.640] * (-2626.821) (-2625.274) (-2631.646) [-2624.706] -- 0:04:36
      320000 -- (-2623.098) (-2626.438) [-2622.005] (-2627.669) * [-2627.626] (-2620.875) (-2631.826) (-2626.443) -- 0:04:36

      Average standard deviation of split frequencies: 0.000000

      320500 -- [-2619.002] (-2618.952) (-2629.294) (-2623.036) * (-2622.709) [-2627.189] (-2623.670) (-2620.685) -- 0:04:35
      321000 -- (-2633.615) (-2625.680) (-2621.986) [-2626.142] * (-2625.853) (-2629.600) (-2625.614) [-2628.496] -- 0:04:34
      321500 -- (-2621.651) (-2629.083) [-2629.364] (-2626.097) * (-2631.050) (-2625.141) (-2627.568) [-2624.318] -- 0:04:34
      322000 -- (-2623.685) [-2636.271] (-2632.749) (-2629.737) * (-2626.419) [-2623.773] (-2631.681) (-2618.774) -- 0:04:35
      322500 -- [-2621.158] (-2630.061) (-2633.069) (-2621.938) * (-2629.426) (-2639.856) (-2626.401) [-2623.101] -- 0:04:35
      323000 -- (-2630.301) (-2628.728) [-2621.335] (-2624.524) * (-2621.912) (-2627.396) (-2626.068) [-2622.827] -- 0:04:34
      323500 -- (-2630.415) [-2623.415] (-2623.777) (-2626.431) * (-2627.153) (-2622.354) [-2623.147] (-2629.325) -- 0:04:33
      324000 -- (-2630.938) (-2627.589) (-2627.351) [-2624.112] * [-2627.527] (-2628.171) (-2619.882) (-2627.784) -- 0:04:33
      324500 -- [-2617.863] (-2626.042) (-2627.404) (-2626.560) * (-2622.604) (-2630.016) [-2622.197] (-2627.105) -- 0:04:34
      325000 -- [-2628.103] (-2626.773) (-2636.567) (-2627.828) * (-2623.922) [-2624.029] (-2631.933) (-2627.901) -- 0:04:34

      Average standard deviation of split frequencies: 0.000289

      325500 -- (-2622.004) (-2623.186) [-2627.580] (-2627.542) * [-2629.121] (-2624.908) (-2624.654) (-2621.317) -- 0:04:33
      326000 -- (-2628.801) (-2628.349) (-2627.254) [-2624.647] * [-2624.187] (-2625.055) (-2632.723) (-2624.083) -- 0:04:32
      326500 -- (-2630.764) (-2621.468) [-2630.018] (-2633.089) * [-2622.621] (-2631.574) (-2627.799) (-2624.852) -- 0:04:32
      327000 -- (-2633.307) (-2627.367) [-2630.779] (-2627.150) * (-2626.300) (-2626.916) [-2626.740] (-2624.471) -- 0:04:33
      327500 -- [-2627.447] (-2625.119) (-2630.523) (-2623.195) * (-2624.220) (-2621.775) [-2632.038] (-2626.380) -- 0:04:33
      328000 -- (-2630.185) (-2631.848) (-2633.448) [-2623.162] * (-2620.819) (-2637.483) (-2629.180) [-2623.353] -- 0:04:32
      328500 -- (-2626.478) (-2623.455) (-2625.337) [-2626.689] * (-2624.584) [-2629.520] (-2624.807) (-2625.696) -- 0:04:31
      329000 -- (-2624.337) (-2620.931) [-2626.580] (-2627.272) * [-2625.037] (-2628.806) (-2622.558) (-2632.698) -- 0:04:33
      329500 -- (-2633.684) (-2625.242) [-2631.676] (-2625.254) * [-2622.909] (-2629.917) (-2627.121) (-2631.370) -- 0:04:32
      330000 -- (-2625.891) [-2628.357] (-2624.838) (-2628.117) * (-2632.538) [-2628.974] (-2623.379) (-2632.725) -- 0:04:32

      Average standard deviation of split frequencies: 0.000285

      330500 -- (-2626.233) [-2626.495] (-2626.677) (-2623.444) * [-2624.186] (-2625.860) (-2626.549) (-2624.762) -- 0:04:31
      331000 -- (-2628.129) (-2633.190) [-2624.937] (-2625.934) * (-2635.533) (-2628.451) [-2621.683] (-2621.067) -- 0:04:30
      331500 -- (-2627.137) (-2621.756) (-2622.930) [-2626.416] * [-2621.231] (-2624.201) (-2626.558) (-2621.180) -- 0:04:32
      332000 -- (-2630.247) [-2626.130] (-2628.983) (-2626.737) * (-2631.226) (-2626.461) (-2624.065) [-2623.259] -- 0:04:31
      332500 -- [-2629.056] (-2620.516) (-2624.477) (-2627.404) * (-2623.889) [-2631.326] (-2624.775) (-2634.149) -- 0:04:31
      333000 -- (-2626.448) (-2625.800) (-2626.437) [-2624.219] * (-2632.247) [-2626.030] (-2627.388) (-2626.672) -- 0:04:30
      333500 -- [-2625.200] (-2623.908) (-2625.022) (-2631.048) * (-2625.889) (-2622.575) (-2628.924) [-2625.843] -- 0:04:29
      334000 -- (-2629.773) (-2627.408) (-2627.174) [-2619.746] * (-2629.499) [-2622.710] (-2623.196) (-2630.358) -- 0:04:31
      334500 -- [-2630.295] (-2629.066) (-2623.551) (-2622.185) * (-2625.974) [-2622.329] (-2621.290) (-2638.391) -- 0:04:30
      335000 -- (-2633.150) (-2626.662) (-2625.686) [-2622.392] * (-2623.763) (-2624.978) (-2627.869) [-2626.194] -- 0:04:29

      Average standard deviation of split frequencies: 0.000281

      335500 -- (-2628.478) (-2630.096) (-2625.802) [-2622.862] * [-2628.913] (-2624.555) (-2633.307) (-2629.716) -- 0:04:29
      336000 -- (-2625.013) [-2629.551] (-2623.955) (-2627.362) * (-2626.814) (-2624.254) [-2623.880] (-2619.990) -- 0:04:28
      336500 -- [-2619.615] (-2621.500) (-2626.722) (-2622.966) * (-2627.766) (-2633.296) [-2623.058] (-2627.635) -- 0:04:30
      337000 -- (-2621.324) (-2626.179) (-2626.464) [-2626.730] * (-2625.833) [-2627.605] (-2628.875) (-2627.207) -- 0:04:29
      337500 -- [-2624.138] (-2634.295) (-2627.238) (-2626.089) * [-2622.182] (-2622.018) (-2622.197) (-2625.030) -- 0:04:28
      338000 -- [-2621.986] (-2627.867) (-2628.963) (-2627.277) * (-2624.936) [-2622.298] (-2626.376) (-2626.027) -- 0:04:28
      338500 -- (-2621.940) (-2632.689) (-2622.678) [-2623.792] * [-2620.893] (-2628.092) (-2624.266) (-2631.105) -- 0:04:27
      339000 -- (-2628.837) (-2624.567) (-2623.685) [-2622.023] * (-2626.308) [-2623.719] (-2624.841) (-2625.458) -- 0:04:29
      339500 -- (-2632.715) (-2632.749) (-2621.421) [-2623.380] * (-2630.279) (-2623.832) [-2627.765] (-2622.908) -- 0:04:28
      340000 -- (-2621.168) (-2636.553) [-2624.889] (-2625.528) * (-2628.209) (-2624.884) (-2626.972) [-2629.786] -- 0:04:27

      Average standard deviation of split frequencies: 0.000277

      340500 -- (-2624.825) [-2622.619] (-2630.784) (-2638.251) * (-2626.085) [-2625.985] (-2636.868) (-2622.879) -- 0:04:27
      341000 -- (-2631.961) (-2625.043) [-2624.560] (-2628.784) * (-2625.227) (-2633.925) (-2628.566) [-2627.286] -- 0:04:26
      341500 -- (-2624.445) (-2623.605) [-2624.935] (-2624.832) * [-2623.054] (-2636.951) (-2633.229) (-2624.151) -- 0:04:28
      342000 -- (-2624.174) [-2628.364] (-2626.030) (-2627.045) * [-2622.818] (-2625.854) (-2636.379) (-2628.396) -- 0:04:27
      342500 -- (-2622.952) (-2625.422) (-2622.984) [-2623.666] * (-2621.648) (-2621.955) (-2624.283) [-2626.276] -- 0:04:26
      343000 -- (-2629.834) [-2619.015] (-2620.180) (-2629.394) * (-2621.209) [-2625.985] (-2626.168) (-2631.124) -- 0:04:26
      343500 -- (-2624.095) (-2628.940) [-2625.380] (-2628.044) * (-2629.679) (-2631.389) [-2625.505] (-2626.860) -- 0:04:25
      344000 -- (-2624.031) (-2623.646) [-2619.411] (-2624.832) * (-2632.372) (-2630.229) (-2626.147) [-2623.642] -- 0:04:26
      344500 -- (-2624.215) (-2624.069) (-2626.702) [-2626.277] * (-2624.644) (-2633.507) (-2624.480) [-2624.043] -- 0:04:26
      345000 -- (-2626.464) (-2632.394) [-2624.135] (-2624.909) * [-2626.155] (-2623.448) (-2622.225) (-2627.702) -- 0:04:25

      Average standard deviation of split frequencies: 0.000272

      345500 -- (-2628.600) (-2626.925) [-2629.803] (-2634.091) * (-2631.421) (-2632.810) [-2625.056] (-2624.894) -- 0:04:25
      346000 -- (-2635.348) [-2619.671] (-2627.388) (-2627.642) * (-2624.418) (-2629.401) [-2629.084] (-2634.933) -- 0:04:24
      346500 -- [-2628.478] (-2620.610) (-2623.063) (-2628.298) * [-2627.594] (-2629.938) (-2621.288) (-2640.965) -- 0:04:25
      347000 -- (-2621.460) [-2623.372] (-2623.489) (-2628.803) * [-2626.985] (-2632.094) (-2626.337) (-2626.034) -- 0:04:25
      347500 -- (-2642.387) (-2629.786) (-2633.218) [-2624.795] * (-2626.571) [-2623.950] (-2622.412) (-2636.789) -- 0:04:24
      348000 -- (-2637.057) (-2620.946) [-2621.189] (-2621.526) * [-2624.707] (-2623.898) (-2626.765) (-2627.875) -- 0:04:24
      348500 -- (-2633.107) (-2626.639) (-2628.296) [-2627.291] * [-2622.248] (-2627.228) (-2621.143) (-2625.885) -- 0:04:23
      349000 -- (-2639.160) [-2620.776] (-2629.255) (-2621.502) * (-2621.649) (-2630.466) (-2631.921) [-2623.965] -- 0:04:24
      349500 -- [-2625.617] (-2625.131) (-2621.896) (-2623.715) * (-2624.544) (-2636.178) (-2627.688) [-2627.160] -- 0:04:24
      350000 -- (-2627.707) [-2621.134] (-2626.025) (-2624.882) * (-2634.436) (-2627.267) (-2623.068) [-2624.123] -- 0:04:23

      Average standard deviation of split frequencies: 0.000269

      350500 -- (-2628.611) [-2622.373] (-2630.202) (-2617.958) * [-2624.645] (-2629.831) (-2626.666) (-2623.540) -- 0:04:23
      351000 -- (-2625.094) (-2633.791) (-2629.718) [-2622.390] * (-2626.962) (-2630.158) [-2627.833] (-2625.429) -- 0:04:22
      351500 -- [-2632.941] (-2623.215) (-2625.006) (-2627.089) * (-2631.151) (-2625.389) [-2625.626] (-2628.374) -- 0:04:23
      352000 -- [-2620.143] (-2619.448) (-2626.537) (-2628.491) * (-2633.682) (-2635.870) (-2624.691) [-2625.101] -- 0:04:23
      352500 -- (-2628.949) (-2634.195) (-2628.786) [-2625.275] * [-2618.906] (-2623.499) (-2634.289) (-2624.606) -- 0:04:22
      353000 -- (-2624.048) [-2622.065] (-2625.392) (-2631.589) * (-2626.086) [-2627.175] (-2635.027) (-2628.489) -- 0:04:22
      353500 -- (-2628.884) (-2627.083) (-2627.678) [-2628.043] * [-2625.771] (-2625.982) (-2627.132) (-2633.100) -- 0:04:21
      354000 -- (-2621.943) [-2623.492] (-2622.163) (-2638.014) * (-2626.656) (-2625.717) (-2625.906) [-2627.552] -- 0:04:22
      354500 -- (-2631.971) [-2620.015] (-2627.780) (-2626.993) * (-2621.102) [-2625.476] (-2623.578) (-2623.284) -- 0:04:22
      355000 -- (-2630.284) (-2621.441) (-2622.696) [-2626.737] * (-2625.591) (-2626.785) (-2619.656) [-2629.620] -- 0:04:21

      Average standard deviation of split frequencies: 0.000265

      355500 -- [-2629.012] (-2622.294) (-2620.904) (-2623.356) * (-2637.764) (-2621.184) [-2627.188] (-2632.354) -- 0:04:21
      356000 -- (-2624.474) (-2625.270) [-2625.478] (-2621.593) * (-2634.066) (-2624.573) [-2620.680] (-2629.505) -- 0:04:20
      356500 -- (-2620.907) (-2627.568) (-2634.414) [-2630.055] * (-2631.362) (-2626.760) (-2624.941) [-2621.733] -- 0:04:21
      357000 -- [-2631.123] (-2637.088) (-2625.996) (-2638.507) * (-2641.235) (-2627.674) [-2621.866] (-2624.128) -- 0:04:21
      357500 -- (-2622.740) (-2624.109) [-2627.207] (-2631.334) * (-2632.600) (-2627.702) (-2626.714) [-2624.119] -- 0:04:20
      358000 -- (-2627.369) (-2626.260) (-2628.938) [-2631.809] * (-2634.194) (-2626.463) (-2629.094) [-2615.934] -- 0:04:20
      358500 -- (-2643.111) [-2619.810] (-2624.401) (-2625.997) * (-2633.310) (-2628.160) (-2625.710) [-2619.217] -- 0:04:21
      359000 -- (-2627.540) [-2622.470] (-2629.129) (-2625.474) * (-2623.071) (-2629.699) [-2627.991] (-2627.120) -- 0:04:20
      359500 -- (-2619.510) (-2627.057) [-2623.327] (-2627.837) * (-2627.763) (-2652.464) (-2627.861) [-2626.796] -- 0:04:20
      360000 -- (-2627.369) (-2632.183) (-2631.305) [-2624.669] * (-2631.864) [-2622.261] (-2626.156) (-2631.535) -- 0:04:19

      Average standard deviation of split frequencies: 0.000523

      360500 -- (-2624.105) (-2634.342) (-2629.223) [-2625.117] * [-2634.593] (-2623.039) (-2628.158) (-2623.922) -- 0:04:18
      361000 -- [-2620.960] (-2631.164) (-2627.710) (-2626.968) * (-2632.689) (-2630.301) (-2626.212) [-2629.682] -- 0:04:20
      361500 -- (-2623.901) (-2625.867) [-2626.280] (-2634.558) * (-2623.647) (-2627.560) [-2628.599] (-2626.895) -- 0:04:19
      362000 -- (-2630.541) [-2621.985] (-2629.992) (-2629.876) * (-2627.389) (-2636.911) [-2629.038] (-2629.459) -- 0:04:19
      362500 -- (-2637.146) [-2623.354] (-2631.007) (-2625.630) * [-2627.697] (-2625.186) (-2637.683) (-2628.367) -- 0:04:18
      363000 -- (-2636.833) (-2628.857) [-2627.088] (-2631.703) * [-2619.362] (-2629.256) (-2623.760) (-2631.481) -- 0:04:17
      363500 -- [-2629.473] (-2626.293) (-2629.056) (-2622.929) * [-2623.058] (-2622.088) (-2624.954) (-2626.179) -- 0:04:19
      364000 -- (-2628.335) (-2627.351) [-2624.473] (-2622.752) * (-2632.402) [-2621.636] (-2630.542) (-2624.733) -- 0:04:18
      364500 -- [-2631.061] (-2627.581) (-2627.364) (-2618.063) * (-2630.140) [-2628.951] (-2626.105) (-2624.831) -- 0:04:18
      365000 -- (-2630.143) (-2628.218) [-2628.768] (-2639.819) * (-2627.579) [-2624.960] (-2625.944) (-2629.159) -- 0:04:17

      Average standard deviation of split frequencies: 0.000515

      365500 -- [-2626.667] (-2629.520) (-2628.996) (-2622.339) * (-2620.840) (-2630.446) (-2626.547) [-2624.651] -- 0:04:16
      366000 -- (-2624.594) (-2630.508) [-2628.396] (-2642.228) * [-2620.308] (-2625.892) (-2625.972) (-2635.776) -- 0:04:18
      366500 -- (-2628.208) (-2627.605) [-2624.877] (-2631.816) * [-2631.350] (-2623.139) (-2628.599) (-2628.386) -- 0:04:17
      367000 -- (-2627.172) (-2627.310) (-2626.731) [-2627.338] * [-2622.206] (-2628.292) (-2627.679) (-2631.178) -- 0:04:16
      367500 -- (-2632.819) (-2627.145) (-2627.574) [-2627.525] * (-2625.336) (-2626.908) (-2626.822) [-2626.233] -- 0:04:16
      368000 -- (-2620.527) (-2638.103) [-2624.902] (-2632.683) * (-2624.444) [-2620.675] (-2627.867) (-2626.233) -- 0:04:15
      368500 -- (-2623.080) (-2627.272) [-2623.856] (-2623.896) * (-2625.526) (-2636.704) [-2627.888] (-2630.997) -- 0:04:17
      369000 -- (-2633.024) (-2626.351) [-2630.445] (-2620.949) * (-2620.783) (-2629.310) [-2626.681] (-2627.357) -- 0:04:16
      369500 -- (-2621.128) (-2631.344) (-2625.652) [-2625.071] * (-2625.251) (-2621.749) (-2627.577) [-2625.064] -- 0:04:15
      370000 -- (-2628.898) [-2627.664] (-2622.140) (-2631.830) * (-2635.899) (-2623.568) (-2628.162) [-2632.798] -- 0:04:15

      Average standard deviation of split frequencies: 0.000509

      370500 -- [-2627.298] (-2630.266) (-2632.526) (-2621.184) * (-2634.521) [-2624.700] (-2635.515) (-2637.266) -- 0:04:14
      371000 -- (-2628.092) (-2631.789) (-2633.837) [-2622.501] * (-2639.016) [-2629.433] (-2628.244) (-2623.449) -- 0:04:16
      371500 -- (-2630.087) (-2632.771) (-2642.221) [-2622.682] * (-2630.250) (-2626.741) [-2630.843] (-2629.501) -- 0:04:15
      372000 -- [-2629.879] (-2630.205) (-2633.030) (-2619.376) * (-2624.466) (-2628.482) (-2631.346) [-2629.935] -- 0:04:14
      372500 -- (-2627.348) (-2622.069) [-2625.158] (-2626.551) * (-2636.802) [-2621.921] (-2631.689) (-2624.037) -- 0:04:14
      373000 -- [-2625.632] (-2621.373) (-2622.791) (-2624.865) * (-2628.101) [-2621.806] (-2629.749) (-2624.710) -- 0:04:13
      373500 -- (-2622.293) [-2629.717] (-2626.114) (-2622.861) * [-2630.183] (-2624.401) (-2624.561) (-2630.410) -- 0:04:14
      374000 -- [-2624.841] (-2619.099) (-2627.168) (-2629.951) * (-2628.747) [-2626.989] (-2623.659) (-2641.363) -- 0:04:14
      374500 -- (-2620.546) [-2626.728] (-2629.526) (-2626.837) * (-2635.958) (-2637.035) [-2620.604] (-2630.930) -- 0:04:13
      375000 -- (-2640.514) (-2627.556) [-2624.808] (-2624.626) * [-2623.967] (-2627.112) (-2637.113) (-2625.210) -- 0:04:13

      Average standard deviation of split frequencies: 0.000501

      375500 -- (-2633.183) (-2625.441) (-2624.126) [-2622.864] * (-2639.775) [-2628.109] (-2627.965) (-2627.070) -- 0:04:12
      376000 -- (-2634.746) (-2624.139) [-2628.790] (-2629.003) * (-2630.178) [-2627.641] (-2624.290) (-2625.472) -- 0:04:13
      376500 -- (-2624.071) (-2630.132) [-2620.453] (-2625.623) * (-2624.273) [-2624.098] (-2624.169) (-2627.318) -- 0:04:13
      377000 -- (-2631.800) (-2628.253) (-2623.900) [-2626.368] * [-2630.962] (-2626.451) (-2625.936) (-2623.838) -- 0:04:12
      377500 -- (-2631.243) (-2620.449) (-2631.580) [-2621.322] * (-2626.659) (-2627.843) [-2626.038] (-2629.949) -- 0:04:12
      378000 -- (-2628.681) [-2626.952] (-2624.314) (-2628.097) * [-2625.153] (-2626.195) (-2627.694) (-2622.453) -- 0:04:13
      378500 -- (-2629.790) [-2626.485] (-2622.388) (-2626.647) * [-2625.062] (-2622.450) (-2627.310) (-2622.734) -- 0:04:12
      379000 -- (-2626.144) (-2631.772) (-2630.210) [-2622.271] * (-2620.460) [-2624.266] (-2626.950) (-2627.723) -- 0:04:12
      379500 -- (-2626.887) [-2629.377] (-2620.471) (-2626.641) * [-2625.637] (-2625.664) (-2639.951) (-2627.443) -- 0:04:11
      380000 -- (-2623.958) (-2621.750) (-2620.882) [-2626.190] * (-2627.159) (-2628.949) (-2629.424) [-2625.511] -- 0:04:11

      Average standard deviation of split frequencies: 0.000495

      380500 -- (-2620.634) (-2626.442) [-2624.505] (-2628.844) * [-2633.780] (-2633.406) (-2625.257) (-2633.088) -- 0:04:12
      381000 -- (-2623.698) (-2631.244) [-2622.937] (-2629.191) * (-2635.356) (-2633.514) (-2624.354) [-2633.147] -- 0:04:11
      381500 -- (-2624.480) (-2628.625) [-2620.959] (-2633.335) * (-2623.853) [-2623.636] (-2626.462) (-2626.424) -- 0:04:11
      382000 -- [-2628.223] (-2627.504) (-2622.900) (-2625.315) * [-2630.810] (-2626.984) (-2626.835) (-2623.256) -- 0:04:10
      382500 -- (-2622.890) (-2621.125) (-2623.426) [-2624.662] * [-2626.638] (-2626.800) (-2632.073) (-2627.709) -- 0:04:10
      383000 -- (-2631.592) (-2635.529) (-2630.321) [-2627.112] * [-2627.156] (-2625.196) (-2624.713) (-2627.951) -- 0:04:11
      383500 -- (-2631.553) (-2623.014) (-2638.236) [-2626.701] * (-2625.630) (-2624.155) [-2625.113] (-2624.647) -- 0:04:10
      384000 -- (-2627.943) (-2628.326) (-2631.059) [-2621.036] * (-2630.399) (-2627.341) [-2627.126] (-2621.648) -- 0:04:10
      384500 -- (-2636.231) (-2628.599) [-2627.869] (-2623.614) * (-2628.553) (-2629.814) [-2620.303] (-2623.675) -- 0:04:09
      385000 -- (-2645.477) (-2622.828) [-2623.536] (-2620.515) * (-2627.690) (-2634.760) (-2623.887) [-2629.452] -- 0:04:09

      Average standard deviation of split frequencies: 0.000489

      385500 -- (-2630.448) (-2625.788) [-2622.606] (-2628.591) * (-2631.237) (-2631.624) (-2624.387) [-2624.486] -- 0:04:10
      386000 -- [-2623.561] (-2624.603) (-2626.944) (-2625.334) * (-2623.005) [-2621.290] (-2625.038) (-2624.645) -- 0:04:09
      386500 -- (-2624.152) (-2630.511) [-2636.787] (-2624.192) * (-2624.918) (-2624.391) [-2633.477] (-2628.078) -- 0:04:09
      387000 -- (-2624.113) (-2624.819) (-2631.653) [-2624.492] * (-2633.036) [-2621.959] (-2623.314) (-2635.043) -- 0:04:08
      387500 -- [-2627.213] (-2624.787) (-2621.286) (-2624.666) * (-2624.680) (-2628.444) [-2623.501] (-2626.417) -- 0:04:08
      388000 -- (-2629.101) [-2621.899] (-2634.384) (-2627.875) * (-2626.674) (-2630.133) [-2625.169] (-2621.928) -- 0:04:09
      388500 -- (-2622.609) (-2625.708) [-2628.377] (-2628.127) * (-2634.240) [-2628.693] (-2635.126) (-2628.527) -- 0:04:08
      389000 -- (-2629.835) (-2629.856) [-2626.271] (-2629.069) * (-2627.666) (-2626.608) (-2628.961) [-2631.479] -- 0:04:08
      389500 -- (-2632.947) (-2627.299) (-2634.370) [-2631.804] * [-2623.670] (-2622.979) (-2625.442) (-2625.453) -- 0:04:07
      390000 -- (-2630.392) (-2637.906) (-2634.456) [-2624.852] * (-2626.991) (-2628.943) (-2632.735) [-2623.762] -- 0:04:07

      Average standard deviation of split frequencies: 0.000483

      390500 -- (-2625.364) [-2622.465] (-2627.539) (-2623.580) * (-2630.966) [-2622.919] (-2634.052) (-2625.351) -- 0:04:08
      391000 -- (-2624.858) (-2620.742) [-2625.782] (-2630.686) * (-2622.277) (-2621.769) (-2632.282) [-2626.048] -- 0:04:07
      391500 -- (-2627.422) [-2621.118] (-2632.461) (-2625.255) * (-2623.950) [-2625.099] (-2626.056) (-2626.208) -- 0:04:07
      392000 -- (-2633.883) (-2626.353) (-2628.505) [-2633.363] * (-2623.985) [-2619.699] (-2624.965) (-2630.477) -- 0:04:06
      392500 -- [-2621.550] (-2629.759) (-2629.072) (-2625.417) * (-2622.527) (-2628.853) [-2623.428] (-2632.278) -- 0:04:06
      393000 -- (-2631.438) (-2627.808) (-2625.647) [-2620.455] * [-2626.961] (-2628.636) (-2630.544) (-2623.440) -- 0:04:07
      393500 -- (-2632.128) [-2621.597] (-2628.330) (-2624.955) * (-2636.442) [-2619.823] (-2624.171) (-2627.369) -- 0:04:06
      394000 -- (-2625.425) [-2623.763] (-2631.283) (-2628.727) * (-2626.610) (-2636.445) (-2625.460) [-2628.519] -- 0:04:06
      394500 -- (-2631.788) (-2624.071) [-2623.980] (-2628.581) * (-2620.687) (-2639.814) (-2627.163) [-2631.646] -- 0:04:05
      395000 -- (-2625.808) (-2626.143) [-2625.991] (-2624.858) * (-2624.594) (-2626.787) [-2623.581] (-2622.347) -- 0:04:05

      Average standard deviation of split frequencies: 0.000476

      395500 -- (-2627.521) (-2623.955) (-2631.292) [-2627.628] * (-2622.646) (-2631.205) [-2630.700] (-2621.806) -- 0:04:06
      396000 -- (-2626.991) (-2625.083) [-2623.034] (-2620.578) * (-2629.642) [-2631.102] (-2627.498) (-2621.166) -- 0:04:05
      396500 -- (-2632.198) [-2625.040] (-2628.026) (-2628.630) * (-2623.154) (-2624.378) (-2631.616) [-2630.780] -- 0:04:05
      397000 -- (-2622.873) (-2625.954) (-2627.593) [-2628.093] * [-2632.954] (-2624.632) (-2624.638) (-2630.236) -- 0:04:04
      397500 -- (-2628.060) [-2624.462] (-2643.012) (-2634.513) * (-2629.701) (-2630.906) [-2623.997] (-2625.262) -- 0:04:04
      398000 -- [-2624.129] (-2623.368) (-2626.383) (-2625.330) * (-2621.252) (-2626.128) [-2622.201] (-2619.703) -- 0:04:05
      398500 -- (-2627.662) [-2625.507] (-2633.019) (-2628.244) * [-2626.080] (-2623.562) (-2632.835) (-2631.462) -- 0:04:04
      399000 -- (-2633.332) [-2623.641] (-2623.209) (-2633.411) * (-2625.834) [-2622.625] (-2630.615) (-2629.362) -- 0:04:04
      399500 -- (-2631.065) [-2623.248] (-2622.539) (-2623.760) * (-2630.477) (-2622.400) (-2629.309) [-2627.034] -- 0:04:03
      400000 -- (-2620.856) (-2627.810) [-2632.642] (-2623.674) * (-2622.510) (-2626.638) (-2625.070) [-2622.121] -- 0:04:03

      Average standard deviation of split frequencies: 0.000471

      400500 -- [-2620.968] (-2627.675) (-2623.729) (-2634.261) * (-2644.394) [-2624.418] (-2622.803) (-2619.291) -- 0:04:03
      401000 -- (-2625.231) (-2625.663) [-2625.946] (-2625.030) * (-2627.781) (-2624.895) (-2624.041) [-2626.688] -- 0:04:03
      401500 -- (-2630.314) [-2631.121] (-2625.211) (-2624.246) * (-2625.504) (-2628.324) (-2630.589) [-2628.907] -- 0:04:02
      402000 -- (-2629.617) (-2635.842) [-2629.315] (-2621.751) * (-2637.795) [-2623.345] (-2623.486) (-2627.590) -- 0:04:02
      402500 -- [-2628.748] (-2628.362) (-2627.917) (-2623.111) * (-2627.836) [-2617.470] (-2624.270) (-2630.969) -- 0:04:01
      403000 -- [-2626.628] (-2639.057) (-2630.166) (-2621.844) * (-2623.569) (-2623.941) [-2621.444] (-2634.125) -- 0:04:02
      403500 -- (-2626.404) (-2630.448) (-2628.110) [-2624.607] * [-2625.125] (-2631.882) (-2628.289) (-2628.120) -- 0:04:02
      404000 -- [-2623.003] (-2623.236) (-2624.344) (-2623.037) * (-2623.176) (-2628.246) (-2624.960) [-2625.814] -- 0:04:01
      404500 -- [-2627.928] (-2630.930) (-2623.800) (-2630.134) * (-2627.373) (-2623.341) (-2627.221) [-2621.947] -- 0:04:01
      405000 -- [-2627.161] (-2628.542) (-2626.903) (-2619.116) * (-2636.378) (-2629.202) [-2624.655] (-2630.023) -- 0:04:00

      Average standard deviation of split frequencies: 0.000464

      405500 -- (-2634.443) (-2626.814) [-2633.916] (-2625.571) * (-2627.462) [-2623.670] (-2629.176) (-2625.148) -- 0:04:01
      406000 -- (-2624.465) (-2633.208) [-2618.394] (-2625.936) * (-2630.767) (-2621.727) [-2624.349] (-2620.220) -- 0:04:01
      406500 -- (-2625.157) [-2620.538] (-2626.534) (-2635.361) * (-2632.656) (-2618.775) [-2627.094] (-2626.959) -- 0:04:00
      407000 -- (-2629.322) (-2627.320) (-2621.417) [-2626.506] * (-2629.781) (-2626.111) (-2628.894) [-2630.776] -- 0:04:00
      407500 -- [-2616.261] (-2623.858) (-2625.211) (-2625.844) * (-2626.582) (-2627.843) [-2625.808] (-2629.633) -- 0:03:59
      408000 -- (-2625.738) (-2623.902) [-2629.658] (-2621.755) * (-2622.164) [-2637.884] (-2626.680) (-2637.340) -- 0:04:00
      408500 -- (-2619.384) [-2622.117] (-2637.293) (-2627.079) * (-2627.247) [-2622.351] (-2634.998) (-2627.418) -- 0:04:00
      409000 -- (-2629.346) (-2637.050) (-2627.482) [-2623.931] * (-2622.619) (-2625.482) [-2621.671] (-2622.559) -- 0:03:59
      409500 -- (-2628.176) (-2627.519) (-2628.397) [-2626.522] * [-2621.183] (-2630.792) (-2623.273) (-2633.164) -- 0:03:59
      410000 -- [-2626.880] (-2631.485) (-2632.339) (-2628.878) * (-2629.226) [-2628.381] (-2629.982) (-2626.989) -- 0:03:58

      Average standard deviation of split frequencies: 0.000459

      410500 -- (-2633.882) (-2631.715) (-2627.004) [-2626.213] * [-2621.898] (-2629.523) (-2619.726) (-2634.790) -- 0:03:59
      411000 -- (-2627.605) (-2635.055) (-2625.961) [-2626.967] * (-2626.127) (-2624.150) [-2621.532] (-2623.661) -- 0:03:59
      411500 -- [-2633.635] (-2640.793) (-2625.380) (-2622.407) * (-2619.244) (-2624.662) (-2628.919) [-2632.084] -- 0:03:58
      412000 -- (-2626.920) (-2627.613) (-2623.409) [-2628.547] * (-2627.196) (-2626.423) (-2625.406) [-2626.145] -- 0:03:58
      412500 -- (-2627.799) [-2625.084] (-2627.096) (-2634.939) * (-2641.165) (-2633.553) (-2628.435) [-2626.470] -- 0:03:59
      413000 -- (-2624.127) (-2625.528) [-2624.826] (-2630.497) * (-2630.928) [-2624.539] (-2636.502) (-2622.423) -- 0:03:58
      413500 -- (-2627.007) [-2628.382] (-2632.791) (-2633.222) * (-2628.740) (-2625.397) [-2627.478] (-2623.803) -- 0:03:58
      414000 -- [-2624.680] (-2628.912) (-2620.656) (-2630.515) * (-2625.166) [-2625.562] (-2623.237) (-2639.121) -- 0:03:57
      414500 -- (-2628.802) (-2630.625) (-2625.608) [-2623.105] * [-2630.916] (-2626.857) (-2631.279) (-2628.858) -- 0:03:57
      415000 -- (-2624.678) (-2628.640) (-2619.429) [-2625.533] * (-2627.220) (-2628.135) (-2630.604) [-2624.402] -- 0:03:58

      Average standard deviation of split frequencies: 0.000453

      415500 -- (-2624.806) (-2626.565) (-2624.202) [-2622.105] * (-2622.664) [-2628.264] (-2630.587) (-2624.819) -- 0:03:57
      416000 -- (-2628.013) (-2623.217) (-2627.587) [-2634.189] * (-2641.117) (-2624.509) (-2627.082) [-2623.293] -- 0:03:57
      416500 -- (-2627.454) [-2624.045] (-2639.217) (-2631.642) * (-2631.007) (-2627.910) [-2624.237] (-2630.754) -- 0:03:56
      417000 -- (-2632.239) (-2636.976) [-2623.912] (-2633.238) * (-2625.610) (-2628.425) (-2632.324) [-2623.648] -- 0:03:56
      417500 -- [-2625.059] (-2634.460) (-2627.622) (-2630.254) * (-2626.537) (-2633.527) [-2626.083] (-2627.539) -- 0:03:57
      418000 -- [-2621.711] (-2630.615) (-2620.364) (-2629.565) * (-2628.020) (-2630.403) [-2618.945] (-2624.952) -- 0:03:56
      418500 -- (-2623.593) [-2633.946] (-2627.404) (-2626.827) * [-2622.221] (-2626.393) (-2625.533) (-2620.079) -- 0:03:56
      419000 -- (-2623.474) [-2632.336] (-2636.462) (-2627.468) * (-2624.899) [-2622.031] (-2617.326) (-2623.170) -- 0:03:55
      419500 -- (-2624.963) (-2634.028) [-2626.334] (-2618.471) * (-2625.271) (-2625.410) (-2627.151) [-2624.893] -- 0:03:55
      420000 -- [-2627.924] (-2629.838) (-2634.648) (-2630.319) * [-2627.501] (-2622.133) (-2628.934) (-2636.812) -- 0:03:56

      Average standard deviation of split frequencies: 0.000448

      420500 -- (-2630.827) (-2622.618) (-2625.860) [-2623.265] * [-2623.202] (-2624.820) (-2626.479) (-2630.845) -- 0:03:55
      421000 -- (-2627.861) [-2629.342] (-2624.564) (-2622.085) * (-2625.488) [-2620.757] (-2636.118) (-2627.555) -- 0:03:55
      421500 -- [-2629.515] (-2625.694) (-2625.135) (-2626.718) * (-2633.048) (-2628.694) (-2634.134) [-2628.181] -- 0:03:54
      422000 -- (-2629.492) (-2624.033) [-2621.896] (-2635.145) * (-2624.264) [-2621.219] (-2628.583) (-2629.390) -- 0:03:54
      422500 -- (-2633.396) [-2621.053] (-2625.917) (-2644.352) * [-2623.052] (-2625.275) (-2627.453) (-2632.358) -- 0:03:55
      423000 -- [-2623.298] (-2622.360) (-2630.433) (-2624.381) * (-2622.549) (-2625.166) [-2626.147] (-2625.737) -- 0:03:54
      423500 -- (-2626.824) [-2621.665] (-2631.940) (-2623.469) * [-2624.471] (-2624.466) (-2631.995) (-2626.887) -- 0:03:54
      424000 -- (-2621.759) [-2625.156] (-2633.877) (-2625.545) * (-2627.388) (-2627.086) [-2624.756] (-2631.633) -- 0:03:53
      424500 -- (-2630.779) (-2622.321) [-2623.307] (-2640.493) * [-2624.649] (-2632.210) (-2629.045) (-2632.220) -- 0:03:53
      425000 -- [-2621.527] (-2624.750) (-2627.313) (-2627.392) * (-2624.488) (-2624.930) (-2631.583) [-2628.221] -- 0:03:54

      Average standard deviation of split frequencies: 0.000443

      425500 -- [-2622.578] (-2625.653) (-2627.681) (-2626.795) * (-2627.039) (-2625.179) [-2629.290] (-2631.558) -- 0:03:53
      426000 -- [-2621.550] (-2627.910) (-2628.478) (-2622.586) * (-2631.354) (-2619.513) (-2625.119) [-2623.395] -- 0:03:53
      426500 -- (-2633.066) [-2630.430] (-2630.620) (-2632.221) * (-2636.420) (-2621.726) (-2625.571) [-2624.146] -- 0:03:52
      427000 -- (-2623.665) (-2619.815) (-2629.787) [-2625.720] * (-2620.264) (-2626.720) [-2625.005] (-2630.591) -- 0:03:52
      427500 -- (-2639.531) (-2633.222) (-2633.707) [-2626.527] * (-2626.363) [-2618.666] (-2629.155) (-2631.203) -- 0:03:53
      428000 -- (-2632.540) (-2621.484) [-2629.683] (-2631.715) * [-2624.950] (-2622.668) (-2629.745) (-2633.052) -- 0:03:52
      428500 -- (-2637.831) [-2620.902] (-2629.565) (-2626.407) * (-2627.646) [-2622.849] (-2631.820) (-2632.542) -- 0:03:52
      429000 -- (-2625.183) (-2626.926) [-2624.664] (-2626.584) * (-2618.773) [-2626.418] (-2627.508) (-2631.225) -- 0:03:51
      429500 -- [-2623.525] (-2622.557) (-2634.016) (-2626.486) * (-2627.199) (-2632.975) (-2626.055) [-2630.281] -- 0:03:51
      430000 -- (-2632.746) (-2624.258) [-2628.963] (-2632.796) * (-2629.784) [-2632.006] (-2619.239) (-2632.448) -- 0:03:51

      Average standard deviation of split frequencies: 0.000438

      430500 -- (-2631.929) [-2628.124] (-2631.223) (-2632.996) * (-2627.646) (-2634.426) [-2622.195] (-2633.781) -- 0:03:51
      431000 -- (-2630.510) [-2633.206] (-2620.883) (-2618.428) * (-2626.815) (-2624.287) [-2629.023] (-2631.563) -- 0:03:51
      431500 -- [-2619.359] (-2629.327) (-2629.914) (-2621.364) * (-2625.859) (-2624.576) (-2625.472) [-2626.355] -- 0:03:50
      432000 -- (-2627.175) (-2633.176) (-2632.904) [-2621.803] * (-2627.042) (-2628.166) [-2623.825] (-2632.438) -- 0:03:50
      432500 -- [-2621.535] (-2629.386) (-2634.019) (-2626.496) * (-2631.027) (-2624.843) (-2623.327) [-2630.015] -- 0:03:50
      433000 -- (-2625.084) (-2631.774) [-2625.240] (-2628.645) * (-2630.898) [-2627.884] (-2635.952) (-2629.122) -- 0:03:50
      433500 -- [-2623.745] (-2636.752) (-2627.196) (-2631.959) * (-2625.915) [-2622.828] (-2624.414) (-2630.078) -- 0:03:49
      434000 -- [-2624.048] (-2634.277) (-2630.938) (-2631.577) * [-2621.912] (-2631.044) (-2627.183) (-2631.908) -- 0:03:49
      434500 -- (-2632.079) [-2623.441] (-2625.878) (-2628.885) * (-2623.723) (-2633.500) [-2627.423] (-2623.935) -- 0:03:49
      435000 -- [-2626.044] (-2618.697) (-2632.902) (-2636.626) * (-2619.996) (-2634.141) (-2629.182) [-2630.053] -- 0:03:49

      Average standard deviation of split frequencies: 0.000432

      435500 -- (-2630.258) [-2623.530] (-2628.615) (-2627.722) * (-2625.862) (-2641.779) (-2622.388) [-2623.670] -- 0:03:49
      436000 -- (-2624.054) (-2625.603) (-2628.084) [-2625.931] * (-2620.148) (-2634.110) (-2622.740) [-2625.214] -- 0:03:48
      436500 -- (-2626.898) [-2622.311] (-2630.619) (-2626.849) * [-2621.900] (-2627.323) (-2629.984) (-2629.329) -- 0:03:48
      437000 -- (-2625.366) (-2624.245) (-2625.701) [-2624.706] * (-2629.890) [-2628.092] (-2629.180) (-2625.409) -- 0:03:48
      437500 -- (-2629.529) (-2629.928) [-2625.191] (-2636.303) * (-2622.649) (-2629.045) [-2627.805] (-2637.344) -- 0:03:48
      438000 -- [-2623.854] (-2628.719) (-2627.419) (-2626.704) * (-2637.515) [-2627.045] (-2624.116) (-2623.903) -- 0:03:48
      438500 -- (-2623.676) (-2633.386) [-2626.411] (-2626.598) * [-2628.251] (-2625.215) (-2626.796) (-2627.374) -- 0:03:47
      439000 -- (-2627.245) (-2630.300) (-2626.724) [-2620.895] * (-2625.378) (-2633.747) (-2625.820) [-2628.807] -- 0:03:47
      439500 -- (-2622.586) (-2632.555) [-2629.896] (-2624.597) * [-2626.434] (-2623.950) (-2625.115) (-2626.144) -- 0:03:48
      440000 -- (-2629.218) [-2626.369] (-2628.674) (-2627.206) * (-2629.234) (-2632.611) [-2625.362] (-2627.191) -- 0:03:47

      Average standard deviation of split frequencies: 0.000428

      440500 -- (-2630.912) (-2629.636) (-2625.950) [-2627.265] * [-2632.707] (-2630.879) (-2626.409) (-2620.887) -- 0:03:47
      441000 -- (-2626.206) [-2623.434] (-2631.436) (-2634.290) * (-2636.914) (-2628.138) [-2632.328] (-2624.055) -- 0:03:46
      441500 -- [-2623.333] (-2625.108) (-2621.784) (-2628.951) * [-2632.535] (-2623.863) (-2623.713) (-2626.266) -- 0:03:46
      442000 -- [-2625.977] (-2636.107) (-2626.907) (-2630.231) * (-2629.116) [-2624.371] (-2637.002) (-2627.718) -- 0:03:47
      442500 -- (-2630.143) (-2634.256) (-2633.230) [-2625.714] * (-2625.953) [-2622.270] (-2628.885) (-2626.329) -- 0:03:46
      443000 -- [-2624.939] (-2628.837) (-2624.337) (-2623.237) * (-2624.530) (-2623.133) (-2629.888) [-2624.821] -- 0:03:46
      443500 -- (-2626.446) [-2627.223] (-2628.264) (-2628.311) * (-2625.226) (-2630.361) [-2628.367] (-2629.772) -- 0:03:45
      444000 -- (-2629.417) (-2633.488) (-2627.759) [-2622.110] * (-2622.022) (-2624.621) [-2625.378] (-2625.024) -- 0:03:45
      444500 -- [-2624.426] (-2627.229) (-2633.146) (-2620.325) * [-2621.258] (-2626.136) (-2623.720) (-2622.491) -- 0:03:46
      445000 -- [-2627.517] (-2622.750) (-2625.148) (-2626.571) * [-2626.497] (-2622.571) (-2624.193) (-2629.922) -- 0:03:45

      Average standard deviation of split frequencies: 0.000423

      445500 -- [-2620.912] (-2622.709) (-2627.782) (-2624.421) * (-2625.317) (-2632.640) (-2629.682) [-2627.009] -- 0:03:45
      446000 -- [-2620.596] (-2629.907) (-2628.562) (-2631.532) * [-2628.654] (-2627.235) (-2623.323) (-2629.253) -- 0:03:44
      446500 -- (-2624.015) (-2628.620) [-2621.837] (-2629.103) * (-2623.899) (-2630.467) [-2624.102] (-2629.104) -- 0:03:44
      447000 -- (-2627.176) [-2622.282] (-2633.287) (-2630.206) * (-2626.394) (-2627.384) (-2627.776) [-2625.072] -- 0:03:45
      447500 -- (-2624.954) [-2622.278] (-2625.090) (-2629.770) * (-2631.510) (-2628.259) [-2623.128] (-2621.194) -- 0:03:44
      448000 -- (-2622.372) (-2630.702) [-2627.102] (-2633.320) * (-2626.806) [-2630.400] (-2623.146) (-2622.377) -- 0:03:44
      448500 -- (-2626.287) (-2627.544) (-2626.425) [-2626.267] * (-2627.916) [-2627.141] (-2629.639) (-2620.055) -- 0:03:43
      449000 -- (-2625.715) (-2632.930) (-2628.172) [-2624.070] * (-2626.826) [-2627.552] (-2623.516) (-2622.890) -- 0:03:43
      449500 -- (-2628.407) (-2632.103) [-2630.047] (-2629.025) * (-2632.506) [-2626.139] (-2619.290) (-2626.111) -- 0:03:44
      450000 -- [-2620.615] (-2628.004) (-2626.815) (-2633.255) * (-2631.045) (-2623.796) (-2623.665) [-2626.067] -- 0:03:43

      Average standard deviation of split frequencies: 0.000418

      450500 -- [-2623.899] (-2624.337) (-2624.347) (-2634.105) * (-2623.799) (-2623.623) (-2623.473) [-2625.746] -- 0:03:43
      451000 -- (-2620.020) (-2630.214) [-2623.614] (-2635.984) * (-2633.591) (-2620.087) (-2626.096) [-2621.238] -- 0:03:42
      451500 -- (-2630.465) (-2638.681) [-2622.223] (-2635.820) * (-2625.685) [-2624.411] (-2634.216) (-2624.853) -- 0:03:42
      452000 -- [-2622.928] (-2622.378) (-2626.920) (-2625.677) * (-2630.522) [-2623.329] (-2626.250) (-2619.852) -- 0:03:43
      452500 -- [-2627.406] (-2624.456) (-2625.877) (-2625.698) * (-2629.000) (-2624.612) [-2623.575] (-2633.851) -- 0:03:42
      453000 -- (-2626.432) (-2626.162) [-2625.887] (-2624.086) * [-2623.754] (-2627.529) (-2626.591) (-2621.537) -- 0:03:42
      453500 -- (-2629.489) (-2635.760) (-2631.362) [-2623.815] * [-2623.867] (-2627.010) (-2621.816) (-2632.261) -- 0:03:41
      454000 -- [-2623.650] (-2628.050) (-2625.534) (-2628.717) * (-2635.750) (-2624.596) [-2628.006] (-2623.577) -- 0:03:41
      454500 -- (-2631.363) [-2625.104] (-2626.003) (-2631.340) * (-2624.948) (-2622.567) (-2632.517) [-2628.706] -- 0:03:42
      455000 -- (-2624.823) (-2624.468) (-2622.903) [-2625.307] * (-2632.576) (-2630.180) [-2627.814] (-2637.720) -- 0:03:41

      Average standard deviation of split frequencies: 0.000414

      455500 -- [-2627.272] (-2623.681) (-2635.893) (-2630.848) * (-2630.913) (-2629.030) (-2624.711) [-2621.525] -- 0:03:41
      456000 -- (-2633.444) (-2631.650) (-2621.189) [-2627.837] * [-2633.822] (-2626.961) (-2637.582) (-2629.299) -- 0:03:40
      456500 -- (-2631.095) (-2620.763) (-2623.604) [-2621.707] * (-2634.905) (-2622.898) [-2623.985] (-2627.896) -- 0:03:40
      457000 -- [-2634.983] (-2627.120) (-2630.216) (-2626.557) * (-2631.557) [-2620.868] (-2628.043) (-2627.837) -- 0:03:41
      457500 -- (-2634.004) [-2617.332] (-2635.948) (-2630.148) * (-2631.550) (-2631.625) [-2631.269] (-2625.972) -- 0:03:40
      458000 -- [-2632.073] (-2624.581) (-2627.693) (-2632.003) * [-2628.284] (-2628.045) (-2622.929) (-2627.275) -- 0:03:40
      458500 -- [-2623.643] (-2622.833) (-2624.324) (-2627.578) * (-2626.738) (-2624.390) [-2628.667] (-2628.970) -- 0:03:39
      459000 -- (-2631.111) (-2620.595) (-2622.309) [-2636.896] * (-2627.373) (-2625.581) (-2627.329) [-2626.269] -- 0:03:39
      459500 -- (-2631.675) (-2622.695) [-2625.928] (-2632.521) * (-2632.199) (-2624.840) [-2624.407] (-2627.938) -- 0:03:39
      460000 -- (-2625.554) [-2631.110] (-2628.509) (-2638.239) * [-2623.331] (-2627.079) (-2630.731) (-2630.416) -- 0:03:39

      Average standard deviation of split frequencies: 0.000409

      460500 -- (-2627.030) (-2623.167) (-2628.875) [-2633.715] * (-2630.950) (-2634.038) (-2627.044) [-2625.290] -- 0:03:39
      461000 -- (-2619.658) (-2627.143) [-2625.210] (-2629.325) * (-2636.333) (-2629.650) (-2625.290) [-2622.883] -- 0:03:38
      461500 -- [-2623.409] (-2620.850) (-2622.044) (-2628.509) * (-2632.378) (-2624.560) [-2627.425] (-2623.604) -- 0:03:38
      462000 -- (-2624.955) (-2632.708) [-2628.341] (-2637.362) * (-2633.042) (-2627.602) [-2627.683] (-2632.338) -- 0:03:38
      462500 -- (-2629.430) [-2624.772] (-2631.298) (-2639.346) * [-2619.297] (-2631.813) (-2629.630) (-2622.187) -- 0:03:38
      463000 -- (-2634.325) (-2621.804) (-2633.467) [-2621.354] * (-2622.684) (-2628.152) (-2632.625) [-2626.520] -- 0:03:38
      463500 -- (-2625.089) (-2626.507) [-2622.623] (-2633.121) * [-2624.248] (-2635.704) (-2633.734) (-2628.991) -- 0:03:37
      464000 -- (-2626.016) (-2626.831) (-2624.545) [-2622.782] * (-2632.860) (-2626.044) [-2626.611] (-2632.760) -- 0:03:37
      464500 -- (-2628.894) (-2630.857) (-2624.829) [-2625.715] * (-2639.074) (-2624.685) [-2630.956] (-2627.403) -- 0:03:37
      465000 -- (-2619.890) (-2621.793) (-2623.800) [-2629.760] * (-2629.850) [-2620.824] (-2631.930) (-2625.955) -- 0:03:37

      Average standard deviation of split frequencies: 0.000405

      465500 -- (-2626.888) [-2618.494] (-2622.753) (-2621.532) * (-2627.612) (-2619.949) (-2632.480) [-2623.645] -- 0:03:37
      466000 -- (-2620.249) [-2620.658] (-2629.659) (-2637.935) * (-2627.941) (-2626.876) (-2624.832) [-2620.664] -- 0:03:36
      466500 -- (-2621.669) [-2626.414] (-2626.509) (-2629.738) * (-2623.322) (-2631.031) (-2631.731) [-2625.071] -- 0:03:36
      467000 -- [-2624.624] (-2624.447) (-2625.380) (-2627.033) * (-2631.804) [-2629.068] (-2626.472) (-2625.532) -- 0:03:36
      467500 -- (-2629.659) (-2619.024) (-2625.261) [-2623.088] * [-2624.532] (-2622.527) (-2622.479) (-2631.259) -- 0:03:36
      468000 -- (-2623.128) [-2620.463] (-2629.544) (-2625.012) * (-2630.760) (-2628.510) [-2628.682] (-2626.471) -- 0:03:35
      468500 -- (-2626.887) [-2621.227] (-2630.536) (-2629.967) * (-2625.227) [-2628.557] (-2625.003) (-2638.309) -- 0:03:35
      469000 -- (-2630.255) [-2626.033] (-2624.162) (-2626.157) * (-2626.490) (-2629.149) [-2624.195] (-2624.989) -- 0:03:35
      469500 -- [-2619.055] (-2630.396) (-2625.046) (-2624.292) * (-2623.896) (-2633.183) (-2626.322) [-2635.241] -- 0:03:35
      470000 -- [-2621.306] (-2632.403) (-2625.891) (-2621.404) * (-2632.966) (-2623.827) [-2621.220] (-2622.407) -- 0:03:35

      Average standard deviation of split frequencies: 0.000401

      470500 -- (-2627.938) [-2628.441] (-2632.532) (-2625.384) * (-2629.754) [-2623.377] (-2625.728) (-2626.077) -- 0:03:34
      471000 -- [-2619.473] (-2627.628) (-2629.420) (-2630.881) * (-2626.399) (-2626.650) (-2626.629) [-2622.286] -- 0:03:34
      471500 -- [-2623.208] (-2628.401) (-2627.958) (-2637.068) * (-2642.708) (-2623.818) [-2625.373] (-2625.268) -- 0:03:34
      472000 -- (-2624.162) (-2624.358) (-2628.092) [-2633.822] * (-2630.090) (-2630.224) (-2634.547) [-2625.981] -- 0:03:34
      472500 -- (-2630.685) (-2623.403) [-2624.907] (-2628.700) * (-2637.762) (-2624.937) [-2622.506] (-2626.259) -- 0:03:34
      473000 -- (-2625.347) (-2635.054) (-2633.199) [-2623.360] * (-2624.447) (-2621.328) (-2627.070) [-2623.596] -- 0:03:33
      473500 -- (-2632.542) (-2618.924) [-2622.474] (-2621.720) * (-2628.816) [-2624.986] (-2630.671) (-2637.159) -- 0:03:33
      474000 -- (-2631.380) (-2620.765) [-2623.939] (-2627.319) * (-2623.267) (-2622.793) [-2628.096] (-2626.730) -- 0:03:33
      474500 -- [-2628.490] (-2634.944) (-2624.233) (-2629.954) * [-2627.960] (-2627.792) (-2632.236) (-2627.563) -- 0:03:33
      475000 -- (-2627.665) (-2628.713) [-2622.825] (-2621.299) * [-2626.109] (-2622.163) (-2630.558) (-2630.419) -- 0:03:33

      Average standard deviation of split frequencies: 0.000396

      475500 -- (-2637.769) [-2628.014] (-2626.760) (-2624.633) * (-2640.456) [-2622.902] (-2631.910) (-2626.484) -- 0:03:32
      476000 -- (-2635.453) (-2628.580) [-2629.317] (-2627.181) * (-2629.882) (-2626.018) (-2634.693) [-2636.045] -- 0:03:32
      476500 -- (-2632.001) [-2625.061] (-2633.041) (-2628.362) * (-2624.459) (-2625.495) (-2631.969) [-2622.950] -- 0:03:32
      477000 -- (-2628.705) (-2623.921) (-2626.783) [-2625.144] * (-2632.925) (-2630.789) (-2630.199) [-2624.310] -- 0:03:32
      477500 -- (-2635.879) (-2624.409) [-2629.014] (-2625.209) * (-2622.874) (-2639.073) (-2629.726) [-2625.564] -- 0:03:32
      478000 -- (-2640.298) (-2628.554) [-2624.834] (-2627.566) * (-2623.308) [-2623.750] (-2625.747) (-2621.671) -- 0:03:31
      478500 -- (-2635.060) [-2624.937] (-2628.245) (-2628.587) * (-2627.175) (-2620.986) (-2624.426) [-2627.228] -- 0:03:31
      479000 -- (-2632.282) (-2633.755) (-2623.653) [-2632.889] * (-2625.392) (-2625.790) (-2625.081) [-2619.783] -- 0:03:32
      479500 -- (-2621.688) (-2631.497) [-2624.665] (-2625.727) * (-2622.410) [-2626.456] (-2627.199) (-2626.014) -- 0:03:31
      480000 -- (-2631.373) (-2627.866) [-2624.538] (-2625.342) * (-2627.437) (-2627.275) [-2627.095] (-2626.094) -- 0:03:31

      Average standard deviation of split frequencies: 0.000392

      480500 -- [-2624.866] (-2626.390) (-2633.974) (-2639.966) * [-2623.509] (-2631.842) (-2627.559) (-2638.166) -- 0:03:30
      481000 -- (-2636.276) (-2627.172) [-2629.784] (-2625.731) * [-2620.430] (-2634.304) (-2617.987) (-2628.538) -- 0:03:30
      481500 -- (-2629.032) (-2637.395) (-2625.622) [-2623.632] * (-2620.188) [-2629.032] (-2629.381) (-2625.304) -- 0:03:31
      482000 -- (-2626.078) (-2626.279) (-2625.686) [-2621.843] * [-2622.524] (-2626.708) (-2623.193) (-2625.889) -- 0:03:30
      482500 -- (-2626.975) (-2628.453) (-2627.298) [-2625.232] * (-2631.907) (-2626.253) [-2626.776] (-2631.808) -- 0:03:30
      483000 -- (-2632.868) (-2631.080) (-2632.901) [-2628.924] * (-2624.217) [-2622.695] (-2627.350) (-2621.851) -- 0:03:29
      483500 -- (-2632.973) (-2627.897) [-2629.388] (-2623.357) * [-2624.867] (-2630.257) (-2636.132) (-2624.483) -- 0:03:29
      484000 -- [-2636.336] (-2629.497) (-2631.570) (-2632.597) * (-2627.193) (-2636.926) (-2633.210) [-2623.918] -- 0:03:30
      484500 -- (-2629.363) (-2627.052) (-2626.098) [-2630.314] * [-2618.271] (-2626.698) (-2625.076) (-2629.231) -- 0:03:29
      485000 -- (-2629.842) [-2624.865] (-2624.467) (-2622.493) * (-2625.033) (-2636.637) [-2623.024] (-2624.565) -- 0:03:29

      Average standard deviation of split frequencies: 0.000388

      485500 -- (-2631.030) [-2626.315] (-2628.551) (-2626.546) * (-2628.472) (-2630.279) [-2628.333] (-2622.512) -- 0:03:28
      486000 -- (-2626.354) [-2623.403] (-2619.375) (-2626.471) * (-2627.380) (-2625.440) [-2628.809] (-2624.346) -- 0:03:28
      486500 -- (-2626.544) (-2630.803) [-2630.384] (-2623.280) * (-2627.378) (-2623.799) [-2620.139] (-2627.196) -- 0:03:28
      487000 -- (-2625.757) (-2621.005) [-2624.806] (-2634.526) * (-2621.818) (-2624.410) [-2626.538] (-2622.854) -- 0:03:28
      487500 -- (-2623.874) (-2621.216) (-2626.132) [-2618.288] * [-2621.886] (-2623.230) (-2624.003) (-2632.023) -- 0:03:28
      488000 -- (-2626.831) (-2627.432) [-2628.964] (-2626.463) * (-2628.388) (-2630.466) [-2631.350] (-2629.082) -- 0:03:27
      488500 -- [-2623.536] (-2618.362) (-2624.401) (-2633.474) * [-2618.519] (-2621.984) (-2619.758) (-2623.292) -- 0:03:27
      489000 -- [-2624.085] (-2626.287) (-2622.822) (-2623.864) * (-2627.919) [-2626.829] (-2620.773) (-2623.796) -- 0:03:27
      489500 -- (-2623.309) (-2633.298) (-2626.081) [-2628.782] * (-2629.449) (-2625.022) (-2632.945) [-2625.200] -- 0:03:27
      490000 -- (-2621.671) (-2625.569) [-2622.463] (-2626.169) * (-2625.345) (-2633.567) (-2627.287) [-2626.803] -- 0:03:27

      Average standard deviation of split frequencies: 0.000384

      490500 -- (-2624.594) (-2631.945) [-2630.095] (-2628.522) * [-2624.506] (-2626.254) (-2626.439) (-2622.168) -- 0:03:26
      491000 -- (-2626.798) (-2627.984) [-2627.561] (-2631.213) * (-2622.233) (-2621.342) [-2625.101] (-2624.499) -- 0:03:26
      491500 -- (-2623.675) (-2625.635) [-2626.994] (-2643.405) * [-2630.804] (-2624.875) (-2622.769) (-2626.746) -- 0:03:26
      492000 -- [-2628.978] (-2625.464) (-2622.934) (-2635.447) * (-2636.747) (-2627.837) (-2626.457) [-2628.931] -- 0:03:26
      492500 -- [-2621.049] (-2621.417) (-2626.960) (-2623.682) * (-2626.085) (-2626.515) [-2623.171] (-2634.667) -- 0:03:26
      493000 -- [-2620.705] (-2626.348) (-2625.539) (-2625.631) * [-2620.294] (-2627.680) (-2631.590) (-2630.480) -- 0:03:25
      493500 -- (-2622.682) (-2621.984) (-2629.648) [-2628.701] * (-2626.685) (-2628.500) [-2628.472] (-2626.964) -- 0:03:25
      494000 -- (-2627.247) (-2624.732) (-2628.639) [-2625.690] * [-2628.515] (-2633.120) (-2624.817) (-2629.426) -- 0:03:25
      494500 -- [-2624.171] (-2631.937) (-2624.941) (-2623.133) * (-2626.285) [-2623.400] (-2637.113) (-2634.329) -- 0:03:25
      495000 -- [-2619.498] (-2623.294) (-2630.838) (-2623.576) * (-2626.075) [-2623.179] (-2629.259) (-2635.324) -- 0:03:25

      Average standard deviation of split frequencies: 0.000380

      495500 -- (-2623.867) [-2627.147] (-2630.436) (-2627.376) * (-2631.270) (-2624.817) [-2623.024] (-2621.104) -- 0:03:24
      496000 -- (-2625.455) (-2622.913) [-2624.478] (-2626.478) * [-2621.078] (-2629.237) (-2622.975) (-2629.310) -- 0:03:24
      496500 -- (-2630.136) [-2625.017] (-2626.114) (-2624.911) * (-2625.147) (-2628.500) [-2620.784] (-2636.180) -- 0:03:24
      497000 -- [-2627.107] (-2626.803) (-2624.165) (-2626.004) * [-2620.696] (-2628.528) (-2627.726) (-2626.799) -- 0:03:24
      497500 -- (-2622.683) (-2621.814) [-2629.278] (-2631.799) * (-2627.065) (-2622.866) (-2630.213) [-2624.939] -- 0:03:24
      498000 -- (-2639.245) (-2623.400) [-2626.971] (-2636.352) * (-2629.039) [-2639.870] (-2629.010) (-2625.961) -- 0:03:23
      498500 -- (-2631.352) (-2625.907) [-2624.035] (-2639.532) * (-2627.712) (-2628.398) (-2622.933) [-2625.033] -- 0:03:23
      499000 -- [-2622.166] (-2630.818) (-2633.117) (-2635.771) * [-2624.959] (-2628.364) (-2620.281) (-2632.769) -- 0:03:23
      499500 -- (-2622.355) [-2624.944] (-2624.777) (-2626.116) * (-2629.614) [-2622.781] (-2628.109) (-2629.631) -- 0:03:23
      500000 -- (-2626.362) (-2628.344) (-2632.454) [-2620.800] * (-2622.624) (-2623.541) (-2625.280) [-2623.494] -- 0:03:23

      Average standard deviation of split frequencies: 0.000377

      500500 -- (-2622.793) (-2633.969) [-2624.807] (-2619.269) * [-2629.024] (-2620.265) (-2624.755) (-2625.926) -- 0:03:22
      501000 -- (-2628.470) (-2629.310) (-2626.592) [-2623.588] * (-2626.172) (-2623.062) [-2624.334] (-2624.783) -- 0:03:22
      501500 -- [-2630.973] (-2631.303) (-2620.713) (-2623.863) * (-2640.426) (-2623.495) [-2621.529] (-2624.783) -- 0:03:22
      502000 -- (-2631.980) [-2626.165] (-2620.300) (-2629.610) * (-2634.725) (-2627.689) (-2621.521) [-2624.737] -- 0:03:22
      502500 -- (-2631.540) (-2624.364) (-2634.919) [-2627.432] * (-2627.886) (-2623.397) [-2622.950] (-2624.118) -- 0:03:21
      503000 -- (-2629.104) [-2620.987] (-2632.406) (-2629.770) * (-2627.935) (-2629.645) [-2625.196] (-2629.045) -- 0:03:21
      503500 -- (-2635.103) (-2628.172) (-2626.380) [-2622.575] * (-2627.747) (-2629.752) (-2629.617) [-2628.104] -- 0:03:21
      504000 -- [-2626.617] (-2622.414) (-2629.632) (-2631.299) * (-2627.049) (-2624.858) (-2630.644) [-2621.511] -- 0:03:21
      504500 -- (-2631.234) (-2622.792) (-2619.844) [-2623.857] * (-2623.994) (-2627.788) [-2628.686] (-2626.099) -- 0:03:21
      505000 -- [-2628.999] (-2633.719) (-2632.575) (-2628.066) * [-2622.709] (-2629.962) (-2626.770) (-2625.588) -- 0:03:20

      Average standard deviation of split frequencies: 0.000373

      505500 -- [-2624.545] (-2628.470) (-2627.806) (-2629.235) * (-2622.114) (-2635.462) [-2620.887] (-2622.049) -- 0:03:20
      506000 -- (-2632.302) [-2622.196] (-2620.689) (-2631.482) * (-2623.675) (-2636.050) (-2633.245) [-2625.179] -- 0:03:20
      506500 -- (-2634.907) (-2623.497) [-2622.571] (-2626.832) * (-2624.209) (-2636.228) [-2632.686] (-2631.752) -- 0:03:20
      507000 -- [-2622.732] (-2625.174) (-2625.323) (-2627.815) * [-2629.188] (-2625.777) (-2630.494) (-2621.839) -- 0:03:20
      507500 -- (-2627.140) (-2627.763) (-2627.659) [-2628.336] * (-2622.680) (-2628.632) [-2626.345] (-2628.037) -- 0:03:19
      508000 -- [-2627.586] (-2625.058) (-2626.852) (-2624.973) * (-2627.948) (-2627.418) [-2630.460] (-2629.344) -- 0:03:19
      508500 -- [-2626.616] (-2621.637) (-2622.698) (-2626.823) * (-2629.342) (-2635.950) [-2625.655] (-2626.916) -- 0:03:19
      509000 -- (-2630.709) (-2619.790) [-2629.189] (-2636.058) * (-2624.964) (-2626.342) (-2626.217) [-2632.959] -- 0:03:19
      509500 -- (-2630.830) (-2630.759) (-2629.161) [-2624.035] * (-2628.462) (-2630.579) (-2626.344) [-2623.865] -- 0:03:19
      510000 -- (-2626.388) [-2620.876] (-2628.680) (-2623.643) * (-2625.471) (-2623.668) (-2624.832) [-2626.817] -- 0:03:18

      Average standard deviation of split frequencies: 0.000369

      510500 -- (-2630.331) [-2620.578] (-2628.352) (-2627.399) * (-2623.383) [-2621.728] (-2619.739) (-2628.234) -- 0:03:18
      511000 -- (-2626.883) (-2623.178) (-2638.844) [-2622.001] * [-2623.220] (-2630.638) (-2629.506) (-2626.242) -- 0:03:18
      511500 -- (-2634.591) (-2637.909) (-2626.968) [-2625.105] * (-2632.514) [-2625.257] (-2630.688) (-2628.076) -- 0:03:18
      512000 -- (-2635.217) (-2623.975) (-2627.974) [-2630.198] * [-2624.570] (-2628.272) (-2625.858) (-2631.711) -- 0:03:18
      512500 -- [-2629.562] (-2623.250) (-2628.853) (-2630.729) * (-2625.279) (-2629.853) (-2625.349) [-2625.198] -- 0:03:17
      513000 -- (-2640.218) (-2622.061) (-2634.724) [-2622.826] * (-2630.800) (-2638.836) (-2624.860) [-2625.071] -- 0:03:17
      513500 -- (-2624.221) (-2623.731) (-2637.736) [-2622.994] * (-2627.855) (-2631.515) [-2629.548] (-2623.875) -- 0:03:18
      514000 -- [-2621.367] (-2630.509) (-2629.059) (-2624.372) * (-2639.699) (-2628.407) (-2628.487) [-2623.851] -- 0:03:17
      514500 -- (-2634.900) (-2620.336) (-2630.375) [-2625.619] * (-2628.727) (-2623.392) [-2626.973] (-2626.895) -- 0:03:17
      515000 -- (-2644.664) [-2628.446] (-2633.608) (-2622.867) * [-2629.167] (-2620.437) (-2630.377) (-2635.085) -- 0:03:16

      Average standard deviation of split frequencies: 0.000365

      515500 -- (-2630.931) [-2622.579] (-2622.204) (-2624.122) * (-2641.419) [-2629.185] (-2628.340) (-2629.218) -- 0:03:16
      516000 -- [-2626.251] (-2634.622) (-2625.717) (-2632.220) * (-2639.746) (-2622.425) [-2632.280] (-2632.507) -- 0:03:16
      516500 -- (-2624.306) (-2628.188) (-2627.086) [-2623.045] * [-2622.721] (-2625.319) (-2629.113) (-2625.358) -- 0:03:16
      517000 -- [-2631.561] (-2621.723) (-2623.629) (-2627.889) * [-2625.923] (-2626.479) (-2627.968) (-2625.300) -- 0:03:16
      517500 -- [-2626.364] (-2627.996) (-2625.078) (-2633.611) * [-2627.656] (-2636.606) (-2630.050) (-2630.985) -- 0:03:15
      518000 -- (-2634.826) (-2624.857) [-2624.621] (-2630.234) * (-2628.464) [-2621.305] (-2628.735) (-2633.910) -- 0:03:15
      518500 -- (-2625.428) (-2630.426) [-2625.118] (-2627.400) * (-2624.966) (-2625.215) [-2626.497] (-2624.711) -- 0:03:15
      519000 -- (-2626.446) (-2626.800) (-2625.759) [-2632.583] * (-2626.752) [-2629.541] (-2623.015) (-2629.206) -- 0:03:15
      519500 -- (-2628.602) (-2628.640) [-2623.488] (-2626.657) * [-2632.855] (-2619.067) (-2632.276) (-2625.434) -- 0:03:15
      520000 -- [-2628.409] (-2621.502) (-2629.697) (-2628.502) * (-2622.482) (-2623.283) (-2629.446) [-2622.025] -- 0:03:14

      Average standard deviation of split frequencies: 0.000362

      520500 -- (-2629.594) (-2624.676) (-2624.797) [-2624.434] * [-2622.934] (-2624.795) (-2628.699) (-2625.976) -- 0:03:14
      521000 -- (-2626.298) (-2625.337) (-2626.153) [-2630.640] * (-2624.842) (-2623.850) (-2625.996) [-2624.135] -- 0:03:14
      521500 -- (-2632.557) [-2623.933] (-2624.148) (-2625.822) * (-2622.519) [-2627.898] (-2624.900) (-2628.013) -- 0:03:14
      522000 -- (-2619.637) [-2630.342] (-2627.197) (-2625.581) * (-2629.706) (-2630.327) [-2621.982] (-2620.686) -- 0:03:14
      522500 -- [-2624.297] (-2623.238) (-2625.172) (-2624.941) * (-2635.541) (-2623.871) (-2625.567) [-2627.989] -- 0:03:13
      523000 -- (-2623.967) [-2623.429] (-2622.394) (-2623.379) * [-2636.872] (-2627.323) (-2635.064) (-2640.056) -- 0:03:13
      523500 -- (-2623.621) [-2625.865] (-2629.019) (-2629.821) * (-2630.178) [-2620.209] (-2630.121) (-2626.807) -- 0:03:13
      524000 -- (-2642.199) (-2622.292) [-2631.714] (-2621.569) * (-2626.744) [-2626.600] (-2625.255) (-2634.938) -- 0:03:13
      524500 -- (-2625.070) (-2629.532) [-2632.219] (-2625.908) * (-2637.306) (-2624.978) [-2625.376] (-2627.634) -- 0:03:13
      525000 -- (-2628.573) (-2623.560) (-2621.777) [-2623.185] * [-2625.213] (-2625.240) (-2632.363) (-2633.243) -- 0:03:12

      Average standard deviation of split frequencies: 0.000358

      525500 -- (-2620.103) (-2624.894) (-2628.320) [-2620.176] * (-2637.977) (-2625.207) (-2621.961) [-2626.522] -- 0:03:12
      526000 -- (-2629.264) (-2624.419) (-2630.328) [-2626.911] * (-2624.589) [-2630.178] (-2628.439) (-2627.185) -- 0:03:12
      526500 -- [-2624.186] (-2626.155) (-2629.529) (-2624.365) * (-2628.264) [-2624.292] (-2630.187) (-2628.658) -- 0:03:12
      527000 -- [-2622.869] (-2629.285) (-2620.393) (-2626.706) * [-2626.140] (-2623.738) (-2638.365) (-2639.895) -- 0:03:12
      527500 -- (-2624.849) (-2631.257) [-2626.350] (-2631.798) * (-2632.450) (-2622.268) (-2628.405) [-2625.504] -- 0:03:11
      528000 -- (-2632.124) (-2626.389) (-2632.122) [-2625.864] * (-2627.095) [-2625.785] (-2625.594) (-2639.365) -- 0:03:11
      528500 -- (-2627.073) (-2624.426) [-2626.914] (-2628.026) * (-2633.048) [-2627.445] (-2628.021) (-2630.862) -- 0:03:11
      529000 -- (-2626.537) (-2624.858) [-2624.953] (-2625.100) * (-2635.984) [-2622.453] (-2628.772) (-2627.983) -- 0:03:11
      529500 -- (-2632.404) (-2631.632) (-2621.942) [-2621.441] * (-2630.780) (-2628.813) [-2620.265] (-2620.505) -- 0:03:11
      530000 -- (-2632.499) (-2638.978) (-2627.055) [-2629.525] * (-2623.257) (-2634.464) [-2628.830] (-2626.659) -- 0:03:10

      Average standard deviation of split frequencies: 0.000355

      530500 -- [-2628.185] (-2633.940) (-2627.725) (-2623.563) * (-2631.316) (-2639.121) [-2632.218] (-2626.148) -- 0:03:10
      531000 -- (-2631.912) [-2629.397] (-2622.366) (-2626.871) * (-2627.489) (-2622.629) (-2632.251) [-2626.829] -- 0:03:10
      531500 -- (-2620.216) (-2631.293) (-2624.437) [-2621.459] * [-2619.134] (-2636.779) (-2625.341) (-2624.128) -- 0:03:10
      532000 -- (-2627.654) [-2623.151] (-2627.896) (-2622.997) * [-2625.163] (-2621.432) (-2624.660) (-2625.586) -- 0:03:10
      532500 -- (-2627.596) (-2627.389) [-2627.719] (-2622.680) * (-2627.596) [-2622.035] (-2629.207) (-2631.122) -- 0:03:09
      533000 -- (-2628.238) (-2626.572) (-2624.677) [-2623.048] * (-2629.667) (-2625.554) [-2629.187] (-2633.130) -- 0:03:09
      533500 -- (-2633.365) [-2623.553] (-2631.320) (-2626.150) * (-2636.682) (-2630.094) (-2635.990) [-2622.443] -- 0:03:09
      534000 -- (-2632.512) (-2625.495) (-2629.615) [-2630.948] * (-2628.777) (-2622.797) [-2626.067] (-2622.708) -- 0:03:09
      534500 -- (-2636.184) [-2625.258] (-2623.268) (-2629.075) * (-2630.258) [-2627.810] (-2627.433) (-2622.456) -- 0:03:08
      535000 -- [-2628.441] (-2627.576) (-2631.965) (-2626.224) * (-2626.972) (-2622.380) [-2625.739] (-2630.141) -- 0:03:08

      Average standard deviation of split frequencies: 0.000352

      535500 -- (-2624.211) (-2630.712) (-2622.106) [-2623.469] * [-2624.159] (-2628.328) (-2623.509) (-2643.019) -- 0:03:09
      536000 -- (-2631.264) [-2622.853] (-2626.973) (-2625.262) * (-2630.956) [-2622.781] (-2625.050) (-2627.926) -- 0:03:08
      536500 -- [-2619.691] (-2634.038) (-2627.598) (-2626.205) * [-2624.798] (-2627.124) (-2626.284) (-2634.986) -- 0:03:08
      537000 -- (-2628.160) [-2629.388] (-2628.398) (-2641.085) * (-2622.899) [-2623.096] (-2633.184) (-2624.308) -- 0:03:07
      537500 -- (-2630.865) [-2630.407] (-2633.725) (-2626.950) * [-2623.483] (-2626.019) (-2631.681) (-2630.813) -- 0:03:07
      538000 -- (-2636.032) [-2628.777] (-2625.986) (-2618.887) * (-2620.252) [-2620.835] (-2636.389) (-2628.225) -- 0:03:08
      538500 -- (-2628.662) (-2624.863) [-2624.955] (-2629.125) * (-2628.396) [-2621.421] (-2628.116) (-2624.281) -- 0:03:07
      539000 -- (-2622.424) (-2633.877) [-2623.018] (-2629.776) * (-2631.221) (-2624.410) [-2622.414] (-2624.360) -- 0:03:07
      539500 -- (-2625.888) (-2627.328) (-2625.013) [-2623.068] * (-2623.168) [-2620.125] (-2628.554) (-2622.046) -- 0:03:06
      540000 -- [-2622.949] (-2624.142) (-2626.751) (-2625.024) * [-2625.054] (-2629.109) (-2624.017) (-2629.501) -- 0:03:06

      Average standard deviation of split frequencies: 0.000349

      540500 -- (-2626.190) [-2623.381] (-2625.740) (-2629.287) * [-2623.474] (-2624.107) (-2628.729) (-2631.662) -- 0:03:07
      541000 -- (-2625.845) [-2625.178] (-2634.000) (-2628.934) * (-2628.084) (-2624.499) (-2629.374) [-2625.235] -- 0:03:06
      541500 -- (-2625.412) [-2626.818] (-2630.223) (-2625.667) * (-2625.500) [-2625.467] (-2623.164) (-2629.768) -- 0:03:06
      542000 -- [-2623.750] (-2623.200) (-2628.517) (-2619.950) * (-2629.169) [-2629.964] (-2626.779) (-2633.378) -- 0:03:05
      542500 -- (-2628.506) (-2623.794) (-2632.727) [-2624.040] * (-2631.549) [-2632.826] (-2625.502) (-2634.690) -- 0:03:05
      543000 -- (-2622.836) [-2624.793] (-2635.359) (-2629.032) * (-2633.777) [-2623.814] (-2635.564) (-2633.341) -- 0:03:05
      543500 -- (-2627.563) (-2625.451) [-2630.048] (-2625.809) * (-2633.071) [-2623.869] (-2631.024) (-2628.713) -- 0:03:05
      544000 -- (-2632.651) [-2627.491] (-2622.645) (-2641.969) * (-2635.661) [-2624.335] (-2624.138) (-2624.427) -- 0:03:05
      544500 -- (-2631.099) (-2630.723) [-2631.209] (-2627.578) * (-2628.397) (-2625.895) [-2625.990] (-2622.116) -- 0:03:04
      545000 -- [-2626.558] (-2625.972) (-2632.199) (-2630.733) * (-2632.590) (-2625.043) [-2628.792] (-2622.568) -- 0:03:04

      Average standard deviation of split frequencies: 0.000345

      545500 -- [-2627.175] (-2629.959) (-2626.349) (-2629.209) * (-2625.411) (-2628.142) [-2624.982] (-2632.832) -- 0:03:04
      546000 -- (-2624.329) [-2623.318] (-2625.492) (-2627.010) * (-2621.007) [-2627.263] (-2625.466) (-2627.030) -- 0:03:04
      546500 -- [-2621.382] (-2627.251) (-2621.303) (-2630.974) * [-2631.001] (-2624.493) (-2621.266) (-2628.377) -- 0:03:04
      547000 -- (-2623.101) (-2625.568) [-2624.828] (-2624.152) * (-2629.329) (-2626.533) [-2624.378] (-2624.181) -- 0:03:03
      547500 -- (-2622.278) (-2621.168) (-2630.678) [-2631.691] * [-2628.094] (-2622.840) (-2623.335) (-2623.163) -- 0:03:04
      548000 -- (-2629.268) (-2637.570) [-2626.529] (-2620.657) * (-2621.976) (-2626.391) [-2623.056] (-2628.621) -- 0:03:03
      548500 -- [-2626.324] (-2624.947) (-2635.913) (-2627.429) * (-2625.344) (-2630.721) [-2627.894] (-2629.783) -- 0:03:03
      549000 -- [-2628.306] (-2626.852) (-2624.244) (-2631.612) * (-2633.435) (-2630.487) [-2631.995] (-2626.920) -- 0:03:03
      549500 -- (-2627.165) (-2624.937) (-2625.346) [-2624.811] * (-2635.801) (-2627.082) [-2623.807] (-2629.716) -- 0:03:02
      550000 -- (-2626.976) (-2634.176) [-2619.549] (-2622.199) * (-2623.560) (-2625.226) [-2624.571] (-2622.657) -- 0:03:03

      Average standard deviation of split frequencies: 0.000342

      550500 -- (-2624.986) (-2630.452) (-2625.904) [-2629.900] * [-2626.024] (-2628.373) (-2623.866) (-2624.651) -- 0:03:02
      551000 -- (-2627.824) (-2624.601) (-2624.223) [-2627.866] * [-2627.265] (-2622.410) (-2630.489) (-2629.914) -- 0:03:02
      551500 -- (-2633.544) [-2627.598] (-2631.047) (-2622.641) * (-2635.046) [-2622.954] (-2622.404) (-2627.655) -- 0:03:02
      552000 -- (-2628.995) [-2619.745] (-2638.540) (-2629.886) * (-2641.505) (-2629.017) [-2625.166] (-2633.202) -- 0:03:01
      552500 -- (-2632.753) (-2623.341) [-2633.025] (-2625.088) * (-2621.936) (-2623.652) (-2626.844) [-2636.734] -- 0:03:02
      553000 -- [-2622.860] (-2631.483) (-2634.287) (-2641.584) * (-2627.304) [-2626.092] (-2627.307) (-2636.223) -- 0:03:01
      553500 -- [-2625.832] (-2623.957) (-2629.956) (-2628.263) * (-2623.199) (-2633.686) [-2623.065] (-2632.476) -- 0:03:01
      554000 -- (-2630.931) [-2623.067] (-2627.187) (-2623.984) * (-2632.226) (-2630.700) [-2625.551] (-2629.445) -- 0:03:01
      554500 -- (-2627.448) (-2618.810) (-2624.914) [-2622.093] * (-2628.820) (-2628.472) [-2621.725] (-2629.566) -- 0:03:00
      555000 -- (-2631.529) [-2626.649] (-2622.710) (-2627.278) * (-2621.647) (-2633.463) (-2622.693) [-2631.334] -- 0:03:01

      Average standard deviation of split frequencies: 0.000339

      555500 -- (-2629.143) [-2621.319] (-2622.459) (-2634.923) * (-2628.587) (-2626.139) (-2627.884) [-2623.418] -- 0:03:00
      556000 -- (-2625.581) (-2629.081) [-2623.572] (-2624.532) * [-2630.444] (-2636.075) (-2624.736) (-2633.494) -- 0:03:00
      556500 -- (-2620.047) (-2623.978) [-2624.529] (-2622.380) * (-2627.082) (-2627.003) [-2620.383] (-2627.225) -- 0:03:00
      557000 -- (-2629.125) (-2627.663) (-2624.889) [-2624.299] * (-2631.848) (-2620.955) [-2618.176] (-2628.269) -- 0:02:59
      557500 -- (-2633.261) (-2619.668) [-2622.344] (-2630.814) * (-2626.274) [-2623.366] (-2628.577) (-2632.621) -- 0:03:00
      558000 -- (-2626.352) [-2623.797] (-2627.976) (-2632.888) * (-2627.349) (-2624.410) (-2627.906) [-2626.194] -- 0:02:59
      558500 -- (-2622.333) (-2625.490) [-2619.915] (-2624.134) * (-2626.330) (-2633.832) [-2625.095] (-2630.491) -- 0:02:59
      559000 -- (-2630.927) (-2622.946) (-2625.709) [-2624.672] * (-2632.748) (-2625.329) (-2619.824) [-2628.501] -- 0:02:59
      559500 -- [-2631.798] (-2625.895) (-2619.450) (-2622.127) * (-2628.558) (-2623.265) [-2621.654] (-2625.251) -- 0:02:58
      560000 -- [-2619.381] (-2630.817) (-2629.150) (-2624.035) * (-2632.727) (-2631.982) [-2626.506] (-2620.988) -- 0:02:59

      Average standard deviation of split frequencies: 0.000336

      560500 -- [-2620.455] (-2636.827) (-2629.314) (-2626.229) * (-2629.059) [-2625.077] (-2628.949) (-2629.044) -- 0:02:58
      561000 -- (-2622.359) (-2627.827) [-2623.849] (-2628.305) * (-2625.960) (-2625.982) [-2623.925] (-2634.726) -- 0:02:58
      561500 -- (-2642.356) (-2627.020) (-2630.284) [-2621.485] * (-2626.206) (-2626.398) [-2630.400] (-2625.595) -- 0:02:58
      562000 -- (-2642.087) [-2625.522] (-2623.613) (-2621.383) * (-2624.957) [-2625.609] (-2627.280) (-2626.855) -- 0:02:57
      562500 -- (-2626.867) [-2623.420] (-2634.637) (-2623.602) * (-2626.778) [-2632.330] (-2628.597) (-2626.046) -- 0:02:58
      563000 -- [-2627.925] (-2625.815) (-2627.583) (-2630.508) * (-2625.890) (-2626.594) (-2626.841) [-2624.927] -- 0:02:57
      563500 -- [-2622.116] (-2627.032) (-2620.634) (-2621.393) * (-2626.980) [-2624.622] (-2625.706) (-2624.537) -- 0:02:57
      564000 -- [-2619.364] (-2626.621) (-2626.912) (-2624.351) * (-2629.272) (-2631.533) (-2627.117) [-2625.397] -- 0:02:57
      564500 -- (-2623.693) (-2624.052) (-2620.562) [-2621.331] * (-2626.393) (-2623.502) (-2626.268) [-2628.849] -- 0:02:56
      565000 -- (-2622.720) (-2624.620) (-2632.988) [-2626.605] * (-2628.770) (-2617.124) [-2628.169] (-2621.484) -- 0:02:57

      Average standard deviation of split frequencies: 0.000333

      565500 -- [-2621.394] (-2629.056) (-2625.809) (-2622.651) * [-2626.840] (-2635.293) (-2632.616) (-2627.137) -- 0:02:56
      566000 -- (-2621.886) (-2625.426) (-2625.408) [-2629.669] * (-2630.961) (-2629.461) (-2627.747) [-2625.554] -- 0:02:56
      566500 -- (-2623.705) (-2631.189) [-2620.656] (-2626.041) * (-2626.042) (-2622.151) (-2624.158) [-2624.560] -- 0:02:56
      567000 -- [-2628.003] (-2635.196) (-2623.470) (-2635.106) * [-2625.164] (-2632.649) (-2623.290) (-2622.007) -- 0:02:55
      567500 -- [-2624.636] (-2625.162) (-2623.118) (-2633.387) * (-2626.630) (-2629.132) [-2627.128] (-2626.314) -- 0:02:56
      568000 -- (-2631.575) (-2627.314) (-2622.524) [-2634.303] * [-2622.310] (-2626.866) (-2625.272) (-2624.747) -- 0:02:55
      568500 -- (-2626.814) [-2622.705] (-2630.272) (-2634.349) * (-2629.142) (-2632.347) [-2625.117] (-2631.067) -- 0:02:55
      569000 -- (-2634.399) (-2624.244) [-2627.927] (-2633.829) * (-2621.887) (-2627.970) (-2625.542) [-2623.700] -- 0:02:54
      569500 -- [-2626.465] (-2627.055) (-2630.030) (-2628.988) * (-2622.748) (-2626.218) (-2622.422) [-2625.398] -- 0:02:54
      570000 -- (-2630.294) (-2628.137) (-2621.564) [-2622.814] * [-2623.561] (-2629.346) (-2626.755) (-2631.449) -- 0:02:55

      Average standard deviation of split frequencies: 0.000330

      570500 -- (-2625.191) (-2634.470) [-2627.700] (-2627.549) * [-2622.017] (-2622.284) (-2630.359) (-2635.100) -- 0:02:54
      571000 -- (-2629.620) [-2626.620] (-2626.009) (-2625.610) * (-2639.362) (-2623.573) (-2625.935) [-2623.554] -- 0:02:54
      571500 -- (-2631.927) (-2632.200) [-2624.431] (-2623.547) * (-2627.411) (-2629.351) (-2625.085) [-2629.610] -- 0:02:53
      572000 -- (-2635.182) [-2627.104] (-2628.046) (-2625.627) * (-2632.427) [-2622.501] (-2634.868) (-2626.807) -- 0:02:54
      572500 -- [-2633.017] (-2620.307) (-2622.668) (-2631.566) * [-2622.627] (-2628.174) (-2628.011) (-2635.324) -- 0:02:53
      573000 -- (-2625.910) (-2627.094) [-2624.377] (-2627.881) * (-2621.830) [-2622.500] (-2624.715) (-2625.986) -- 0:02:53
      573500 -- (-2622.591) [-2622.516] (-2625.708) (-2633.266) * (-2624.332) (-2634.139) [-2624.100] (-2630.785) -- 0:02:53
      574000 -- [-2621.935] (-2627.071) (-2624.065) (-2624.636) * [-2624.284] (-2634.541) (-2621.601) (-2636.207) -- 0:02:52
      574500 -- (-2625.017) [-2626.392] (-2628.333) (-2624.152) * (-2630.817) [-2628.418] (-2622.881) (-2632.450) -- 0:02:53
      575000 -- (-2624.788) (-2623.948) [-2626.521] (-2630.126) * [-2629.220] (-2630.314) (-2626.967) (-2630.939) -- 0:02:52

      Average standard deviation of split frequencies: 0.000327

      575500 -- (-2625.354) (-2624.978) [-2625.655] (-2620.262) * (-2628.375) (-2629.218) [-2627.147] (-2634.620) -- 0:02:52
      576000 -- (-2624.249) [-2627.453] (-2620.695) (-2621.369) * [-2625.075] (-2640.582) (-2627.791) (-2634.955) -- 0:02:52
      576500 -- (-2635.077) (-2626.808) (-2637.755) [-2630.707] * [-2620.543] (-2640.097) (-2623.745) (-2633.551) -- 0:02:51
      577000 -- [-2625.870] (-2625.577) (-2629.180) (-2628.314) * [-2621.192] (-2627.581) (-2624.513) (-2623.230) -- 0:02:52
      577500 -- (-2630.956) [-2626.150] (-2623.073) (-2633.089) * [-2628.045] (-2626.743) (-2628.057) (-2626.399) -- 0:02:51
      578000 -- [-2623.202] (-2629.979) (-2631.497) (-2626.152) * (-2623.994) [-2631.300] (-2625.382) (-2625.162) -- 0:02:51
      578500 -- (-2621.754) (-2630.314) [-2621.771] (-2627.813) * [-2625.056] (-2628.999) (-2628.652) (-2626.321) -- 0:02:51
      579000 -- (-2635.839) (-2625.160) [-2626.702] (-2627.404) * (-2631.824) [-2628.516] (-2629.348) (-2621.478) -- 0:02:50
      579500 -- (-2627.998) (-2624.214) [-2628.299] (-2624.695) * (-2628.662) [-2627.612] (-2626.656) (-2622.831) -- 0:02:51
      580000 -- (-2631.858) (-2621.742) [-2626.950] (-2635.050) * (-2635.404) (-2630.034) [-2633.529] (-2629.583) -- 0:02:50

      Average standard deviation of split frequencies: 0.000325

      580500 -- [-2629.181] (-2631.049) (-2619.323) (-2636.417) * (-2628.832) [-2624.974] (-2629.412) (-2628.966) -- 0:02:50
      581000 -- (-2627.119) (-2634.102) (-2627.156) [-2633.445] * (-2629.478) [-2625.005] (-2626.207) (-2625.587) -- 0:02:50
      581500 -- [-2629.455] (-2628.753) (-2626.737) (-2628.506) * [-2629.723] (-2626.813) (-2626.381) (-2636.212) -- 0:02:49
      582000 -- (-2630.584) [-2622.196] (-2628.307) (-2633.909) * (-2623.740) (-2629.242) [-2621.672] (-2641.162) -- 0:02:50
      582500 -- [-2635.640] (-2629.247) (-2630.667) (-2636.876) * (-2626.506) (-2621.860) [-2624.600] (-2636.669) -- 0:02:49
      583000 -- [-2629.097] (-2624.053) (-2628.871) (-2627.329) * (-2621.310) (-2620.149) (-2624.226) [-2626.015] -- 0:02:49
      583500 -- [-2623.370] (-2627.099) (-2623.012) (-2633.282) * (-2626.328) (-2632.973) (-2633.298) [-2636.298] -- 0:02:49
      584000 -- (-2628.985) [-2625.225] (-2628.898) (-2629.031) * [-2627.889] (-2633.170) (-2628.044) (-2629.897) -- 0:02:48
      584500 -- (-2627.677) [-2624.097] (-2629.420) (-2629.910) * [-2624.428] (-2624.373) (-2620.028) (-2626.693) -- 0:02:49
      585000 -- [-2626.299] (-2626.427) (-2629.804) (-2625.747) * (-2628.067) (-2633.320) (-2623.224) [-2622.053] -- 0:02:48

      Average standard deviation of split frequencies: 0.000322

      585500 -- (-2626.792) (-2637.872) (-2624.653) [-2625.741] * [-2621.847] (-2621.399) (-2626.685) (-2627.493) -- 0:02:48
      586000 -- (-2619.211) [-2625.467] (-2625.938) (-2637.290) * (-2626.033) (-2627.322) [-2634.326] (-2620.734) -- 0:02:48
      586500 -- [-2619.293] (-2635.013) (-2625.473) (-2633.725) * (-2633.695) (-2631.513) [-2623.227] (-2626.297) -- 0:02:47
      587000 -- (-2625.120) [-2634.166] (-2626.103) (-2629.561) * (-2623.073) [-2623.907] (-2629.709) (-2630.113) -- 0:02:48
      587500 -- [-2629.974] (-2635.067) (-2634.056) (-2630.109) * [-2626.066] (-2627.786) (-2629.323) (-2634.040) -- 0:02:47
      588000 -- (-2634.817) (-2630.089) [-2621.999] (-2630.448) * (-2630.562) (-2626.654) [-2628.126] (-2631.524) -- 0:02:47
      588500 -- (-2622.826) (-2630.238) [-2624.392] (-2623.375) * (-2629.068) [-2622.662] (-2624.289) (-2626.782) -- 0:02:47
      589000 -- (-2636.593) (-2626.177) [-2625.780] (-2633.137) * (-2622.372) [-2629.585] (-2629.541) (-2632.459) -- 0:02:46
      589500 -- (-2627.940) (-2628.365) (-2626.635) [-2620.864] * (-2626.226) (-2621.391) (-2629.642) [-2631.862] -- 0:02:47
      590000 -- (-2625.423) [-2627.642] (-2628.870) (-2624.404) * [-2621.940] (-2632.700) (-2625.780) (-2634.040) -- 0:02:46

      Average standard deviation of split frequencies: 0.000319

      590500 -- [-2620.017] (-2630.099) (-2623.460) (-2622.389) * (-2626.277) [-2625.926] (-2631.334) (-2628.394) -- 0:02:46
      591000 -- [-2624.831] (-2633.478) (-2620.500) (-2625.563) * (-2625.532) (-2631.578) [-2619.516] (-2625.377) -- 0:02:46
      591500 -- (-2629.573) (-2633.568) [-2623.859] (-2623.519) * (-2624.248) [-2628.343] (-2623.178) (-2626.256) -- 0:02:45
      592000 -- (-2634.204) [-2623.566] (-2626.214) (-2627.016) * (-2632.234) (-2631.608) [-2623.038] (-2628.459) -- 0:02:46
      592500 -- (-2630.230) [-2626.235] (-2631.479) (-2635.619) * (-2633.250) (-2620.245) (-2620.334) [-2625.493] -- 0:02:45
      593000 -- [-2622.570] (-2630.177) (-2630.303) (-2631.538) * (-2626.667) (-2626.926) (-2621.584) [-2631.986] -- 0:02:45
      593500 -- (-2626.747) (-2620.795) [-2631.914] (-2630.993) * (-2627.935) (-2627.609) (-2622.159) [-2631.757] -- 0:02:45
      594000 -- [-2633.943] (-2623.033) (-2629.652) (-2628.931) * (-2624.324) (-2633.271) (-2627.675) [-2628.743] -- 0:02:44
      594500 -- (-2630.745) (-2620.766) (-2627.184) [-2623.232] * (-2634.420) (-2628.634) [-2624.640] (-2628.078) -- 0:02:45
      595000 -- (-2625.918) (-2627.379) [-2628.723] (-2624.626) * (-2622.996) [-2624.868] (-2620.860) (-2630.145) -- 0:02:44

      Average standard deviation of split frequencies: 0.000316

      595500 -- (-2625.105) (-2626.370) [-2626.039] (-2629.632) * [-2622.238] (-2630.163) (-2626.179) (-2624.141) -- 0:02:44
      596000 -- (-2625.574) (-2627.209) [-2621.233] (-2627.876) * (-2628.319) [-2628.225] (-2626.290) (-2624.587) -- 0:02:44
      596500 -- (-2623.259) (-2620.021) (-2626.059) [-2624.318] * (-2631.946) [-2621.318] (-2633.756) (-2623.068) -- 0:02:44
      597000 -- (-2622.587) (-2624.566) (-2627.596) [-2620.474] * [-2629.339] (-2620.636) (-2634.523) (-2625.011) -- 0:02:44
      597500 -- (-2621.733) (-2627.276) (-2623.726) [-2619.544] * (-2637.342) (-2626.484) (-2630.364) [-2625.570] -- 0:02:43
      598000 -- [-2621.153] (-2624.436) (-2621.982) (-2628.289) * (-2629.835) [-2624.161] (-2629.354) (-2625.274) -- 0:02:43
      598500 -- (-2624.736) (-2625.372) [-2625.129] (-2628.684) * [-2625.308] (-2628.322) (-2622.441) (-2634.764) -- 0:02:43
      599000 -- [-2622.611] (-2622.153) (-2625.092) (-2626.375) * (-2626.745) (-2637.529) (-2636.447) [-2629.726] -- 0:02:43
      599500 -- (-2625.523) (-2625.794) (-2627.021) [-2626.028] * (-2630.379) [-2628.632] (-2633.297) (-2621.006) -- 0:02:43
      600000 -- (-2619.635) [-2624.388] (-2627.218) (-2624.233) * (-2631.307) (-2630.420) (-2624.192) [-2633.016] -- 0:02:42

      Average standard deviation of split frequencies: 0.000314

      600500 -- (-2631.799) [-2626.228] (-2631.177) (-2629.006) * (-2623.684) (-2628.281) [-2623.518] (-2632.955) -- 0:02:42
      601000 -- (-2623.839) (-2630.515) (-2628.165) [-2629.881] * [-2621.570] (-2621.002) (-2627.139) (-2623.852) -- 0:02:41
      601500 -- (-2630.836) (-2630.058) (-2624.451) [-2628.662] * [-2625.168] (-2630.674) (-2624.909) (-2627.778) -- 0:02:42
      602000 -- (-2626.801) [-2623.994] (-2627.609) (-2625.766) * [-2622.148] (-2625.050) (-2627.511) (-2628.708) -- 0:02:41
      602500 -- (-2622.483) (-2630.725) (-2626.270) [-2624.670] * [-2624.616] (-2627.968) (-2624.188) (-2626.392) -- 0:02:41
      603000 -- [-2630.672] (-2631.262) (-2625.220) (-2623.378) * (-2624.344) (-2634.557) [-2624.322] (-2628.259) -- 0:02:41
      603500 -- (-2627.793) (-2629.207) (-2623.556) [-2622.162] * (-2625.522) (-2626.976) [-2621.895] (-2645.954) -- 0:02:40
      604000 -- (-2621.734) [-2620.055] (-2621.904) (-2634.489) * [-2622.526] (-2625.932) (-2621.605) (-2630.682) -- 0:02:41
      604500 -- (-2637.201) [-2617.296] (-2626.917) (-2630.556) * (-2630.476) [-2626.196] (-2627.525) (-2628.334) -- 0:02:40
      605000 -- (-2629.319) (-2624.207) (-2632.967) [-2625.085] * (-2625.640) (-2626.314) [-2630.248] (-2623.356) -- 0:02:40

      Average standard deviation of split frequencies: 0.000311

      605500 -- [-2622.745] (-2631.635) (-2633.987) (-2631.179) * (-2620.985) (-2643.199) (-2625.200) [-2623.273] -- 0:02:40
      606000 -- (-2635.484) [-2623.556] (-2626.803) (-2630.610) * (-2624.914) [-2624.187] (-2623.887) (-2627.404) -- 0:02:39
      606500 -- (-2629.952) [-2623.548] (-2628.387) (-2642.878) * (-2632.973) (-2626.940) (-2625.679) [-2626.370] -- 0:02:40
      607000 -- (-2625.578) [-2620.979] (-2624.715) (-2630.120) * (-2637.083) [-2630.215] (-2626.084) (-2627.355) -- 0:02:39
      607500 -- (-2627.515) (-2629.362) (-2628.965) [-2620.606] * [-2623.431] (-2630.039) (-2620.555) (-2627.283) -- 0:02:39
      608000 -- (-2629.633) (-2625.076) (-2627.146) [-2626.588] * (-2629.981) [-2629.427] (-2621.102) (-2627.240) -- 0:02:39
      608500 -- (-2634.731) (-2624.166) [-2629.042] (-2621.382) * (-2628.558) (-2621.766) (-2627.687) [-2625.933] -- 0:02:38
      609000 -- (-2623.684) [-2619.843] (-2629.360) (-2629.234) * (-2630.113) [-2628.036] (-2628.420) (-2632.339) -- 0:02:39
      609500 -- (-2632.568) (-2624.630) [-2623.418] (-2629.215) * (-2622.029) (-2635.456) [-2623.695] (-2626.444) -- 0:02:38
      610000 -- [-2620.783] (-2626.533) (-2623.371) (-2620.089) * [-2623.863] (-2625.776) (-2621.094) (-2631.355) -- 0:02:38

      Average standard deviation of split frequencies: 0.000309

      610500 -- (-2623.646) [-2627.036] (-2624.842) (-2621.386) * (-2627.192) (-2630.922) (-2623.201) [-2627.415] -- 0:02:38
      611000 -- [-2623.716] (-2629.545) (-2626.798) (-2620.247) * (-2624.091) (-2629.961) [-2628.020] (-2628.003) -- 0:02:37
      611500 -- (-2622.417) (-2627.272) [-2632.942] (-2634.687) * [-2621.225] (-2633.185) (-2631.881) (-2631.243) -- 0:02:38
      612000 -- (-2628.213) [-2620.142] (-2631.862) (-2623.267) * [-2624.150] (-2626.234) (-2632.388) (-2625.485) -- 0:02:37
      612500 -- (-2626.149) (-2623.593) (-2627.463) [-2623.240] * (-2624.901) [-2620.162] (-2639.524) (-2621.676) -- 0:02:37
      613000 -- [-2626.214] (-2626.745) (-2624.104) (-2627.069) * [-2621.325] (-2628.976) (-2632.941) (-2634.630) -- 0:02:37
      613500 -- (-2626.771) (-2627.784) [-2625.786] (-2631.726) * [-2630.500] (-2627.024) (-2621.239) (-2622.896) -- 0:02:36
      614000 -- (-2620.807) (-2622.224) [-2625.475] (-2622.853) * (-2628.985) (-2620.676) (-2631.260) [-2621.779] -- 0:02:37
      614500 -- (-2628.329) (-2635.267) [-2626.013] (-2627.703) * (-2630.482) (-2628.885) (-2625.798) [-2624.106] -- 0:02:36
      615000 -- (-2631.334) (-2633.331) [-2621.037] (-2623.269) * [-2626.055] (-2626.790) (-2631.112) (-2624.038) -- 0:02:36

      Average standard deviation of split frequencies: 0.000306

      615500 -- (-2630.143) [-2620.185] (-2622.064) (-2627.236) * (-2625.577) (-2625.552) [-2627.037] (-2623.783) -- 0:02:36
      616000 -- (-2627.962) (-2630.698) (-2620.047) [-2619.492] * (-2628.827) [-2628.220] (-2628.507) (-2623.255) -- 0:02:35
      616500 -- (-2628.602) [-2625.603] (-2626.657) (-2631.193) * [-2625.517] (-2624.089) (-2629.398) (-2626.762) -- 0:02:36
      617000 -- [-2626.565] (-2623.298) (-2626.924) (-2623.274) * (-2627.483) [-2620.101] (-2634.564) (-2635.096) -- 0:02:35
      617500 -- (-2628.185) (-2628.654) [-2627.787] (-2624.939) * (-2629.264) (-2625.931) [-2624.015] (-2632.088) -- 0:02:35
      618000 -- (-2623.848) (-2631.867) [-2627.010] (-2632.315) * (-2626.108) (-2626.592) [-2621.462] (-2629.958) -- 0:02:35
      618500 -- [-2628.827] (-2629.250) (-2619.302) (-2621.702) * [-2631.849] (-2630.887) (-2623.759) (-2628.330) -- 0:02:35
      619000 -- (-2625.907) [-2623.844] (-2621.693) (-2626.723) * (-2632.500) [-2626.532] (-2630.604) (-2625.514) -- 0:02:35
      619500 -- [-2624.165] (-2624.196) (-2624.785) (-2631.151) * (-2628.914) [-2622.337] (-2625.274) (-2621.903) -- 0:02:34
      620000 -- (-2622.176) (-2623.876) (-2629.861) [-2621.824] * [-2624.726] (-2625.069) (-2622.750) (-2623.082) -- 0:02:34

      Average standard deviation of split frequencies: 0.000304

      620500 -- (-2624.947) (-2628.857) (-2625.450) [-2635.559] * (-2622.090) [-2627.509] (-2627.737) (-2631.034) -- 0:02:34
      621000 -- (-2627.003) (-2627.832) [-2628.194] (-2628.091) * (-2623.341) (-2632.295) (-2636.541) [-2625.217] -- 0:02:34
      621500 -- (-2634.742) [-2621.038] (-2629.827) (-2623.774) * (-2630.546) [-2623.883] (-2632.076) (-2620.816) -- 0:02:34
      622000 -- (-2624.605) (-2631.046) (-2625.911) [-2621.812] * [-2621.190] (-2632.880) (-2632.335) (-2622.029) -- 0:02:33
      622500 -- (-2636.131) [-2625.055] (-2625.661) (-2625.208) * [-2624.102] (-2620.716) (-2637.509) (-2625.337) -- 0:02:33
      623000 -- [-2625.599] (-2625.033) (-2627.372) (-2627.516) * [-2624.581] (-2624.191) (-2631.330) (-2637.027) -- 0:02:33
      623500 -- [-2625.621] (-2628.600) (-2624.092) (-2626.257) * (-2621.622) (-2628.111) [-2630.009] (-2623.953) -- 0:02:33
      624000 -- (-2624.694) (-2639.420) [-2629.523] (-2624.299) * (-2624.327) (-2624.976) (-2631.920) [-2621.081] -- 0:02:33
      624500 -- (-2635.170) (-2628.504) (-2624.497) [-2622.401] * [-2629.272] (-2633.300) (-2627.058) (-2628.623) -- 0:02:32
      625000 -- [-2623.403] (-2624.883) (-2624.385) (-2626.033) * (-2640.783) [-2621.994] (-2621.452) (-2626.038) -- 0:02:32

      Average standard deviation of split frequencies: 0.000301

      625500 -- (-2629.031) [-2628.250] (-2625.450) (-2626.372) * (-2630.446) [-2630.246] (-2631.232) (-2626.831) -- 0:02:32
      626000 -- [-2621.529] (-2627.348) (-2628.486) (-2628.510) * (-2632.162) [-2629.420] (-2625.526) (-2622.683) -- 0:02:32
      626500 -- (-2624.445) (-2627.124) [-2625.254] (-2628.899) * (-2635.563) (-2630.559) [-2629.350] (-2622.105) -- 0:02:32
      627000 -- (-2622.248) [-2627.399] (-2630.019) (-2625.987) * [-2635.854] (-2621.322) (-2635.858) (-2622.778) -- 0:02:31
      627500 -- (-2625.609) [-2627.555] (-2622.899) (-2634.818) * [-2628.716] (-2619.875) (-2628.928) (-2626.585) -- 0:02:31
      628000 -- (-2628.938) (-2631.642) (-2623.158) [-2624.937] * (-2628.875) [-2629.666] (-2632.966) (-2624.923) -- 0:02:31
      628500 -- (-2627.951) [-2625.195] (-2624.908) (-2628.006) * [-2623.367] (-2623.414) (-2627.513) (-2628.120) -- 0:02:31
      629000 -- [-2624.274] (-2632.121) (-2630.348) (-2622.574) * (-2624.650) [-2620.011] (-2636.943) (-2627.040) -- 0:02:30
      629500 -- (-2624.928) [-2620.836] (-2622.754) (-2622.746) * [-2621.995] (-2622.880) (-2636.384) (-2624.206) -- 0:02:30
      630000 -- (-2629.159) (-2625.722) [-2621.996] (-2626.051) * (-2642.957) (-2626.071) [-2634.465] (-2630.553) -- 0:02:30

      Average standard deviation of split frequencies: 0.000299

      630500 -- (-2619.680) [-2629.459] (-2624.441) (-2619.791) * (-2629.728) [-2625.423] (-2627.542) (-2620.319) -- 0:02:30
      631000 -- (-2624.687) (-2629.612) [-2628.467] (-2629.381) * (-2636.833) [-2625.122] (-2628.040) (-2621.724) -- 0:02:30
      631500 -- (-2623.566) (-2622.502) (-2632.119) [-2622.733] * (-2628.648) (-2624.100) [-2625.377] (-2630.425) -- 0:02:29
      632000 -- (-2630.099) [-2620.052] (-2630.358) (-2625.289) * (-2633.047) [-2622.533] (-2624.237) (-2626.773) -- 0:02:29
      632500 -- (-2623.159) (-2626.845) [-2624.694] (-2627.911) * (-2633.429) [-2622.793] (-2627.740) (-2623.291) -- 0:02:29
      633000 -- [-2622.152] (-2625.360) (-2627.744) (-2627.571) * (-2628.936) (-2637.750) (-2625.527) [-2623.927] -- 0:02:29
      633500 -- (-2633.182) (-2627.160) (-2630.766) [-2628.906] * (-2632.912) [-2623.011] (-2627.903) (-2624.969) -- 0:02:29
      634000 -- [-2633.083] (-2623.029) (-2629.468) (-2629.233) * (-2622.776) [-2622.696] (-2632.115) (-2625.494) -- 0:02:28
      634500 -- (-2626.976) [-2621.256] (-2624.439) (-2621.281) * [-2627.928] (-2630.529) (-2628.359) (-2631.546) -- 0:02:28
      635000 -- (-2628.535) (-2626.262) [-2625.565] (-2623.566) * (-2631.781) (-2636.664) [-2625.069] (-2633.114) -- 0:02:28

      Average standard deviation of split frequencies: 0.000296

      635500 -- (-2630.452) [-2623.319] (-2621.040) (-2625.388) * (-2631.871) (-2628.755) [-2623.743] (-2622.689) -- 0:02:28
      636000 -- (-2620.446) (-2622.373) [-2622.954] (-2627.998) * [-2624.472] (-2634.091) (-2633.215) (-2627.035) -- 0:02:28
      636500 -- [-2628.376] (-2624.096) (-2622.012) (-2629.725) * (-2625.014) [-2620.914] (-2635.684) (-2622.215) -- 0:02:27
      637000 -- [-2619.302] (-2623.367) (-2621.729) (-2622.963) * (-2626.561) (-2626.003) [-2618.020] (-2629.669) -- 0:02:27
      637500 -- (-2633.308) (-2625.500) [-2623.644] (-2630.898) * (-2627.149) (-2630.615) [-2619.490] (-2628.778) -- 0:02:27
      638000 -- (-2623.219) [-2629.236] (-2622.235) (-2624.871) * [-2628.951] (-2626.195) (-2621.033) (-2626.425) -- 0:02:27
      638500 -- [-2625.255] (-2629.315) (-2626.716) (-2625.023) * (-2629.365) [-2621.694] (-2630.992) (-2621.340) -- 0:02:27
      639000 -- (-2623.629) (-2633.734) (-2633.929) [-2625.669] * (-2621.069) [-2622.860] (-2624.276) (-2625.773) -- 0:02:26
      639500 -- (-2627.681) (-2626.173) (-2630.197) [-2618.770] * (-2624.290) [-2627.052] (-2627.396) (-2623.558) -- 0:02:26
      640000 -- [-2621.956] (-2629.186) (-2628.057) (-2623.800) * (-2622.382) (-2631.450) (-2628.037) [-2622.921] -- 0:02:26

      Average standard deviation of split frequencies: 0.000294

      640500 -- [-2622.537] (-2627.121) (-2625.678) (-2630.004) * (-2627.745) [-2630.311] (-2621.220) (-2624.522) -- 0:02:26
      641000 -- (-2626.115) [-2625.024] (-2625.300) (-2625.459) * (-2622.658) (-2622.760) [-2621.546] (-2625.152) -- 0:02:26
      641500 -- (-2626.938) (-2622.747) [-2631.931] (-2623.598) * (-2625.657) (-2628.450) [-2623.161] (-2619.945) -- 0:02:25
      642000 -- (-2627.438) [-2624.864] (-2630.481) (-2631.189) * (-2628.171) (-2628.039) [-2624.341] (-2623.858) -- 0:02:25
      642500 -- (-2627.814) [-2626.790] (-2627.991) (-2622.421) * [-2622.187] (-2623.941) (-2621.326) (-2624.625) -- 0:02:25
      643000 -- (-2625.056) [-2623.729] (-2629.631) (-2621.578) * (-2627.835) (-2627.995) [-2618.951] (-2626.758) -- 0:02:25
      643500 -- (-2628.022) [-2629.200] (-2621.549) (-2623.654) * (-2630.617) [-2628.690] (-2623.835) (-2627.523) -- 0:02:25
      644000 -- (-2620.590) [-2627.220] (-2631.518) (-2624.587) * (-2623.994) (-2623.615) (-2622.968) [-2632.884] -- 0:02:24
      644500 -- (-2625.800) [-2627.917] (-2626.907) (-2626.080) * (-2631.657) [-2626.115] (-2635.089) (-2629.241) -- 0:02:24
      645000 -- (-2623.210) (-2622.691) [-2622.707] (-2635.898) * (-2625.034) (-2631.130) [-2628.620] (-2636.572) -- 0:02:24

      Average standard deviation of split frequencies: 0.000292

      645500 -- (-2628.666) (-2632.130) [-2625.164] (-2629.246) * (-2626.291) (-2630.572) (-2626.463) [-2623.266] -- 0:02:24
      646000 -- [-2624.773] (-2620.681) (-2633.373) (-2626.237) * [-2626.686] (-2627.878) (-2627.919) (-2625.756) -- 0:02:24
      646500 -- (-2622.842) (-2626.596) [-2623.392] (-2631.717) * [-2627.562] (-2632.466) (-2628.709) (-2635.378) -- 0:02:23
      647000 -- (-2624.016) (-2625.224) (-2622.973) [-2630.496] * [-2621.032] (-2627.044) (-2625.655) (-2630.922) -- 0:02:23
      647500 -- [-2620.740] (-2622.379) (-2619.800) (-2623.183) * (-2629.785) (-2619.526) (-2627.479) [-2622.788] -- 0:02:23
      648000 -- (-2634.412) [-2620.876] (-2628.920) (-2621.776) * (-2629.667) (-2627.049) [-2622.477] (-2631.511) -- 0:02:23
      648500 -- (-2625.202) (-2622.477) [-2625.216] (-2633.777) * [-2620.947] (-2631.144) (-2624.274) (-2624.211) -- 0:02:23
      649000 -- [-2628.217] (-2626.191) (-2625.465) (-2624.289) * (-2624.076) (-2638.197) (-2623.838) [-2623.532] -- 0:02:22
      649500 -- [-2621.167] (-2627.933) (-2621.940) (-2623.967) * (-2636.839) (-2631.251) [-2624.527] (-2626.203) -- 0:02:22
      650000 -- (-2624.814) (-2627.260) (-2623.387) [-2624.814] * (-2623.397) (-2620.898) (-2630.200) [-2629.068] -- 0:02:22

      Average standard deviation of split frequencies: 0.000290

      650500 -- (-2629.076) (-2629.103) [-2625.742] (-2622.836) * [-2624.707] (-2626.958) (-2626.287) (-2621.006) -- 0:02:22
      651000 -- (-2628.115) (-2630.413) [-2632.799] (-2628.691) * (-2618.580) [-2619.741] (-2626.394) (-2630.450) -- 0:02:22
      651500 -- (-2635.385) (-2625.653) [-2620.132] (-2636.187) * (-2619.589) (-2624.883) (-2629.522) [-2629.320] -- 0:02:21
      652000 -- (-2623.942) (-2637.038) (-2620.039) [-2627.505] * (-2630.651) [-2627.573] (-2623.531) (-2632.383) -- 0:02:21
      652500 -- (-2623.350) [-2627.640] (-2635.756) (-2625.837) * (-2624.309) (-2624.166) (-2629.228) [-2630.294] -- 0:02:21
      653000 -- [-2622.305] (-2627.529) (-2624.915) (-2632.199) * (-2623.245) [-2625.056] (-2629.725) (-2632.602) -- 0:02:21
      653500 -- (-2625.654) (-2638.931) (-2621.053) [-2631.753] * (-2632.908) (-2629.868) (-2626.053) [-2629.203] -- 0:02:21
      654000 -- [-2625.328] (-2627.445) (-2622.478) (-2630.992) * (-2631.607) (-2619.987) (-2623.355) [-2635.485] -- 0:02:20
      654500 -- (-2630.157) (-2632.652) (-2629.590) [-2622.627] * (-2629.382) [-2619.596] (-2624.497) (-2629.226) -- 0:02:20
      655000 -- (-2623.720) (-2627.816) (-2622.518) [-2619.094] * (-2627.736) (-2619.816) [-2628.158] (-2638.265) -- 0:02:20

      Average standard deviation of split frequencies: 0.000287

      655500 -- [-2625.556] (-2625.541) (-2640.532) (-2622.459) * [-2624.768] (-2631.691) (-2624.938) (-2622.792) -- 0:02:20
      656000 -- (-2627.911) (-2631.366) (-2638.834) [-2625.286] * (-2628.892) [-2627.269] (-2624.327) (-2620.892) -- 0:02:20
      656500 -- (-2628.344) (-2630.789) (-2628.865) [-2633.683] * (-2628.160) (-2627.605) [-2624.018] (-2630.666) -- 0:02:19
      657000 -- (-2625.686) (-2626.185) (-2631.075) [-2628.135] * [-2631.395] (-2625.771) (-2629.028) (-2625.961) -- 0:02:19
      657500 -- (-2630.197) [-2617.934] (-2629.908) (-2627.320) * (-2631.217) [-2627.843] (-2628.326) (-2627.904) -- 0:02:19
      658000 -- [-2620.064] (-2623.950) (-2622.050) (-2619.801) * [-2626.237] (-2624.652) (-2639.412) (-2629.239) -- 0:02:19
      658500 -- (-2627.224) [-2619.671] (-2623.427) (-2624.075) * [-2623.970] (-2626.640) (-2629.325) (-2622.539) -- 0:02:18
      659000 -- (-2632.489) [-2624.273] (-2628.484) (-2626.534) * (-2632.583) [-2624.206] (-2638.756) (-2621.522) -- 0:02:18
      659500 -- [-2630.206] (-2625.625) (-2630.156) (-2621.896) * (-2631.649) (-2623.749) [-2619.812] (-2625.679) -- 0:02:18
      660000 -- (-2625.443) (-2629.622) [-2623.013] (-2619.670) * [-2633.032] (-2631.139) (-2618.920) (-2625.471) -- 0:02:18

      Average standard deviation of split frequencies: 0.000285

      660500 -- (-2624.758) (-2625.806) (-2634.624) [-2618.311] * (-2625.606) (-2625.452) (-2626.373) [-2623.028] -- 0:02:18
      661000 -- [-2628.498] (-2628.318) (-2630.332) (-2624.858) * (-2623.810) (-2622.558) (-2637.363) [-2622.009] -- 0:02:17
      661500 -- (-2620.245) (-2624.645) [-2630.843] (-2629.408) * (-2624.109) [-2625.070] (-2628.023) (-2623.190) -- 0:02:17
      662000 -- (-2625.843) [-2623.516] (-2626.060) (-2630.160) * (-2628.865) (-2617.317) (-2627.510) [-2630.364] -- 0:02:17
      662500 -- [-2630.644] (-2627.810) (-2623.168) (-2626.388) * (-2626.227) (-2626.069) [-2628.758] (-2622.950) -- 0:02:17
      663000 -- (-2628.821) (-2631.398) (-2625.031) [-2629.939] * (-2631.155) (-2624.918) (-2626.399) [-2627.375] -- 0:02:17
      663500 -- (-2624.520) (-2626.119) (-2621.699) [-2623.824] * (-2628.356) (-2636.435) [-2626.151] (-2624.962) -- 0:02:16
      664000 -- (-2625.159) [-2622.096] (-2629.702) (-2629.829) * (-2638.784) (-2628.715) (-2623.363) [-2624.003] -- 0:02:16
      664500 -- (-2632.333) (-2627.154) (-2630.080) [-2624.774] * (-2625.871) (-2628.445) (-2620.449) [-2628.524] -- 0:02:16
      665000 -- (-2630.286) (-2625.219) [-2622.797] (-2638.520) * (-2624.433) (-2626.954) (-2628.713) [-2627.331] -- 0:02:16

      Average standard deviation of split frequencies: 0.000283

      665500 -- (-2644.658) [-2619.366] (-2626.245) (-2627.364) * [-2621.388] (-2625.824) (-2620.472) (-2632.257) -- 0:02:16
      666000 -- (-2625.237) [-2626.467] (-2629.531) (-2626.274) * (-2634.335) (-2629.524) [-2632.995] (-2624.771) -- 0:02:15
      666500 -- (-2636.044) [-2629.342] (-2623.095) (-2628.664) * [-2624.047] (-2632.483) (-2633.932) (-2626.972) -- 0:02:15
      667000 -- [-2627.176] (-2630.577) (-2623.948) (-2626.948) * (-2625.360) [-2628.109] (-2626.236) (-2625.050) -- 0:02:15
      667500 -- (-2621.430) (-2633.498) [-2621.483] (-2636.302) * [-2626.933] (-2625.085) (-2626.113) (-2629.580) -- 0:02:14
      668000 -- (-2623.816) (-2635.993) [-2625.144] (-2627.835) * (-2621.241) (-2632.958) [-2625.292] (-2620.770) -- 0:02:15
      668500 -- (-2626.208) (-2639.688) [-2622.017] (-2631.690) * [-2626.073] (-2631.558) (-2636.264) (-2634.704) -- 0:02:14
      669000 -- [-2630.149] (-2633.977) (-2625.392) (-2628.724) * (-2625.360) (-2626.528) (-2626.625) [-2630.452] -- 0:02:14
      669500 -- (-2630.854) (-2629.626) (-2624.461) [-2624.460] * (-2623.385) (-2626.111) (-2633.652) [-2624.855] -- 0:02:14
      670000 -- [-2627.557] (-2626.455) (-2627.786) (-2620.339) * (-2632.363) [-2626.899] (-2627.935) (-2621.471) -- 0:02:14

      Average standard deviation of split frequencies: 0.000281

      670500 -- [-2624.249] (-2625.839) (-2627.076) (-2620.942) * (-2631.808) (-2628.547) [-2625.740] (-2621.965) -- 0:02:14
      671000 -- (-2638.904) (-2630.144) (-2634.051) [-2626.155] * (-2622.494) (-2622.908) (-2621.055) [-2630.125] -- 0:02:13
      671500 -- (-2629.355) (-2624.564) (-2632.267) [-2621.744] * (-2621.842) [-2623.421] (-2629.131) (-2630.556) -- 0:02:13
      672000 -- (-2624.354) [-2624.972] (-2625.689) (-2629.343) * (-2628.685) [-2623.303] (-2628.092) (-2629.905) -- 0:02:13
      672500 -- (-2624.757) (-2625.692) (-2631.846) [-2622.298] * [-2619.883] (-2626.184) (-2636.374) (-2627.869) -- 0:02:13
      673000 -- (-2630.228) (-2625.006) [-2628.555] (-2626.870) * [-2627.347] (-2622.904) (-2635.301) (-2630.713) -- 0:02:13
      673500 -- (-2633.251) (-2627.408) [-2625.560] (-2630.084) * (-2647.514) (-2622.909) [-2628.776] (-2628.813) -- 0:02:12
      674000 -- (-2621.918) (-2623.789) [-2622.030] (-2623.105) * (-2631.767) (-2628.756) (-2628.422) [-2627.804] -- 0:02:12
      674500 -- (-2634.442) [-2628.365] (-2630.451) (-2620.914) * (-2629.173) [-2622.687] (-2629.783) (-2628.457) -- 0:02:12
      675000 -- (-2627.142) (-2631.131) (-2626.360) [-2625.722] * (-2631.804) (-2623.174) (-2638.172) [-2626.164] -- 0:02:12

      Average standard deviation of split frequencies: 0.000279

      675500 -- (-2633.142) (-2628.885) [-2629.516] (-2626.256) * [-2627.927] (-2625.073) (-2634.430) (-2624.299) -- 0:02:12
      676000 -- (-2624.069) [-2630.069] (-2629.803) (-2629.838) * (-2638.264) [-2629.597] (-2623.335) (-2624.082) -- 0:02:11
      676500 -- (-2627.008) (-2629.679) (-2632.018) [-2626.620] * (-2621.599) [-2622.402] (-2630.386) (-2629.889) -- 0:02:11
      677000 -- (-2629.165) (-2629.031) [-2624.520] (-2622.837) * (-2635.326) (-2624.623) [-2625.253] (-2625.040) -- 0:02:11
      677500 -- [-2624.861] (-2620.201) (-2622.210) (-2625.148) * (-2629.087) (-2621.143) (-2630.976) [-2630.355] -- 0:02:11
      678000 -- (-2626.977) [-2625.512] (-2622.694) (-2626.328) * (-2633.908) [-2629.893] (-2624.566) (-2628.342) -- 0:02:11
      678500 -- (-2635.493) (-2636.521) (-2637.130) [-2626.642] * (-2628.174) (-2624.106) [-2633.374] (-2629.632) -- 0:02:10
      679000 -- [-2623.144] (-2634.508) (-2628.144) (-2631.231) * [-2625.200] (-2623.440) (-2625.780) (-2625.334) -- 0:02:10
      679500 -- (-2633.765) [-2625.325] (-2629.856) (-2627.753) * [-2620.128] (-2630.943) (-2627.270) (-2632.242) -- 0:02:10
      680000 -- (-2625.499) (-2621.757) [-2628.087] (-2624.017) * (-2630.117) (-2628.229) (-2622.939) [-2626.750] -- 0:02:10

      Average standard deviation of split frequencies: 0.000277

      680500 -- (-2627.202) [-2629.987] (-2623.571) (-2635.226) * (-2634.405) (-2632.548) (-2623.714) [-2623.710] -- 0:02:10
      681000 -- (-2635.371) [-2630.784] (-2628.047) (-2624.651) * (-2628.510) [-2620.818] (-2629.933) (-2626.334) -- 0:02:09
      681500 -- (-2618.121) (-2628.839) (-2627.904) [-2630.452] * (-2635.646) [-2628.152] (-2626.799) (-2629.418) -- 0:02:09
      682000 -- (-2618.265) (-2633.159) [-2627.499] (-2630.810) * (-2630.646) (-2627.940) (-2638.424) [-2625.506] -- 0:02:09
      682500 -- (-2629.349) (-2625.221) [-2627.944] (-2626.043) * (-2633.508) (-2630.340) [-2621.370] (-2625.793) -- 0:02:09
      683000 -- (-2630.631) (-2623.470) [-2627.917] (-2624.975) * (-2625.558) (-2632.642) [-2628.416] (-2629.194) -- 0:02:09
      683500 -- [-2626.231] (-2630.142) (-2627.864) (-2626.582) * (-2626.658) (-2631.050) [-2618.938] (-2628.874) -- 0:02:08
      684000 -- (-2625.381) [-2620.949] (-2627.758) (-2629.425) * [-2622.009] (-2623.380) (-2624.529) (-2629.422) -- 0:02:08
      684500 -- (-2630.043) (-2625.683) (-2621.731) [-2621.872] * [-2627.643] (-2630.746) (-2627.201) (-2635.499) -- 0:02:08
      685000 -- (-2622.786) [-2622.008] (-2625.672) (-2624.741) * (-2633.555) [-2630.352] (-2620.586) (-2626.228) -- 0:02:08

      Average standard deviation of split frequencies: 0.000275

      685500 -- (-2624.926) (-2627.648) [-2620.599] (-2628.049) * (-2628.009) [-2625.475] (-2625.036) (-2631.131) -- 0:02:08
      686000 -- (-2632.216) (-2626.247) (-2627.496) [-2619.317] * (-2624.321) (-2629.143) (-2625.046) [-2628.219] -- 0:02:07
      686500 -- [-2624.209] (-2626.926) (-2625.898) (-2628.449) * (-2627.515) (-2629.493) [-2621.036] (-2630.166) -- 0:02:07
      687000 -- (-2627.005) (-2631.204) (-2622.148) [-2627.407] * (-2629.098) (-2626.696) (-2627.886) [-2621.828] -- 0:02:07
      687500 -- [-2617.717] (-2627.177) (-2622.857) (-2624.664) * (-2625.356) (-2626.362) [-2623.057] (-2628.963) -- 0:02:07
      688000 -- (-2630.769) [-2628.080] (-2627.803) (-2624.592) * (-2627.519) (-2620.946) [-2625.428] (-2628.657) -- 0:02:06
      688500 -- [-2629.649] (-2628.418) (-2628.045) (-2630.560) * [-2624.711] (-2628.880) (-2625.945) (-2625.228) -- 0:02:06
      689000 -- (-2624.314) (-2631.865) (-2624.167) [-2630.398] * (-2621.372) (-2627.574) [-2626.537] (-2626.419) -- 0:02:06
      689500 -- (-2623.736) (-2629.231) (-2621.295) [-2628.081] * (-2622.253) [-2622.060] (-2626.221) (-2624.661) -- 0:02:06
      690000 -- (-2624.555) (-2626.440) [-2624.721] (-2622.779) * [-2622.130] (-2627.276) (-2631.325) (-2628.808) -- 0:02:06

      Average standard deviation of split frequencies: 0.000273

      690500 -- (-2624.935) (-2622.201) [-2629.652] (-2626.306) * [-2627.700] (-2627.585) (-2624.743) (-2631.187) -- 0:02:05
      691000 -- [-2620.834] (-2627.965) (-2625.371) (-2629.220) * (-2623.037) (-2628.130) [-2626.161] (-2629.598) -- 0:02:05
      691500 -- (-2630.556) (-2624.032) [-2626.237] (-2627.344) * [-2622.726] (-2630.857) (-2623.330) (-2630.567) -- 0:02:05
      692000 -- (-2628.263) [-2621.094] (-2629.313) (-2628.857) * (-2624.662) (-2633.870) [-2619.322] (-2620.199) -- 0:02:05
      692500 -- (-2638.165) (-2625.306) [-2625.992] (-2627.273) * (-2628.520) (-2638.211) [-2620.683] (-2634.240) -- 0:02:05
      693000 -- (-2629.842) [-2627.437] (-2632.138) (-2629.389) * (-2630.570) [-2625.130] (-2624.881) (-2640.671) -- 0:02:04
      693500 -- (-2626.288) (-2629.741) (-2619.752) [-2621.880] * (-2619.985) (-2624.053) [-2633.216] (-2631.700) -- 0:02:04
      694000 -- [-2627.720] (-2624.788) (-2618.046) (-2636.091) * (-2625.081) [-2620.038] (-2622.948) (-2627.642) -- 0:02:04
      694500 -- (-2633.338) (-2624.716) [-2625.875] (-2630.149) * (-2634.050) (-2623.118) (-2628.263) [-2632.137] -- 0:02:04
      695000 -- (-2628.380) (-2623.034) [-2624.500] (-2629.311) * [-2628.429] (-2632.545) (-2637.212) (-2630.626) -- 0:02:04

      Average standard deviation of split frequencies: 0.000271

      695500 -- (-2623.309) (-2624.747) [-2628.348] (-2632.787) * (-2627.102) [-2631.444] (-2624.135) (-2628.203) -- 0:02:03
      696000 -- [-2628.616] (-2627.645) (-2628.400) (-2622.490) * (-2625.553) (-2627.055) [-2625.622] (-2634.369) -- 0:02:03
      696500 -- (-2623.465) [-2624.275] (-2623.992) (-2629.103) * (-2634.407) [-2623.179] (-2624.867) (-2623.688) -- 0:02:03
      697000 -- [-2623.184] (-2624.576) (-2630.044) (-2631.092) * (-2619.754) [-2624.540] (-2631.060) (-2625.855) -- 0:02:03
      697500 -- (-2625.316) (-2625.685) (-2625.577) [-2625.077] * (-2630.792) [-2623.829] (-2622.842) (-2630.087) -- 0:02:03
      698000 -- [-2623.721] (-2633.985) (-2623.433) (-2619.871) * [-2625.998] (-2625.208) (-2627.187) (-2627.160) -- 0:02:02
      698500 -- (-2626.293) (-2625.328) [-2622.905] (-2631.768) * [-2625.206] (-2630.381) (-2626.079) (-2621.664) -- 0:02:02
      699000 -- [-2626.692] (-2623.643) (-2635.232) (-2631.798) * [-2623.322] (-2628.126) (-2627.942) (-2622.234) -- 0:02:02
      699500 -- (-2623.878) [-2635.925] (-2630.711) (-2629.308) * [-2627.303] (-2625.977) (-2628.295) (-2635.937) -- 0:02:02
      700000 -- (-2631.255) (-2624.268) [-2631.209] (-2628.721) * (-2626.761) [-2619.789] (-2623.154) (-2635.677) -- 0:02:02

      Average standard deviation of split frequencies: 0.000269

      700500 -- (-2636.213) [-2627.658] (-2637.472) (-2621.609) * (-2626.876) (-2628.828) [-2623.953] (-2626.234) -- 0:02:01
      701000 -- (-2624.234) (-2628.041) (-2626.115) [-2627.172] * (-2623.174) (-2626.369) (-2633.173) [-2621.944] -- 0:02:01
      701500 -- [-2630.479] (-2625.244) (-2628.968) (-2631.008) * [-2624.402] (-2628.235) (-2633.424) (-2622.217) -- 0:02:01
      702000 -- (-2628.240) (-2624.233) [-2631.055] (-2630.100) * [-2625.122] (-2634.408) (-2626.399) (-2626.383) -- 0:02:01
      702500 -- [-2626.471] (-2623.523) (-2629.087) (-2628.694) * (-2623.906) (-2621.285) (-2633.122) [-2624.917] -- 0:02:01
      703000 -- (-2625.071) (-2626.644) [-2626.860] (-2635.452) * (-2622.768) (-2626.476) (-2631.918) [-2620.708] -- 0:02:00
      703500 -- (-2623.943) [-2627.779] (-2620.998) (-2630.362) * (-2623.306) (-2631.654) (-2627.322) [-2621.644] -- 0:02:00
      704000 -- (-2626.823) [-2624.054] (-2623.542) (-2629.079) * [-2623.795] (-2628.804) (-2626.744) (-2621.239) -- 0:02:00
      704500 -- (-2620.918) [-2627.874] (-2626.548) (-2629.263) * (-2626.212) [-2626.712] (-2634.455) (-2622.799) -- 0:02:00
      705000 -- (-2624.678) (-2622.986) (-2624.473) [-2626.153] * (-2637.871) [-2625.687] (-2624.423) (-2633.499) -- 0:02:00

      Average standard deviation of split frequencies: 0.000267

      705500 -- (-2621.350) (-2627.231) (-2627.208) [-2625.713] * (-2622.184) [-2625.684] (-2625.151) (-2626.390) -- 0:01:59
      706000 -- (-2622.469) (-2624.368) (-2630.951) [-2624.120] * (-2627.335) (-2625.507) (-2637.716) [-2626.565] -- 0:01:59
      706500 -- (-2628.155) (-2626.998) (-2631.403) [-2633.093] * [-2624.847] (-2637.977) (-2629.123) (-2632.372) -- 0:01:59
      707000 -- [-2628.590] (-2625.920) (-2638.904) (-2630.904) * (-2622.211) (-2621.646) [-2624.270] (-2625.275) -- 0:01:59
      707500 -- (-2633.850) (-2619.588) (-2629.642) [-2619.894] * [-2622.007] (-2631.926) (-2625.970) (-2629.063) -- 0:01:59
      708000 -- (-2622.178) [-2624.782] (-2624.797) (-2627.124) * (-2628.000) [-2629.431] (-2629.496) (-2628.424) -- 0:01:58
      708500 -- [-2622.169] (-2624.402) (-2629.247) (-2625.753) * (-2627.828) (-2622.830) [-2622.468] (-2625.434) -- 0:01:58
      709000 -- (-2621.558) (-2630.222) [-2626.650] (-2626.053) * (-2625.897) (-2621.578) (-2620.726) [-2621.540] -- 0:01:58
      709500 -- (-2624.130) (-2627.655) (-2621.062) [-2625.964] * (-2621.790) (-2628.757) [-2622.918] (-2631.367) -- 0:01:58
      710000 -- (-2623.554) (-2635.041) [-2625.617] (-2626.550) * [-2620.209] (-2629.120) (-2629.056) (-2624.093) -- 0:01:58

      Average standard deviation of split frequencies: 0.000265

      710500 -- (-2626.562) (-2632.880) (-2634.257) [-2630.483] * [-2625.879] (-2625.034) (-2633.795) (-2622.844) -- 0:01:57
      711000 -- (-2619.590) (-2629.682) [-2626.101] (-2632.783) * (-2629.388) (-2632.133) (-2627.325) [-2626.663] -- 0:01:57
      711500 -- [-2621.642] (-2630.959) (-2623.587) (-2626.566) * [-2625.643] (-2634.177) (-2624.382) (-2628.171) -- 0:01:57
      712000 -- [-2623.253] (-2632.482) (-2630.746) (-2627.418) * (-2630.681) [-2625.752] (-2623.690) (-2627.379) -- 0:01:57
      712500 -- [-2624.102] (-2626.908) (-2631.103) (-2623.216) * (-2623.670) (-2630.209) [-2626.673] (-2627.214) -- 0:01:57
      713000 -- (-2631.113) (-2627.432) (-2622.978) [-2624.944] * (-2620.141) (-2627.679) (-2629.124) [-2630.645] -- 0:01:56
      713500 -- (-2624.414) (-2625.034) (-2630.363) [-2628.002] * [-2625.723] (-2632.350) (-2632.179) (-2624.119) -- 0:01:56
      714000 -- (-2640.265) (-2625.687) [-2631.249] (-2625.138) * (-2632.811) (-2621.986) (-2624.017) [-2619.024] -- 0:01:56
      714500 -- (-2633.205) [-2626.906] (-2627.440) (-2625.275) * (-2631.606) (-2625.133) (-2631.203) [-2624.244] -- 0:01:56
      715000 -- (-2629.949) [-2628.117] (-2625.945) (-2629.539) * (-2630.285) [-2628.032] (-2625.060) (-2620.446) -- 0:01:55

      Average standard deviation of split frequencies: 0.000263

      715500 -- (-2626.892) (-2624.935) [-2625.583] (-2625.251) * (-2626.368) (-2625.115) (-2633.992) [-2619.426] -- 0:01:55
      716000 -- (-2626.413) (-2624.979) (-2620.207) [-2624.884] * [-2628.884] (-2619.994) (-2620.356) (-2629.171) -- 0:01:55
      716500 -- [-2624.669] (-2624.623) (-2627.444) (-2628.305) * (-2626.348) (-2632.924) (-2620.509) [-2623.716] -- 0:01:55
      717000 -- (-2630.887) [-2625.521] (-2627.985) (-2624.285) * (-2624.211) (-2626.045) (-2624.262) [-2624.399] -- 0:01:55
      717500 -- (-2622.722) (-2623.709) (-2627.761) [-2626.155] * (-2631.996) [-2625.378] (-2625.987) (-2627.987) -- 0:01:54
      718000 -- (-2636.278) [-2625.570] (-2632.992) (-2629.313) * [-2625.319] (-2624.320) (-2624.317) (-2626.845) -- 0:01:54
      718500 -- (-2624.475) (-2634.434) [-2628.516] (-2631.739) * (-2627.140) [-2623.747] (-2629.189) (-2630.065) -- 0:01:54
      719000 -- (-2642.963) (-2627.885) (-2628.498) [-2631.106] * [-2626.977] (-2628.548) (-2627.903) (-2628.393) -- 0:01:54
      719500 -- (-2625.794) (-2626.083) [-2626.781] (-2625.883) * (-2627.812) (-2621.504) (-2625.306) [-2626.796] -- 0:01:54
      720000 -- (-2635.525) [-2623.497] (-2623.068) (-2631.372) * [-2628.361] (-2627.027) (-2629.799) (-2622.729) -- 0:01:53

      Average standard deviation of split frequencies: 0.000262

      720500 -- (-2621.303) (-2625.406) [-2624.421] (-2626.036) * (-2621.204) (-2628.677) [-2626.393] (-2622.925) -- 0:01:53
      721000 -- (-2626.907) [-2619.716] (-2624.516) (-2630.317) * (-2632.071) (-2626.205) (-2626.254) [-2631.570] -- 0:01:53
      721500 -- [-2622.972] (-2635.268) (-2620.321) (-2631.337) * (-2626.778) (-2620.658) (-2621.832) [-2637.835] -- 0:01:53
      722000 -- (-2627.531) (-2624.245) [-2624.885] (-2621.976) * (-2631.497) [-2618.559] (-2624.833) (-2629.892) -- 0:01:53
      722500 -- (-2630.129) (-2621.699) [-2621.451] (-2625.904) * (-2621.981) [-2627.409] (-2628.242) (-2636.315) -- 0:01:52
      723000 -- (-2627.147) (-2630.168) (-2625.872) [-2623.722] * (-2632.353) [-2629.492] (-2629.917) (-2633.272) -- 0:01:52
      723500 -- [-2631.434] (-2623.700) (-2623.624) (-2628.084) * (-2631.624) (-2627.034) [-2623.278] (-2624.599) -- 0:01:52
      724000 -- (-2622.752) [-2631.003] (-2626.936) (-2631.323) * (-2627.253) [-2625.251] (-2631.760) (-2630.652) -- 0:01:52
      724500 -- (-2623.299) [-2626.419] (-2624.795) (-2628.155) * (-2629.307) (-2631.988) [-2624.159] (-2626.008) -- 0:01:52
      725000 -- (-2630.491) (-2620.406) (-2632.916) [-2641.108] * (-2626.955) (-2627.962) (-2626.760) [-2620.905] -- 0:01:51

      Average standard deviation of split frequencies: 0.000260

      725500 -- [-2626.160] (-2628.004) (-2631.086) (-2627.344) * (-2623.321) (-2630.727) [-2622.679] (-2629.328) -- 0:01:51
      726000 -- (-2627.839) (-2629.053) [-2628.029] (-2625.385) * [-2624.005] (-2626.116) (-2632.377) (-2632.793) -- 0:01:51
      726500 -- (-2625.884) [-2628.382] (-2627.827) (-2624.575) * (-2639.132) (-2627.008) (-2623.019) [-2626.399] -- 0:01:51
      727000 -- (-2621.355) (-2623.987) [-2628.008] (-2630.091) * (-2625.804) [-2617.852] (-2625.174) (-2620.525) -- 0:01:51
      727500 -- (-2636.020) [-2623.740] (-2633.095) (-2626.947) * (-2628.432) (-2624.976) (-2623.665) [-2626.977] -- 0:01:50
      728000 -- (-2631.127) [-2621.785] (-2630.180) (-2625.455) * [-2630.998] (-2629.648) (-2627.480) (-2635.405) -- 0:01:50
      728500 -- (-2628.443) [-2625.653] (-2635.224) (-2628.457) * [-2619.823] (-2629.639) (-2629.464) (-2623.803) -- 0:01:50
      729000 -- (-2631.635) (-2628.493) [-2629.972] (-2631.760) * (-2627.788) [-2621.261] (-2627.533) (-2624.764) -- 0:01:50
      729500 -- [-2625.169] (-2623.327) (-2628.491) (-2630.511) * [-2629.421] (-2621.961) (-2623.058) (-2622.885) -- 0:01:50
      730000 -- (-2624.987) (-2633.606) (-2627.281) [-2626.100] * (-2626.255) (-2623.627) (-2625.972) [-2623.780] -- 0:01:49

      Average standard deviation of split frequencies: 0.000258

      730500 -- [-2621.529] (-2627.688) (-2624.642) (-2630.422) * [-2628.928] (-2623.754) (-2625.770) (-2621.084) -- 0:01:49
      731000 -- (-2630.305) (-2621.709) [-2625.996] (-2624.965) * (-2636.139) [-2624.711] (-2628.142) (-2630.022) -- 0:01:49
      731500 -- (-2626.314) [-2628.210] (-2626.268) (-2631.871) * (-2635.809) [-2621.884] (-2624.747) (-2622.975) -- 0:01:49
      732000 -- (-2629.923) (-2625.237) [-2620.642] (-2631.788) * (-2633.304) [-2631.109] (-2633.524) (-2620.580) -- 0:01:49
      732500 -- (-2632.679) (-2627.847) [-2629.254] (-2623.154) * (-2633.112) (-2624.155) [-2624.477] (-2622.051) -- 0:01:48
      733000 -- (-2627.763) (-2639.190) [-2622.215] (-2631.301) * (-2621.264) (-2627.576) (-2627.977) [-2631.509] -- 0:01:48
      733500 -- (-2628.864) (-2626.121) (-2634.643) [-2628.005] * (-2629.110) (-2628.524) [-2622.358] (-2628.051) -- 0:01:48
      734000 -- [-2627.488] (-2632.347) (-2626.768) (-2635.480) * (-2629.825) (-2631.072) [-2625.553] (-2634.687) -- 0:01:48
      734500 -- [-2628.873] (-2625.589) (-2624.804) (-2628.972) * (-2621.543) (-2625.281) (-2639.897) [-2632.582] -- 0:01:48
      735000 -- (-2627.345) [-2621.224] (-2622.121) (-2626.034) * [-2622.736] (-2635.097) (-2631.498) (-2634.700) -- 0:01:47

      Average standard deviation of split frequencies: 0.000256

      735500 -- (-2628.229) [-2623.415] (-2625.633) (-2620.409) * (-2622.280) (-2622.583) [-2629.582] (-2632.384) -- 0:01:47
      736000 -- (-2628.239) (-2627.668) (-2625.310) [-2623.020] * (-2628.325) [-2622.985] (-2624.086) (-2632.511) -- 0:01:47
      736500 -- (-2635.476) (-2630.856) (-2627.699) [-2623.895] * [-2623.089] (-2628.415) (-2638.280) (-2621.906) -- 0:01:47
      737000 -- (-2624.264) (-2632.328) (-2624.937) [-2623.209] * (-2632.173) (-2624.052) (-2628.358) [-2624.466] -- 0:01:47
      737500 -- [-2623.787] (-2626.495) (-2638.007) (-2621.783) * (-2628.586) (-2630.461) (-2630.608) [-2621.895] -- 0:01:46
      738000 -- [-2621.541] (-2625.284) (-2629.757) (-2622.233) * (-2621.445) (-2631.645) (-2625.791) [-2624.883] -- 0:01:46
      738500 -- (-2625.968) [-2622.456] (-2627.913) (-2622.678) * [-2620.212] (-2634.506) (-2623.632) (-2625.936) -- 0:01:46
      739000 -- (-2624.429) (-2624.159) (-2631.018) [-2622.514] * [-2626.770] (-2621.762) (-2627.980) (-2629.291) -- 0:01:46
      739500 -- [-2633.585] (-2623.830) (-2619.464) (-2626.776) * (-2621.841) [-2623.165] (-2626.943) (-2629.237) -- 0:01:46
      740000 -- [-2627.786] (-2627.547) (-2625.542) (-2625.588) * (-2620.942) (-2624.889) [-2623.759] (-2631.182) -- 0:01:45

      Average standard deviation of split frequencies: 0.000255

      740500 -- (-2627.327) (-2632.779) (-2630.697) [-2629.430] * [-2624.029] (-2623.699) (-2623.591) (-2635.248) -- 0:01:45
      741000 -- (-2628.506) [-2622.991] (-2625.053) (-2626.466) * (-2622.194) (-2636.434) [-2622.415] (-2625.831) -- 0:01:45
      741500 -- (-2629.027) [-2621.862] (-2630.755) (-2631.957) * (-2631.084) (-2630.834) [-2629.444] (-2631.687) -- 0:01:45
      742000 -- (-2625.571) (-2622.236) [-2626.594] (-2630.098) * [-2624.772] (-2629.537) (-2633.845) (-2626.520) -- 0:01:45
      742500 -- (-2631.064) [-2625.004] (-2635.509) (-2625.402) * (-2629.078) [-2626.532] (-2622.638) (-2622.933) -- 0:01:44
      743000 -- (-2628.664) [-2627.643] (-2633.913) (-2629.208) * (-2631.240) (-2625.978) (-2623.896) [-2621.018] -- 0:01:44
      743500 -- [-2623.223] (-2620.209) (-2628.683) (-2624.967) * (-2630.085) (-2625.109) (-2629.554) [-2626.767] -- 0:01:44
      744000 -- (-2620.354) [-2624.853] (-2626.216) (-2620.900) * (-2628.556) (-2625.066) (-2625.051) [-2622.303] -- 0:01:44
      744500 -- [-2620.398] (-2624.497) (-2622.087) (-2626.660) * (-2636.991) (-2627.569) (-2619.381) [-2623.469] -- 0:01:43
      745000 -- [-2622.485] (-2630.449) (-2628.420) (-2642.004) * (-2627.651) [-2629.968] (-2629.967) (-2622.504) -- 0:01:43

      Average standard deviation of split frequencies: 0.000253

      745500 -- (-2629.738) [-2622.293] (-2620.310) (-2626.934) * (-2629.662) [-2624.506] (-2624.889) (-2631.020) -- 0:01:43
      746000 -- (-2626.372) [-2636.336] (-2621.893) (-2624.621) * (-2632.172) (-2629.314) (-2630.128) [-2623.962] -- 0:01:43
      746500 -- (-2625.541) (-2623.083) (-2629.630) [-2626.200] * (-2638.798) (-2625.882) [-2627.753] (-2623.491) -- 0:01:43
      747000 -- (-2632.037) (-2624.579) [-2626.411] (-2625.419) * (-2632.199) (-2632.882) (-2635.619) [-2633.794] -- 0:01:42
      747500 -- (-2628.676) (-2626.224) [-2620.596] (-2626.836) * (-2634.394) (-2626.020) (-2626.891) [-2623.254] -- 0:01:42
      748000 -- (-2628.404) [-2619.340] (-2629.543) (-2629.273) * (-2632.277) (-2626.092) (-2638.405) [-2623.110] -- 0:01:42
      748500 -- (-2634.953) [-2622.147] (-2625.529) (-2627.796) * (-2630.252) (-2628.259) (-2638.493) [-2623.757] -- 0:01:42
      749000 -- (-2622.741) (-2635.925) [-2624.291] (-2621.882) * (-2631.224) (-2621.879) [-2624.364] (-2624.048) -- 0:01:42
      749500 -- (-2618.839) (-2624.503) (-2624.437) [-2624.597] * [-2626.834] (-2625.940) (-2645.599) (-2624.250) -- 0:01:41
      750000 -- (-2626.599) [-2627.161] (-2639.324) (-2623.349) * (-2626.780) (-2625.714) (-2625.100) [-2622.727] -- 0:01:41

      Average standard deviation of split frequencies: 0.000251

      750500 -- [-2628.928] (-2631.874) (-2628.410) (-2628.794) * (-2624.442) (-2627.407) [-2618.898] (-2627.892) -- 0:01:41
      751000 -- (-2625.847) (-2628.139) [-2625.940] (-2626.004) * (-2627.061) (-2626.469) [-2623.301] (-2631.731) -- 0:01:41
      751500 -- (-2630.277) (-2627.656) [-2625.661] (-2624.322) * [-2628.543] (-2625.452) (-2625.982) (-2632.773) -- 0:01:41
      752000 -- (-2628.899) [-2624.976] (-2624.340) (-2623.663) * (-2629.929) (-2623.866) [-2624.200] (-2627.480) -- 0:01:40
      752500 -- (-2628.860) (-2625.428) [-2627.175] (-2624.698) * (-2629.882) (-2624.354) [-2625.091] (-2628.996) -- 0:01:40
      753000 -- (-2627.197) [-2625.089] (-2622.585) (-2629.199) * (-2624.836) [-2628.313] (-2627.451) (-2633.378) -- 0:01:40
      753500 -- [-2622.764] (-2625.668) (-2632.536) (-2627.324) * (-2626.801) (-2628.085) (-2626.721) [-2623.264] -- 0:01:40
      754000 -- [-2633.276] (-2620.669) (-2631.870) (-2624.596) * (-2629.033) (-2624.609) [-2623.317] (-2629.454) -- 0:01:40
      754500 -- (-2631.493) [-2623.665] (-2626.386) (-2630.808) * (-2631.341) [-2625.171] (-2629.159) (-2632.372) -- 0:01:39
      755000 -- (-2631.010) (-2632.321) [-2625.853] (-2626.165) * [-2629.416] (-2641.637) (-2627.090) (-2641.929) -- 0:01:39

      Average standard deviation of split frequencies: 0.000249

      755500 -- (-2630.316) [-2640.885] (-2627.318) (-2633.466) * (-2625.616) (-2631.593) [-2622.751] (-2625.933) -- 0:01:39
      756000 -- (-2627.451) (-2629.059) (-2629.960) [-2626.719] * [-2627.558] (-2632.851) (-2632.679) (-2628.895) -- 0:01:39
      756500 -- [-2626.036] (-2626.802) (-2618.706) (-2625.516) * (-2625.694) [-2629.853] (-2634.305) (-2624.283) -- 0:01:39
      757000 -- (-2627.855) (-2627.922) (-2628.619) [-2622.322] * (-2625.922) (-2635.768) (-2640.831) [-2623.571] -- 0:01:38
      757500 -- (-2621.481) (-2625.327) [-2628.413] (-2627.026) * (-2626.170) (-2634.981) [-2628.477] (-2623.009) -- 0:01:38
      758000 -- (-2624.491) [-2626.909] (-2625.558) (-2626.135) * (-2618.777) (-2632.309) (-2637.362) [-2620.253] -- 0:01:38
      758500 -- (-2631.640) (-2631.007) [-2628.205] (-2632.737) * [-2626.522] (-2627.720) (-2634.030) (-2628.462) -- 0:01:38
      759000 -- [-2628.011] (-2631.545) (-2623.494) (-2637.755) * (-2625.290) (-2624.706) [-2627.238] (-2627.112) -- 0:01:38
      759500 -- (-2628.983) (-2625.125) [-2629.427] (-2624.322) * (-2627.267) (-2634.556) (-2624.091) [-2622.670] -- 0:01:37
      760000 -- [-2628.149] (-2631.606) (-2627.759) (-2623.692) * (-2630.233) [-2623.132] (-2630.941) (-2631.349) -- 0:01:37

      Average standard deviation of split frequencies: 0.000248

      760500 -- (-2626.553) (-2629.169) [-2626.835] (-2631.624) * (-2625.557) (-2619.403) (-2624.466) [-2623.136] -- 0:01:37
      761000 -- [-2633.808] (-2632.577) (-2625.459) (-2623.621) * [-2625.586] (-2627.652) (-2619.019) (-2620.533) -- 0:01:37
      761500 -- [-2625.489] (-2618.933) (-2619.770) (-2631.304) * [-2627.291] (-2632.644) (-2625.082) (-2629.208) -- 0:01:37
      762000 -- (-2622.917) (-2628.129) [-2627.684] (-2629.574) * (-2628.853) [-2631.877] (-2625.189) (-2629.696) -- 0:01:36
      762500 -- [-2622.231] (-2626.391) (-2627.080) (-2634.353) * (-2630.244) (-2628.282) [-2626.235] (-2629.218) -- 0:01:36
      763000 -- (-2621.494) (-2624.747) [-2627.841] (-2632.633) * [-2627.613] (-2628.681) (-2629.966) (-2629.830) -- 0:01:36
      763500 -- (-2631.629) (-2620.307) (-2634.128) [-2624.682] * (-2630.013) (-2626.077) (-2629.043) [-2623.858] -- 0:01:36
      764000 -- (-2634.778) (-2628.594) (-2631.879) [-2626.373] * (-2632.525) [-2627.806] (-2634.056) (-2623.402) -- 0:01:36
      764500 -- (-2629.997) (-2624.960) (-2630.768) [-2640.591] * (-2628.699) [-2640.392] (-2634.084) (-2623.654) -- 0:01:36
      765000 -- (-2623.348) (-2625.228) [-2627.002] (-2635.583) * (-2628.645) (-2628.698) [-2633.089] (-2621.566) -- 0:01:35

      Average standard deviation of split frequencies: 0.000246

      765500 -- (-2624.576) (-2626.059) (-2625.456) [-2624.730] * (-2626.090) (-2624.916) [-2630.731] (-2623.353) -- 0:01:35
      766000 -- [-2622.499] (-2621.626) (-2630.733) (-2632.062) * (-2626.406) (-2634.037) (-2626.292) [-2632.324] -- 0:01:35
      766500 -- (-2628.398) [-2622.217] (-2627.621) (-2620.001) * [-2624.854] (-2622.471) (-2625.530) (-2625.703) -- 0:01:35
      767000 -- (-2630.553) [-2622.121] (-2630.315) (-2625.658) * (-2621.585) (-2629.655) (-2623.366) [-2621.858] -- 0:01:35
      767500 -- (-2629.923) [-2623.796] (-2623.602) (-2620.888) * (-2621.826) (-2631.295) [-2619.341] (-2629.265) -- 0:01:34
      768000 -- [-2623.662] (-2627.255) (-2627.852) (-2625.757) * (-2624.869) [-2627.009] (-2628.159) (-2626.454) -- 0:01:34
      768500 -- (-2623.636) [-2626.023] (-2630.199) (-2625.362) * (-2624.828) [-2623.319] (-2629.529) (-2624.409) -- 0:01:34
      769000 -- (-2627.561) (-2627.124) (-2626.077) [-2629.874] * (-2626.278) (-2623.633) [-2627.926] (-2627.266) -- 0:01:34
      769500 -- (-2631.515) [-2623.524] (-2623.210) (-2624.315) * (-2627.520) [-2635.925] (-2625.879) (-2626.655) -- 0:01:34
      770000 -- (-2625.934) (-2630.021) [-2628.302] (-2624.832) * (-2628.728) (-2626.237) (-2632.298) [-2630.762] -- 0:01:34

      Average standard deviation of split frequencies: 0.000245

      770500 -- [-2627.258] (-2625.562) (-2631.994) (-2623.767) * (-2627.797) [-2625.431] (-2630.162) (-2634.414) -- 0:01:33
      771000 -- (-2626.141) (-2628.148) (-2625.674) [-2619.337] * [-2622.923] (-2624.217) (-2630.974) (-2632.439) -- 0:01:33
      771500 -- (-2634.712) (-2630.686) (-2628.226) [-2625.861] * (-2627.881) (-2626.019) [-2625.490] (-2626.941) -- 0:01:33
      772000 -- [-2625.432] (-2619.354) (-2628.874) (-2628.392) * (-2625.426) [-2622.339] (-2628.210) (-2620.783) -- 0:01:33
      772500 -- (-2625.937) (-2628.378) (-2625.810) [-2623.653] * (-2624.740) (-2626.156) (-2626.763) [-2619.592] -- 0:01:33
      773000 -- (-2626.639) (-2625.642) [-2630.085] (-2624.315) * (-2623.255) (-2624.845) [-2629.836] (-2624.739) -- 0:01:32
      773500 -- (-2627.132) (-2627.456) [-2623.820] (-2625.267) * (-2630.948) (-2637.856) (-2625.633) [-2628.282] -- 0:01:32
      774000 -- (-2628.774) (-2630.802) (-2629.895) [-2625.803] * (-2625.488) [-2623.151] (-2630.778) (-2628.292) -- 0:01:32
      774500 -- (-2622.371) [-2626.730] (-2624.024) (-2624.186) * (-2631.026) (-2622.109) (-2619.716) [-2623.622] -- 0:01:32
      775000 -- [-2628.650] (-2642.822) (-2620.369) (-2627.323) * [-2625.646] (-2620.919) (-2626.003) (-2620.996) -- 0:01:32

      Average standard deviation of split frequencies: 0.000243

      775500 -- (-2632.937) (-2627.583) [-2628.687] (-2619.143) * (-2625.397) (-2629.355) [-2625.744] (-2631.825) -- 0:01:31
      776000 -- [-2625.128] (-2632.456) (-2627.663) (-2625.644) * [-2628.924] (-2622.315) (-2628.672) (-2626.587) -- 0:01:31
      776500 -- [-2624.753] (-2636.992) (-2625.221) (-2622.590) * (-2635.011) (-2623.610) (-2635.890) [-2630.321] -- 0:01:31
      777000 -- (-2625.829) (-2625.392) [-2621.745] (-2625.064) * (-2630.220) (-2627.972) [-2620.789] (-2639.650) -- 0:01:31
      777500 -- (-2624.745) (-2629.313) (-2629.046) [-2629.158] * [-2625.539] (-2627.293) (-2628.236) (-2624.848) -- 0:01:31
      778000 -- (-2626.985) (-2627.527) [-2624.038] (-2622.332) * (-2629.536) (-2623.794) [-2629.476] (-2633.943) -- 0:01:31
      778500 -- [-2635.286] (-2622.609) (-2631.229) (-2626.872) * (-2634.092) (-2625.603) [-2633.555] (-2631.689) -- 0:01:30
      779000 -- (-2631.024) [-2620.076] (-2629.800) (-2624.372) * [-2619.524] (-2631.400) (-2634.074) (-2632.672) -- 0:01:30
      779500 -- [-2626.018] (-2628.722) (-2620.818) (-2625.182) * (-2626.502) [-2625.808] (-2627.955) (-2624.920) -- 0:01:30
      780000 -- [-2623.328] (-2625.710) (-2626.332) (-2624.254) * [-2620.595] (-2624.126) (-2627.777) (-2626.851) -- 0:01:30

      Average standard deviation of split frequencies: 0.000242

      780500 -- (-2629.413) (-2623.067) (-2628.099) [-2626.133] * [-2627.076] (-2636.962) (-2624.016) (-2627.901) -- 0:01:29
      781000 -- [-2632.341] (-2621.141) (-2624.786) (-2627.142) * (-2626.973) (-2625.145) [-2620.868] (-2635.291) -- 0:01:29
      781500 -- [-2625.932] (-2635.673) (-2632.519) (-2627.879) * (-2625.638) [-2620.043] (-2625.470) (-2626.297) -- 0:01:29
      782000 -- [-2623.911] (-2626.195) (-2633.548) (-2624.101) * (-2626.002) (-2629.577) [-2622.608] (-2625.385) -- 0:01:29
      782500 -- (-2626.307) (-2625.035) [-2625.974] (-2628.037) * [-2625.838] (-2631.274) (-2632.715) (-2622.579) -- 0:01:29
      783000 -- (-2622.334) (-2623.113) [-2624.243] (-2634.993) * (-2622.065) (-2620.289) [-2627.495] (-2624.401) -- 0:01:28
      783500 -- [-2623.428] (-2624.788) (-2630.261) (-2624.631) * (-2627.187) (-2625.834) [-2623.026] (-2623.704) -- 0:01:28
      784000 -- (-2628.132) (-2628.330) (-2634.179) [-2621.230] * (-2628.325) (-2626.487) [-2621.477] (-2627.628) -- 0:01:28
      784500 -- (-2620.102) [-2628.660] (-2627.574) (-2624.593) * (-2618.864) [-2627.367] (-2627.276) (-2630.823) -- 0:01:28
      785000 -- (-2632.837) (-2621.344) (-2629.682) [-2624.118] * (-2624.202) [-2624.864] (-2631.395) (-2626.262) -- 0:01:28

      Average standard deviation of split frequencies: 0.000240

      785500 -- (-2625.513) (-2627.848) [-2624.438] (-2625.583) * (-2625.543) [-2623.634] (-2634.672) (-2622.790) -- 0:01:28
      786000 -- (-2632.082) [-2631.082] (-2632.584) (-2621.479) * (-2625.673) [-2621.763] (-2627.293) (-2620.758) -- 0:01:27
      786500 -- (-2629.509) (-2630.218) (-2631.545) [-2622.870] * [-2622.598] (-2625.470) (-2635.394) (-2625.214) -- 0:01:27
      787000 -- (-2625.623) (-2624.006) [-2624.103] (-2629.394) * (-2622.563) (-2628.666) [-2624.473] (-2623.015) -- 0:01:27
      787500 -- (-2625.447) (-2627.718) (-2623.466) [-2626.457] * (-2629.151) (-2629.760) [-2628.317] (-2622.961) -- 0:01:27
      788000 -- (-2619.598) [-2634.183] (-2627.609) (-2629.534) * (-2620.685) (-2624.267) (-2633.134) [-2625.899] -- 0:01:27
      788500 -- (-2631.163) (-2624.931) (-2628.082) [-2622.703] * (-2619.058) [-2623.064] (-2635.751) (-2634.876) -- 0:01:26
      789000 -- (-2621.465) (-2627.530) (-2628.580) [-2624.849] * (-2627.768) (-2623.752) [-2623.911] (-2631.549) -- 0:01:26
      789500 -- (-2630.134) [-2624.086] (-2635.158) (-2630.531) * (-2628.815) (-2634.103) [-2622.136] (-2641.045) -- 0:01:26
      790000 -- (-2624.662) (-2625.624) [-2627.345] (-2630.573) * (-2626.902) (-2633.211) (-2625.557) [-2629.476] -- 0:01:26

      Average standard deviation of split frequencies: 0.000238

      790500 -- (-2626.858) (-2628.850) [-2619.582] (-2636.617) * [-2624.528] (-2621.165) (-2631.205) (-2629.057) -- 0:01:26
      791000 -- (-2621.172) (-2630.410) (-2629.725) [-2621.709] * [-2627.364] (-2630.509) (-2630.259) (-2629.516) -- 0:01:25
      791500 -- (-2618.089) (-2627.019) (-2626.747) [-2624.343] * (-2620.589) (-2623.309) [-2624.418] (-2625.109) -- 0:01:25
      792000 -- (-2628.241) (-2631.749) [-2622.136] (-2626.481) * [-2624.622] (-2633.340) (-2624.020) (-2623.052) -- 0:01:25
      792500 -- (-2625.905) [-2628.356] (-2625.983) (-2626.972) * (-2634.503) (-2625.856) (-2618.787) [-2621.715] -- 0:01:25
      793000 -- (-2627.479) (-2624.943) [-2622.637] (-2625.444) * (-2637.621) (-2623.314) (-2621.657) [-2639.673] -- 0:01:25
      793500 -- (-2627.707) [-2621.937] (-2623.041) (-2623.577) * (-2626.028) (-2625.301) (-2632.173) [-2628.152] -- 0:01:24
      794000 -- [-2629.207] (-2622.873) (-2630.407) (-2624.872) * (-2631.965) (-2627.112) [-2623.064] (-2631.344) -- 0:01:24
      794500 -- (-2625.210) (-2624.264) [-2622.417] (-2624.741) * (-2633.125) [-2631.853] (-2634.261) (-2631.606) -- 0:01:24
      795000 -- (-2620.434) (-2621.017) (-2627.627) [-2636.736] * [-2619.735] (-2628.962) (-2629.686) (-2632.562) -- 0:01:24

      Average standard deviation of split frequencies: 0.000237

      795500 -- (-2627.655) (-2622.618) [-2625.814] (-2626.905) * [-2629.936] (-2631.703) (-2625.111) (-2622.091) -- 0:01:24
      796000 -- (-2623.305) [-2624.451] (-2627.255) (-2626.542) * (-2623.572) [-2621.614] (-2621.981) (-2628.677) -- 0:01:23
      796500 -- (-2621.721) (-2625.022) [-2625.430] (-2623.776) * (-2630.969) (-2629.054) (-2626.896) [-2631.594] -- 0:01:23
      797000 -- (-2628.736) [-2631.248] (-2631.228) (-2621.123) * [-2623.165] (-2642.137) (-2632.920) (-2625.122) -- 0:01:23
      797500 -- (-2627.942) [-2621.643] (-2641.036) (-2621.531) * (-2627.450) (-2630.280) (-2626.249) [-2626.043] -- 0:01:23
      798000 -- (-2622.566) (-2633.188) [-2626.715] (-2624.776) * (-2626.185) [-2622.623] (-2631.589) (-2627.563) -- 0:01:23
      798500 -- [-2625.307] (-2626.563) (-2628.582) (-2622.635) * [-2622.664] (-2632.059) (-2626.234) (-2631.005) -- 0:01:23
      799000 -- (-2627.367) (-2627.770) (-2633.056) [-2625.469] * (-2627.221) (-2636.199) [-2620.432] (-2639.670) -- 0:01:22
      799500 -- (-2623.970) (-2637.637) (-2633.840) [-2623.320] * (-2626.087) [-2630.104] (-2624.776) (-2629.384) -- 0:01:22
      800000 -- [-2625.933] (-2629.695) (-2627.366) (-2627.051) * (-2631.574) (-2628.611) [-2623.321] (-2631.993) -- 0:01:22

      Average standard deviation of split frequencies: 0.000236

      800500 -- (-2622.527) (-2628.216) [-2621.673] (-2632.236) * [-2629.536] (-2623.158) (-2627.412) (-2634.708) -- 0:01:21
      801000 -- (-2628.348) (-2632.783) [-2626.109] (-2630.078) * (-2628.478) [-2621.552] (-2630.077) (-2629.356) -- 0:01:21
      801500 -- [-2624.450] (-2633.051) (-2622.743) (-2632.031) * (-2627.618) (-2623.332) (-2628.734) [-2628.830] -- 0:01:21
      802000 -- [-2627.187] (-2627.785) (-2623.948) (-2628.149) * (-2624.388) [-2626.422] (-2627.718) (-2626.492) -- 0:01:21
      802500 -- (-2627.997) (-2623.474) [-2627.179] (-2630.092) * (-2625.667) (-2620.857) (-2627.984) [-2624.255] -- 0:01:21
      803000 -- (-2632.038) [-2631.531] (-2630.542) (-2626.256) * [-2631.836] (-2629.696) (-2631.524) (-2626.643) -- 0:01:20
      803500 -- (-2626.965) (-2629.902) (-2622.993) [-2621.670] * (-2625.717) (-2634.777) [-2624.719] (-2627.886) -- 0:01:20
      804000 -- [-2624.507] (-2622.392) (-2621.857) (-2625.490) * (-2624.448) [-2628.203] (-2627.270) (-2624.635) -- 0:01:20
      804500 -- (-2631.781) [-2627.010] (-2629.307) (-2626.237) * (-2624.863) [-2629.954] (-2629.745) (-2624.953) -- 0:01:20
      805000 -- (-2630.107) (-2629.884) [-2620.139] (-2626.363) * (-2639.220) (-2619.864) [-2625.286] (-2631.844) -- 0:01:20

      Average standard deviation of split frequencies: 0.000234

      805500 -- (-2630.422) (-2627.332) [-2620.609] (-2626.065) * (-2634.985) [-2625.096] (-2628.179) (-2621.900) -- 0:01:19
      806000 -- (-2627.989) (-2625.620) [-2625.998] (-2630.895) * (-2627.930) (-2626.108) (-2629.576) [-2627.454] -- 0:01:19
      806500 -- (-2631.392) (-2638.071) (-2627.774) [-2620.587] * (-2628.650) (-2635.059) (-2619.903) [-2626.843] -- 0:01:19
      807000 -- (-2627.270) [-2618.342] (-2619.719) (-2628.593) * (-2626.520) (-2626.645) [-2625.298] (-2624.531) -- 0:01:19
      807500 -- (-2626.793) (-2626.443) (-2627.248) [-2622.606] * (-2629.513) [-2621.700] (-2622.289) (-2622.161) -- 0:01:19
      808000 -- (-2627.496) (-2629.926) [-2627.184] (-2629.061) * (-2629.313) (-2624.842) [-2626.289] (-2624.500) -- 0:01:19
      808500 -- (-2632.320) (-2624.170) [-2622.774] (-2628.981) * (-2627.626) [-2625.575] (-2625.251) (-2633.805) -- 0:01:18
      809000 -- (-2630.489) (-2624.761) (-2622.986) [-2623.516] * (-2630.504) (-2625.969) [-2629.420] (-2622.659) -- 0:01:18
      809500 -- [-2623.576] (-2625.933) (-2620.636) (-2626.617) * (-2623.079) (-2627.841) (-2628.920) [-2625.523] -- 0:01:18
      810000 -- (-2628.946) [-2634.762] (-2632.389) (-2626.254) * (-2621.114) (-2630.643) (-2623.198) [-2619.238] -- 0:01:18

      Average standard deviation of split frequencies: 0.000233

      810500 -- (-2628.659) (-2623.500) (-2631.266) [-2623.089] * (-2623.789) [-2624.070] (-2627.334) (-2628.527) -- 0:01:18
      811000 -- [-2631.358] (-2626.666) (-2622.801) (-2624.812) * (-2622.896) [-2628.712] (-2624.877) (-2628.252) -- 0:01:17
      811500 -- (-2624.864) (-2623.912) (-2626.993) [-2631.237] * (-2640.044) (-2628.818) [-2623.545] (-2627.250) -- 0:01:17
      812000 -- [-2628.403] (-2624.804) (-2637.280) (-2630.465) * (-2632.992) (-2623.564) [-2629.188] (-2629.325) -- 0:01:17
      812500 -- (-2622.394) [-2631.053] (-2633.614) (-2627.951) * (-2629.308) (-2628.696) (-2629.765) [-2626.470] -- 0:01:17
      813000 -- [-2626.381] (-2621.529) (-2627.123) (-2626.334) * (-2626.947) (-2626.617) [-2629.615] (-2630.616) -- 0:01:17
      813500 -- (-2631.505) [-2622.177] (-2620.943) (-2634.426) * (-2629.607) (-2619.221) [-2623.786] (-2625.989) -- 0:01:16
      814000 -- (-2627.595) (-2622.881) (-2628.321) [-2629.829] * (-2620.890) [-2625.104] (-2633.188) (-2633.456) -- 0:01:16
      814500 -- (-2619.703) (-2626.642) [-2632.670] (-2629.227) * [-2621.127] (-2620.617) (-2634.471) (-2621.618) -- 0:01:16
      815000 -- [-2627.362] (-2622.567) (-2630.153) (-2632.573) * (-2623.239) [-2623.141] (-2632.453) (-2629.762) -- 0:01:16

      Average standard deviation of split frequencies: 0.000231

      815500 -- (-2629.471) [-2625.256] (-2635.411) (-2626.676) * (-2627.055) [-2623.854] (-2629.181) (-2628.311) -- 0:01:16
      816000 -- (-2628.387) (-2625.441) [-2630.267] (-2624.677) * (-2633.646) [-2622.730] (-2629.781) (-2630.767) -- 0:01:15
      816500 -- [-2623.886] (-2632.189) (-2627.919) (-2622.319) * (-2631.189) [-2622.679] (-2627.522) (-2628.796) -- 0:01:15
      817000 -- (-2626.298) (-2633.184) [-2627.471] (-2624.287) * (-2629.470) (-2635.284) (-2626.833) [-2623.095] -- 0:01:15
      817500 -- (-2627.962) (-2636.269) (-2627.263) [-2627.784] * [-2626.630] (-2627.737) (-2629.591) (-2630.272) -- 0:01:15
      818000 -- (-2625.603) [-2620.036] (-2630.653) (-2625.556) * (-2626.442) (-2631.355) [-2628.667] (-2626.580) -- 0:01:14
      818500 -- (-2625.134) (-2620.563) (-2625.788) [-2620.916] * (-2626.473) (-2628.425) [-2623.561] (-2623.741) -- 0:01:14
      819000 -- (-2634.993) [-2624.146] (-2627.540) (-2636.641) * (-2620.606) (-2630.379) [-2628.417] (-2628.487) -- 0:01:14
      819500 -- (-2626.910) [-2622.549] (-2632.542) (-2625.445) * (-2632.427) (-2627.555) (-2623.377) [-2629.309] -- 0:01:14
      820000 -- [-2629.850] (-2622.916) (-2631.538) (-2625.476) * (-2624.230) (-2626.953) (-2630.592) [-2628.747] -- 0:01:14

      Average standard deviation of split frequencies: 0.000230

      820500 -- (-2636.975) [-2623.478] (-2628.057) (-2624.659) * (-2627.086) (-2626.632) [-2620.252] (-2625.361) -- 0:01:13
      821000 -- (-2631.627) [-2625.600] (-2632.685) (-2630.146) * (-2626.795) [-2628.008] (-2619.185) (-2624.317) -- 0:01:13
      821500 -- (-2633.132) (-2618.619) [-2623.660] (-2626.633) * (-2636.796) (-2623.869) (-2626.051) [-2619.387] -- 0:01:13
      822000 -- (-2628.415) (-2621.812) [-2632.036] (-2621.893) * [-2634.441] (-2625.666) (-2622.570) (-2629.450) -- 0:01:13
      822500 -- (-2628.238) [-2622.295] (-2622.959) (-2631.779) * (-2630.838) (-2628.125) [-2619.017] (-2627.644) -- 0:01:13
      823000 -- (-2633.105) (-2624.052) [-2620.779] (-2628.872) * [-2625.876] (-2624.506) (-2625.266) (-2626.765) -- 0:01:12
      823500 -- (-2629.253) (-2623.272) (-2622.662) [-2626.919] * [-2623.491] (-2625.933) (-2626.857) (-2624.847) -- 0:01:12
      824000 -- [-2622.973] (-2620.060) (-2624.525) (-2623.864) * (-2622.615) (-2628.720) [-2624.045] (-2624.743) -- 0:01:12
      824500 -- [-2625.346] (-2621.465) (-2626.355) (-2629.818) * (-2629.474) [-2624.698] (-2627.982) (-2627.408) -- 0:01:12
      825000 -- (-2631.742) (-2623.322) (-2619.854) [-2625.061] * [-2623.703] (-2625.199) (-2627.866) (-2624.978) -- 0:01:12

      Average standard deviation of split frequencies: 0.000228

      825500 -- (-2624.216) [-2622.668] (-2627.768) (-2632.897) * (-2630.313) (-2632.869) (-2637.477) [-2622.689] -- 0:01:11
      826000 -- (-2622.846) [-2629.628] (-2643.246) (-2623.593) * [-2621.100] (-2626.804) (-2621.945) (-2631.733) -- 0:01:11
      826500 -- (-2623.973) (-2624.174) (-2630.178) [-2621.025] * [-2623.241] (-2621.429) (-2621.584) (-2624.219) -- 0:01:11
      827000 -- (-2629.281) (-2626.591) [-2624.399] (-2624.149) * [-2622.779] (-2625.407) (-2629.554) (-2619.414) -- 0:01:11
      827500 -- (-2623.820) (-2628.511) (-2629.729) [-2624.077] * [-2628.223] (-2629.588) (-2630.347) (-2632.817) -- 0:01:11
      828000 -- (-2626.101) (-2626.850) (-2629.409) [-2627.400] * (-2634.321) [-2621.714] (-2627.571) (-2631.591) -- 0:01:10
      828500 -- (-2631.231) (-2623.212) [-2630.281] (-2622.265) * (-2632.480) [-2624.814] (-2624.182) (-2630.812) -- 0:01:10
      829000 -- [-2621.962] (-2631.988) (-2631.091) (-2621.788) * (-2634.583) (-2623.432) (-2622.091) [-2628.366] -- 0:01:10
      829500 -- [-2621.871] (-2634.691) (-2628.984) (-2626.211) * (-2629.420) [-2620.555] (-2624.442) (-2624.450) -- 0:01:10
      830000 -- (-2620.840) [-2625.483] (-2623.059) (-2625.891) * (-2636.350) [-2632.276] (-2626.849) (-2621.952) -- 0:01:10

      Average standard deviation of split frequencies: 0.000227

      830500 -- (-2633.658) [-2624.882] (-2636.582) (-2626.407) * (-2624.713) (-2631.963) [-2624.421] (-2619.556) -- 0:01:09
      831000 -- [-2627.503] (-2627.685) (-2628.346) (-2622.303) * (-2639.398) (-2623.344) [-2626.596] (-2630.297) -- 0:01:09
      831500 -- (-2631.252) (-2622.000) (-2627.109) [-2621.290] * (-2628.167) [-2620.432] (-2625.662) (-2635.077) -- 0:01:09
      832000 -- (-2621.187) (-2637.688) (-2630.638) [-2629.581] * (-2639.267) (-2626.894) [-2624.764] (-2622.690) -- 0:01:09
      832500 -- [-2629.207] (-2629.758) (-2624.213) (-2622.248) * (-2632.275) [-2628.441] (-2633.870) (-2624.223) -- 0:01:09
      833000 -- (-2627.526) (-2620.758) (-2623.298) [-2622.223] * [-2625.617] (-2631.352) (-2621.628) (-2624.720) -- 0:01:08
      833500 -- (-2629.390) (-2626.043) [-2626.189] (-2627.429) * (-2634.227) (-2620.871) [-2626.076] (-2623.675) -- 0:01:08
      834000 -- (-2627.536) [-2632.341] (-2631.271) (-2637.648) * (-2627.195) [-2620.361] (-2629.599) (-2631.713) -- 0:01:08
      834500 -- (-2627.101) (-2633.205) [-2622.632] (-2622.815) * (-2623.482) [-2629.035] (-2624.373) (-2631.261) -- 0:01:08
      835000 -- (-2622.949) (-2627.719) (-2627.090) [-2630.493] * (-2626.423) [-2623.850] (-2624.168) (-2636.369) -- 0:01:07

      Average standard deviation of split frequencies: 0.000226

      835500 -- (-2627.243) (-2620.923) (-2629.639) [-2623.167] * (-2629.497) (-2626.222) [-2620.577] (-2631.804) -- 0:01:07
      836000 -- [-2625.092] (-2625.214) (-2630.073) (-2635.025) * (-2624.839) [-2631.067] (-2625.346) (-2622.197) -- 0:01:07
      836500 -- [-2625.243] (-2626.996) (-2627.396) (-2628.666) * (-2622.635) [-2625.440] (-2626.939) (-2625.887) -- 0:01:07
      837000 -- (-2623.325) (-2636.127) (-2626.993) [-2626.764] * (-2633.441) [-2626.992] (-2624.152) (-2635.821) -- 0:01:07
      837500 -- (-2622.515) (-2633.531) [-2626.384] (-2624.050) * (-2628.042) [-2622.559] (-2628.123) (-2625.641) -- 0:01:06
      838000 -- [-2621.486] (-2628.658) (-2630.992) (-2624.759) * (-2631.715) (-2628.562) (-2622.824) [-2625.670] -- 0:01:06
      838500 -- [-2621.074] (-2623.756) (-2627.484) (-2625.119) * (-2628.571) [-2620.408] (-2623.984) (-2625.602) -- 0:01:06
      839000 -- [-2620.710] (-2630.118) (-2628.110) (-2622.607) * [-2624.859] (-2624.889) (-2629.355) (-2624.606) -- 0:01:06
      839500 -- [-2629.264] (-2617.954) (-2633.830) (-2622.519) * (-2630.669) [-2625.175] (-2632.923) (-2628.144) -- 0:01:06
      840000 -- (-2628.358) (-2624.710) (-2632.182) [-2622.837] * (-2628.519) [-2626.277] (-2633.926) (-2621.106) -- 0:01:05

      Average standard deviation of split frequencies: 0.000224

      840500 -- (-2631.701) [-2627.180] (-2623.105) (-2627.699) * (-2626.955) (-2626.706) (-2620.324) [-2628.048] -- 0:01:05
      841000 -- [-2628.364] (-2624.687) (-2625.171) (-2629.896) * (-2627.285) [-2629.072] (-2631.984) (-2625.194) -- 0:01:05
      841500 -- [-2622.957] (-2622.656) (-2629.613) (-2626.095) * [-2627.216] (-2629.608) (-2633.046) (-2619.955) -- 0:01:05
      842000 -- (-2625.199) (-2630.831) (-2630.347) [-2623.227] * (-2627.113) (-2620.508) [-2625.254] (-2625.380) -- 0:01:05
      842500 -- (-2623.101) [-2628.025] (-2632.286) (-2630.921) * (-2618.528) (-2624.357) [-2623.617] (-2620.346) -- 0:01:04
      843000 -- (-2623.013) [-2624.948] (-2635.214) (-2628.089) * (-2621.833) (-2620.227) (-2630.926) [-2620.081] -- 0:01:04
      843500 -- (-2621.057) [-2620.293] (-2622.162) (-2635.980) * [-2621.788] (-2628.356) (-2620.305) (-2624.861) -- 0:01:04
      844000 -- [-2620.890] (-2625.894) (-2628.149) (-2629.798) * [-2631.984] (-2621.082) (-2630.448) (-2628.968) -- 0:01:04
      844500 -- [-2622.829] (-2629.604) (-2634.322) (-2632.413) * (-2631.097) (-2628.271) (-2624.504) [-2630.043] -- 0:01:04
      845000 -- (-2624.814) (-2624.309) (-2625.915) [-2623.464] * (-2635.441) [-2620.797] (-2623.187) (-2631.404) -- 0:01:03

      Average standard deviation of split frequencies: 0.000223

      845500 -- (-2630.332) [-2626.374] (-2621.087) (-2627.210) * [-2628.255] (-2627.435) (-2626.032) (-2631.211) -- 0:01:03
      846000 -- (-2635.771) (-2630.787) (-2627.794) [-2620.910] * (-2629.946) (-2624.377) [-2618.991] (-2631.217) -- 0:01:03
      846500 -- [-2627.810] (-2627.382) (-2628.589) (-2630.206) * (-2632.306) (-2630.228) (-2624.539) [-2619.973] -- 0:01:03
      847000 -- (-2623.790) (-2625.196) (-2630.412) [-2625.461] * [-2625.698] (-2634.528) (-2636.466) (-2626.603) -- 0:01:03
      847500 -- (-2632.932) [-2624.073] (-2628.051) (-2624.896) * (-2621.899) (-2629.467) [-2622.503] (-2629.459) -- 0:01:02
      848000 -- (-2626.705) [-2620.405] (-2628.250) (-2623.938) * [-2620.390] (-2623.493) (-2624.082) (-2627.330) -- 0:01:02
      848500 -- (-2630.611) (-2627.950) (-2630.979) [-2627.165] * [-2625.517] (-2631.484) (-2622.540) (-2626.006) -- 0:01:02
      849000 -- [-2622.761] (-2627.950) (-2628.428) (-2628.529) * (-2622.593) (-2646.955) [-2626.796] (-2629.290) -- 0:01:02
      849500 -- [-2623.879] (-2624.212) (-2626.219) (-2623.617) * [-2629.410] (-2637.385) (-2623.429) (-2622.312) -- 0:01:02
      850000 -- (-2628.254) [-2626.325] (-2626.858) (-2627.255) * (-2625.444) (-2627.840) (-2632.396) [-2629.844] -- 0:01:01

      Average standard deviation of split frequencies: 0.000222

      850500 -- (-2629.293) [-2629.730] (-2627.960) (-2631.938) * (-2626.523) (-2630.488) (-2630.383) [-2625.612] -- 0:01:01
      851000 -- [-2624.605] (-2642.419) (-2624.382) (-2629.548) * (-2632.113) [-2630.853] (-2630.186) (-2627.134) -- 0:01:01
      851500 -- [-2620.773] (-2640.346) (-2630.590) (-2626.886) * [-2628.576] (-2623.969) (-2625.740) (-2629.663) -- 0:01:01
      852000 -- (-2623.303) (-2627.975) [-2632.376] (-2630.755) * (-2621.756) (-2626.079) (-2629.847) [-2626.323] -- 0:01:00
      852500 -- (-2626.774) (-2628.462) [-2625.722] (-2625.855) * (-2624.400) [-2633.582] (-2626.420) (-2628.743) -- 0:01:00
      853000 -- (-2625.617) (-2630.855) [-2630.219] (-2623.076) * [-2621.486] (-2625.084) (-2628.110) (-2626.464) -- 0:01:00
      853500 -- [-2624.990] (-2628.347) (-2625.514) (-2632.966) * [-2626.361] (-2624.762) (-2628.941) (-2627.197) -- 0:01:00
      854000 -- (-2638.087) [-2631.374] (-2628.892) (-2634.731) * (-2631.293) (-2627.517) [-2624.435] (-2626.308) -- 0:01:00
      854500 -- (-2631.591) [-2619.128] (-2628.614) (-2622.137) * (-2628.635) [-2625.471] (-2623.075) (-2625.264) -- 0:00:59
      855000 -- (-2628.632) [-2623.446] (-2631.767) (-2624.909) * (-2629.084) (-2620.668) [-2631.007] (-2624.060) -- 0:00:59

      Average standard deviation of split frequencies: 0.000220

      855500 -- (-2636.046) (-2620.612) [-2623.154] (-2626.057) * (-2629.363) (-2630.128) [-2626.357] (-2633.629) -- 0:00:59
      856000 -- [-2631.522] (-2628.391) (-2620.930) (-2629.155) * (-2628.605) [-2625.081] (-2622.701) (-2622.990) -- 0:00:59
      856500 -- (-2625.449) (-2625.964) (-2624.479) [-2628.139] * (-2622.466) [-2620.520] (-2622.363) (-2626.010) -- 0:00:58
      857000 -- [-2627.866] (-2621.352) (-2621.228) (-2626.603) * (-2621.188) [-2627.968] (-2626.439) (-2633.380) -- 0:00:58
      857500 -- (-2626.964) [-2625.002] (-2634.604) (-2624.493) * (-2624.357) [-2623.261] (-2623.816) (-2624.917) -- 0:00:58
      858000 -- (-2630.875) [-2620.712] (-2627.183) (-2628.098) * (-2634.547) [-2621.518] (-2627.390) (-2626.362) -- 0:00:58
      858500 -- (-2630.155) (-2629.105) (-2631.144) [-2624.662] * (-2624.821) (-2628.048) [-2631.189] (-2626.562) -- 0:00:58
      859000 -- [-2628.323] (-2627.602) (-2629.053) (-2629.327) * (-2620.145) (-2626.134) (-2625.889) [-2624.988] -- 0:00:58
      859500 -- [-2624.166] (-2622.689) (-2628.976) (-2628.121) * [-2623.039] (-2621.453) (-2627.562) (-2622.801) -- 0:00:57
      860000 -- (-2626.724) (-2631.978) [-2625.634] (-2635.410) * [-2624.434] (-2628.985) (-2629.643) (-2625.688) -- 0:00:57

      Average standard deviation of split frequencies: 0.000219

      860500 -- (-2624.221) [-2634.614] (-2630.184) (-2624.668) * (-2621.978) (-2628.825) (-2628.981) [-2627.051] -- 0:00:57
      861000 -- (-2625.086) (-2636.286) (-2629.905) [-2626.706] * (-2626.237) [-2630.040] (-2625.314) (-2627.358) -- 0:00:57
      861500 -- [-2627.126] (-2626.792) (-2627.573) (-2628.985) * (-2622.794) (-2633.959) [-2621.182] (-2624.958) -- 0:00:57
      862000 -- (-2625.863) (-2630.415) [-2624.598] (-2630.574) * (-2628.393) (-2632.399) (-2629.233) [-2621.968] -- 0:00:56
      862500 -- (-2627.638) (-2625.348) [-2625.792] (-2624.095) * (-2630.605) (-2636.530) [-2623.782] (-2629.967) -- 0:00:56
      863000 -- (-2632.624) (-2622.603) [-2632.408] (-2631.699) * [-2628.711] (-2622.318) (-2624.318) (-2633.494) -- 0:00:56
      863500 -- [-2626.858] (-2626.309) (-2629.539) (-2629.655) * (-2624.440) (-2620.535) [-2623.880] (-2624.351) -- 0:00:56
      864000 -- (-2630.808) (-2628.541) [-2621.339] (-2623.654) * (-2626.681) [-2630.523] (-2623.622) (-2636.268) -- 0:00:56
      864500 -- (-2626.579) [-2631.016] (-2626.791) (-2622.894) * (-2632.529) (-2625.377) (-2626.849) [-2626.934] -- 0:00:55
      865000 -- (-2628.685) (-2624.559) [-2620.738] (-2624.615) * (-2627.933) (-2626.437) [-2623.192] (-2626.050) -- 0:00:55

      Average standard deviation of split frequencies: 0.000218

      865500 -- (-2623.891) (-2626.599) [-2623.463] (-2632.603) * (-2631.507) (-2625.489) (-2624.690) [-2622.772] -- 0:00:55
      866000 -- (-2622.728) [-2629.656] (-2625.810) (-2627.912) * (-2630.112) (-2629.663) [-2627.737] (-2623.946) -- 0:00:55
      866500 -- [-2624.832] (-2626.902) (-2624.867) (-2627.258) * (-2627.669) (-2620.888) (-2628.976) [-2624.669] -- 0:00:55
      867000 -- (-2635.595) (-2622.748) (-2621.300) [-2624.219] * [-2620.965] (-2626.174) (-2625.602) (-2630.550) -- 0:00:54
      867500 -- (-2626.254) (-2629.979) [-2616.000] (-2629.147) * (-2622.307) (-2633.831) [-2623.117] (-2634.032) -- 0:00:54
      868000 -- (-2623.154) (-2624.925) [-2623.589] (-2632.040) * [-2628.072] (-2634.897) (-2628.300) (-2622.567) -- 0:00:54
      868500 -- [-2624.460] (-2632.449) (-2624.166) (-2629.532) * (-2625.900) [-2630.579] (-2628.640) (-2623.023) -- 0:00:54
      869000 -- [-2626.874] (-2623.121) (-2629.456) (-2623.276) * (-2626.709) [-2623.549] (-2620.909) (-2630.886) -- 0:00:53
      869500 -- (-2633.790) (-2626.648) [-2628.601] (-2628.124) * (-2637.651) (-2630.832) [-2623.186] (-2624.962) -- 0:00:53
      870000 -- (-2629.498) (-2622.968) (-2622.581) [-2619.884] * (-2632.579) (-2627.855) (-2622.774) [-2621.180] -- 0:00:53

      Average standard deviation of split frequencies: 0.000217

      870500 -- (-2629.501) (-2626.728) [-2619.701] (-2625.108) * (-2626.006) (-2631.272) [-2628.296] (-2626.503) -- 0:00:53
      871000 -- [-2630.998] (-2633.568) (-2623.076) (-2628.242) * (-2628.881) (-2630.120) (-2625.157) [-2636.087] -- 0:00:53
      871500 -- (-2628.194) (-2627.507) [-2629.872] (-2621.587) * [-2626.009] (-2623.160) (-2630.905) (-2623.683) -- 0:00:52
      872000 -- (-2630.164) [-2622.807] (-2621.842) (-2620.044) * (-2628.229) (-2627.190) (-2630.118) [-2630.294] -- 0:00:52
      872500 -- [-2620.660] (-2626.736) (-2626.181) (-2623.486) * (-2625.568) [-2628.324] (-2629.047) (-2629.564) -- 0:00:52
      873000 -- (-2623.378) (-2631.306) (-2631.492) [-2622.175] * (-2627.970) [-2632.168] (-2638.646) (-2627.618) -- 0:00:52
      873500 -- (-2622.981) [-2623.030] (-2624.017) (-2624.583) * (-2620.398) (-2624.543) (-2621.287) [-2623.493] -- 0:00:52
      874000 -- [-2621.575] (-2622.412) (-2626.924) (-2624.582) * (-2625.832) [-2622.525] (-2627.417) (-2632.103) -- 0:00:51
      874500 -- (-2622.376) (-2627.181) [-2626.730] (-2630.867) * [-2628.977] (-2621.972) (-2629.184) (-2628.989) -- 0:00:51
      875000 -- (-2622.542) (-2636.509) (-2625.531) [-2634.490] * [-2627.946] (-2631.790) (-2622.962) (-2631.695) -- 0:00:51

      Average standard deviation of split frequencies: 0.000215

      875500 -- (-2623.373) [-2628.627] (-2627.167) (-2627.434) * (-2635.619) [-2624.271] (-2630.866) (-2624.129) -- 0:00:51
      876000 -- (-2623.408) (-2628.367) [-2619.690] (-2624.971) * (-2634.188) (-2630.322) [-2625.158] (-2632.290) -- 0:00:51
      876500 -- [-2625.141] (-2629.355) (-2628.133) (-2632.031) * (-2627.611) (-2622.197) [-2621.265] (-2623.611) -- 0:00:50
      877000 -- (-2624.564) (-2628.583) (-2630.675) [-2623.387] * (-2627.194) (-2626.959) [-2619.696] (-2619.754) -- 0:00:50
      877500 -- (-2629.436) (-2635.764) (-2624.134) [-2624.187] * (-2621.973) [-2630.751] (-2624.030) (-2625.720) -- 0:00:50
      878000 -- (-2631.649) (-2628.515) (-2622.522) [-2622.638] * [-2628.365] (-2630.387) (-2627.378) (-2626.420) -- 0:00:50
      878500 -- [-2625.071] (-2634.879) (-2622.286) (-2628.190) * (-2629.459) (-2622.464) (-2623.595) [-2620.153] -- 0:00:50
      879000 -- [-2625.052] (-2633.254) (-2621.351) (-2624.354) * [-2628.188] (-2635.404) (-2622.762) (-2620.486) -- 0:00:49
      879500 -- [-2623.957] (-2630.046) (-2620.148) (-2627.245) * (-2624.910) (-2633.939) (-2631.269) [-2621.662] -- 0:00:49
      880000 -- (-2625.217) (-2628.009) [-2627.789] (-2630.244) * [-2622.871] (-2624.946) (-2623.919) (-2623.494) -- 0:00:49

      Average standard deviation of split frequencies: 0.000214

      880500 -- (-2623.163) (-2627.675) (-2635.458) [-2625.009] * (-2628.724) [-2628.812] (-2622.389) (-2625.401) -- 0:00:49
      881000 -- (-2622.263) (-2631.092) [-2623.900] (-2629.902) * (-2629.405) (-2630.572) [-2630.507] (-2632.306) -- 0:00:49
      881500 -- (-2623.144) (-2635.048) (-2632.403) [-2626.771] * (-2624.094) (-2626.891) (-2620.157) [-2631.261] -- 0:00:48
      882000 -- [-2630.901] (-2630.011) (-2630.740) (-2624.693) * (-2631.147) (-2621.443) [-2623.729] (-2624.453) -- 0:00:48
      882500 -- [-2626.663] (-2632.277) (-2626.537) (-2629.767) * [-2623.216] (-2632.734) (-2622.309) (-2629.277) -- 0:00:48
      883000 -- (-2627.105) [-2627.910] (-2629.406) (-2623.226) * (-2626.524) (-2620.964) [-2630.788] (-2633.052) -- 0:00:48
      883500 -- (-2627.583) (-2630.698) (-2625.558) [-2627.242] * (-2630.997) (-2631.467) (-2626.299) [-2631.292] -- 0:00:47
      884000 -- (-2632.495) (-2624.212) [-2622.344] (-2624.569) * (-2630.494) (-2633.741) [-2626.467] (-2630.808) -- 0:00:47
      884500 -- (-2630.266) (-2623.825) [-2630.087] (-2624.236) * (-2623.433) [-2619.676] (-2626.896) (-2630.063) -- 0:00:47
      885000 -- [-2624.442] (-2631.305) (-2627.117) (-2619.673) * [-2625.007] (-2624.214) (-2637.373) (-2624.132) -- 0:00:47

      Average standard deviation of split frequencies: 0.000213

      885500 -- [-2628.508] (-2635.784) (-2623.069) (-2629.344) * (-2626.388) (-2628.555) (-2629.926) [-2627.282] -- 0:00:47
      886000 -- (-2634.501) [-2631.172] (-2625.328) (-2623.833) * [-2627.280] (-2625.729) (-2633.047) (-2630.719) -- 0:00:46
      886500 -- (-2621.826) (-2618.508) (-2625.752) [-2619.195] * (-2622.830) (-2629.174) (-2629.578) [-2629.510] -- 0:00:46
      887000 -- [-2628.168] (-2625.386) (-2628.394) (-2623.380) * (-2623.198) (-2624.769) (-2632.908) [-2622.739] -- 0:00:46
      887500 -- (-2631.327) (-2626.096) (-2629.722) [-2625.992] * (-2631.832) (-2627.968) [-2629.940] (-2626.139) -- 0:00:46
      888000 -- (-2625.316) (-2622.303) (-2623.592) [-2628.417] * (-2629.450) [-2633.751] (-2623.387) (-2626.773) -- 0:00:46
      888500 -- [-2624.323] (-2629.085) (-2626.687) (-2620.122) * (-2625.519) (-2631.828) (-2625.590) [-2619.399] -- 0:00:45
      889000 -- (-2624.788) (-2626.969) (-2633.983) [-2629.043] * [-2627.579] (-2627.895) (-2627.988) (-2619.982) -- 0:00:45
      889500 -- (-2625.594) (-2632.573) [-2634.213] (-2625.505) * (-2631.743) [-2621.952] (-2628.720) (-2629.614) -- 0:00:45
      890000 -- (-2633.933) (-2622.669) [-2630.977] (-2623.962) * (-2623.609) [-2624.717] (-2629.448) (-2621.291) -- 0:00:45

      Average standard deviation of split frequencies: 0.000212

      890500 -- (-2632.232) (-2625.569) [-2624.781] (-2624.582) * [-2634.991] (-2627.582) (-2633.161) (-2621.693) -- 0:00:45
      891000 -- [-2622.760] (-2631.307) (-2630.011) (-2631.894) * (-2629.239) (-2629.634) (-2633.561) [-2629.384] -- 0:00:44
      891500 -- (-2632.162) (-2630.899) [-2622.877] (-2632.527) * (-2638.873) (-2626.311) [-2625.752] (-2627.199) -- 0:00:44
      892000 -- (-2634.543) (-2631.006) [-2624.501] (-2633.536) * (-2625.578) (-2625.317) [-2629.051] (-2632.087) -- 0:00:44
      892500 -- (-2627.837) [-2629.449] (-2626.920) (-2624.167) * (-2623.619) [-2623.181] (-2626.357) (-2626.610) -- 0:00:44
      893000 -- (-2637.290) (-2635.843) (-2628.998) [-2627.333] * (-2622.084) (-2633.564) (-2634.141) [-2626.225] -- 0:00:44
      893500 -- (-2632.859) [-2626.660] (-2630.128) (-2626.529) * [-2624.175] (-2631.173) (-2622.977) (-2629.181) -- 0:00:43
      894000 -- [-2629.250] (-2629.617) (-2626.811) (-2629.042) * (-2621.988) (-2631.119) (-2620.279) [-2631.468] -- 0:00:43
      894500 -- (-2634.695) (-2622.476) (-2627.283) [-2625.670] * (-2626.117) (-2630.441) (-2628.273) [-2625.237] -- 0:00:43
      895000 -- (-2629.161) (-2620.580) [-2626.238] (-2627.496) * (-2625.114) (-2625.279) (-2631.321) [-2621.854] -- 0:00:43

      Average standard deviation of split frequencies: 0.000210

      895500 -- (-2622.455) (-2625.602) [-2624.071] (-2623.752) * (-2627.352) (-2623.104) [-2623.806] (-2627.636) -- 0:00:43
      896000 -- (-2630.163) [-2625.462] (-2628.916) (-2621.084) * (-2634.526) (-2625.689) (-2621.105) [-2622.818] -- 0:00:42
      896500 -- (-2627.054) (-2621.578) (-2627.944) [-2631.514] * (-2630.429) (-2634.058) [-2624.034] (-2621.336) -- 0:00:42
      897000 -- (-2625.745) (-2619.737) [-2628.265] (-2629.777) * [-2620.504] (-2630.436) (-2629.639) (-2624.401) -- 0:00:42
      897500 -- (-2627.020) [-2623.724] (-2632.013) (-2629.068) * [-2626.711] (-2628.112) (-2623.916) (-2622.025) -- 0:00:42
      898000 -- (-2631.276) (-2623.933) [-2625.644] (-2624.959) * (-2625.656) (-2627.815) (-2625.472) [-2626.818] -- 0:00:42
      898500 -- (-2622.483) (-2623.487) (-2625.977) [-2620.739] * (-2621.602) [-2629.439] (-2628.945) (-2628.319) -- 0:00:41
      899000 -- [-2625.378] (-2627.699) (-2627.538) (-2620.563) * (-2627.192) (-2626.309) (-2624.855) [-2622.996] -- 0:00:41
      899500 -- (-2624.306) (-2630.420) (-2633.247) [-2622.534] * (-2625.166) (-2637.806) (-2620.223) [-2628.701] -- 0:00:41
      900000 -- [-2621.311] (-2625.707) (-2635.271) (-2627.682) * (-2632.985) (-2622.060) [-2625.707] (-2629.193) -- 0:00:41

      Average standard deviation of split frequencies: 0.000209

      900500 -- (-2625.277) [-2624.249] (-2631.401) (-2630.695) * (-2625.794) [-2627.930] (-2625.234) (-2627.698) -- 0:00:40
      901000 -- [-2627.602] (-2621.810) (-2627.383) (-2626.659) * (-2639.850) (-2623.389) [-2626.200] (-2619.602) -- 0:00:40
      901500 -- (-2622.677) (-2625.046) (-2623.953) [-2627.012] * (-2629.958) (-2626.341) [-2625.686] (-2623.288) -- 0:00:40
      902000 -- [-2625.824] (-2626.002) (-2624.213) (-2624.293) * (-2627.426) [-2625.388] (-2629.076) (-2622.197) -- 0:00:40
      902500 -- [-2622.977] (-2630.199) (-2626.648) (-2626.006) * (-2624.282) (-2622.182) (-2625.176) [-2626.503] -- 0:00:40
      903000 -- (-2621.328) (-2629.236) (-2635.163) [-2620.659] * (-2620.047) (-2625.420) (-2634.325) [-2626.196] -- 0:00:39
      903500 -- (-2628.343) [-2621.411] (-2626.394) (-2631.562) * (-2629.378) (-2628.540) (-2621.553) [-2621.971] -- 0:00:39
      904000 -- (-2629.920) (-2623.813) [-2627.675] (-2629.092) * [-2628.902] (-2628.128) (-2631.788) (-2632.946) -- 0:00:39
      904500 -- (-2630.087) [-2621.084] (-2626.690) (-2625.387) * [-2626.777] (-2630.538) (-2623.088) (-2627.704) -- 0:00:39
      905000 -- (-2620.556) (-2631.736) (-2623.950) [-2623.926] * (-2628.856) [-2625.054] (-2625.456) (-2635.046) -- 0:00:39

      Average standard deviation of split frequencies: 0.000208

      905500 -- [-2625.502] (-2635.070) (-2626.375) (-2622.638) * [-2620.582] (-2625.939) (-2628.730) (-2630.381) -- 0:00:38
      906000 -- (-2626.485) [-2628.993] (-2624.868) (-2628.025) * (-2632.413) (-2627.694) (-2632.745) [-2618.540] -- 0:00:38
      906500 -- [-2625.061] (-2630.198) (-2626.706) (-2630.548) * [-2629.408] (-2625.827) (-2632.607) (-2625.631) -- 0:00:38
      907000 -- (-2629.584) (-2636.228) (-2624.222) [-2624.008] * (-2634.191) [-2628.287] (-2632.506) (-2629.414) -- 0:00:38
      907500 -- (-2626.511) [-2632.829] (-2633.066) (-2630.677) * [-2621.158] (-2623.858) (-2622.477) (-2629.079) -- 0:00:38
      908000 -- (-2633.876) [-2625.286] (-2622.774) (-2629.837) * (-2622.773) (-2625.237) [-2624.939] (-2631.656) -- 0:00:37
      908500 -- [-2619.310] (-2629.609) (-2625.621) (-2633.261) * (-2627.958) [-2628.091] (-2630.648) (-2626.589) -- 0:00:37
      909000 -- (-2632.506) (-2626.893) [-2621.047] (-2623.150) * (-2625.323) (-2626.519) (-2623.522) [-2622.288] -- 0:00:37
      909500 -- (-2624.940) [-2626.717] (-2621.913) (-2629.809) * (-2626.473) [-2628.712] (-2627.751) (-2624.557) -- 0:00:37
      910000 -- [-2625.544] (-2632.538) (-2623.467) (-2624.167) * (-2624.647) (-2634.677) [-2623.943] (-2634.979) -- 0:00:36

      Average standard deviation of split frequencies: 0.000207

      910500 -- (-2622.588) [-2625.808] (-2632.152) (-2624.970) * [-2626.325] (-2628.375) (-2623.222) (-2631.790) -- 0:00:36
      911000 -- [-2625.601] (-2632.063) (-2624.542) (-2628.140) * (-2625.943) (-2629.800) [-2625.596] (-2625.633) -- 0:00:36
      911500 -- [-2624.681] (-2624.562) (-2621.011) (-2630.476) * (-2627.394) [-2624.916] (-2627.928) (-2628.582) -- 0:00:36
      912000 -- [-2620.753] (-2624.521) (-2626.511) (-2628.326) * [-2625.955] (-2626.507) (-2631.870) (-2626.544) -- 0:00:36
      912500 -- (-2627.819) (-2625.244) (-2637.088) [-2624.066] * (-2623.816) (-2623.187) [-2620.829] (-2624.835) -- 0:00:35
      913000 -- [-2626.915] (-2632.172) (-2634.298) (-2622.866) * [-2620.017] (-2630.780) (-2625.921) (-2626.780) -- 0:00:35
      913500 -- (-2638.550) (-2626.599) (-2636.607) [-2619.656] * (-2626.686) (-2630.752) (-2623.908) [-2625.866] -- 0:00:35
      914000 -- (-2624.303) [-2624.530] (-2634.424) (-2626.509) * (-2622.713) (-2632.402) [-2625.864] (-2630.364) -- 0:00:35
      914500 -- (-2638.860) [-2622.722] (-2632.848) (-2626.877) * (-2630.147) [-2622.670] (-2625.581) (-2634.380) -- 0:00:35
      915000 -- [-2623.830] (-2621.196) (-2624.868) (-2625.187) * (-2625.694) (-2625.700) (-2625.851) [-2624.205] -- 0:00:34

      Average standard deviation of split frequencies: 0.000206

      915500 -- (-2621.169) (-2621.130) (-2625.219) [-2628.104] * (-2623.901) (-2634.447) [-2622.852] (-2626.674) -- 0:00:34
      916000 -- (-2630.180) [-2626.436] (-2624.962) (-2623.712) * (-2631.770) (-2629.095) [-2621.083] (-2631.481) -- 0:00:34
      916500 -- (-2624.429) (-2631.282) [-2622.608] (-2626.826) * (-2629.077) [-2620.854] (-2629.419) (-2636.336) -- 0:00:34
      917000 -- (-2625.548) [-2631.274] (-2630.960) (-2625.828) * [-2618.979] (-2623.781) (-2627.114) (-2626.969) -- 0:00:34
      917500 -- (-2626.462) (-2627.094) (-2629.304) [-2625.084] * (-2633.520) (-2626.173) (-2628.401) [-2622.866] -- 0:00:33
      918000 -- (-2623.377) (-2623.318) [-2624.924] (-2632.586) * (-2625.701) (-2634.408) [-2622.885] (-2625.482) -- 0:00:33
      918500 -- [-2627.185] (-2624.914) (-2625.345) (-2627.613) * (-2627.045) (-2625.290) [-2622.579] (-2626.197) -- 0:00:33
      919000 -- (-2627.579) [-2626.021] (-2621.179) (-2624.901) * (-2637.814) (-2636.040) (-2625.264) [-2624.485] -- 0:00:33
      919500 -- (-2624.165) (-2621.568) (-2620.953) [-2619.165] * (-2627.431) [-2622.383] (-2626.034) (-2626.651) -- 0:00:33
      920000 -- [-2625.603] (-2631.600) (-2621.925) (-2624.470) * (-2630.727) (-2623.903) [-2620.414] (-2623.442) -- 0:00:32

      Average standard deviation of split frequencies: 0.000205

      920500 -- (-2628.164) (-2632.962) (-2624.916) [-2627.540] * (-2624.545) (-2632.138) (-2620.568) [-2627.272] -- 0:00:32
      921000 -- [-2622.180] (-2631.007) (-2622.039) (-2622.527) * (-2630.758) (-2632.726) [-2627.670] (-2626.194) -- 0:00:32
      921500 -- (-2622.915) (-2633.161) (-2629.590) [-2624.593] * (-2622.657) (-2628.880) (-2625.282) [-2627.845] -- 0:00:32
      922000 -- [-2619.274] (-2627.805) (-2623.601) (-2626.354) * (-2626.278) (-2628.097) [-2629.908] (-2623.213) -- 0:00:32
      922500 -- (-2623.456) (-2628.071) [-2621.594] (-2626.502) * (-2635.295) (-2628.536) (-2632.857) [-2627.212] -- 0:00:31
      923000 -- (-2622.676) (-2624.232) [-2622.885] (-2625.706) * (-2625.011) (-2632.523) [-2628.043] (-2627.332) -- 0:00:31
      923500 -- (-2621.380) [-2629.927] (-2635.511) (-2628.451) * [-2629.306] (-2628.298) (-2624.033) (-2626.817) -- 0:00:31
      924000 -- [-2626.738] (-2633.523) (-2631.351) (-2631.394) * (-2623.698) (-2643.380) [-2628.929] (-2625.099) -- 0:00:31
      924500 -- (-2623.574) [-2632.483] (-2633.190) (-2624.568) * (-2625.974) (-2629.768) (-2628.989) [-2621.960] -- 0:00:31
      925000 -- (-2629.169) (-2629.152) [-2622.103] (-2629.772) * [-2628.487] (-2626.891) (-2622.666) (-2621.332) -- 0:00:30

      Average standard deviation of split frequencies: 0.000204

      925500 -- (-2634.361) [-2622.859] (-2632.554) (-2619.536) * (-2631.655) (-2627.018) [-2626.061] (-2627.471) -- 0:00:30
      926000 -- (-2624.550) (-2624.794) (-2625.637) [-2624.850] * (-2620.436) (-2627.881) [-2644.605] (-2620.907) -- 0:00:30
      926500 -- [-2622.650] (-2621.450) (-2632.357) (-2625.630) * (-2628.214) (-2628.554) [-2627.409] (-2628.763) -- 0:00:30
      927000 -- (-2625.732) [-2622.533] (-2620.788) (-2628.405) * (-2626.834) (-2632.442) (-2627.529) [-2627.916] -- 0:00:30
      927500 -- (-2627.284) (-2625.413) [-2618.788] (-2626.278) * (-2631.377) (-2638.363) [-2622.437] (-2625.402) -- 0:00:29
      928000 -- (-2634.843) [-2627.269] (-2622.608) (-2628.891) * (-2628.720) (-2624.053) (-2626.568) [-2629.341] -- 0:00:29
      928500 -- (-2621.468) (-2626.120) [-2624.384] (-2623.766) * (-2630.507) (-2631.045) [-2625.977] (-2632.352) -- 0:00:29
      929000 -- (-2628.890) (-2622.818) [-2623.194] (-2631.863) * [-2630.264] (-2627.761) (-2625.924) (-2627.889) -- 0:00:29
      929500 -- [-2630.972] (-2621.073) (-2629.229) (-2624.908) * (-2626.873) [-2630.256] (-2627.573) (-2626.204) -- 0:00:28
      930000 -- (-2625.167) [-2625.526] (-2626.955) (-2627.052) * (-2626.028) (-2621.776) (-2626.646) [-2622.864] -- 0:00:28

      Average standard deviation of split frequencies: 0.000203

      930500 -- [-2628.699] (-2620.743) (-2623.120) (-2629.977) * (-2626.534) (-2629.505) (-2629.515) [-2623.125] -- 0:00:28
      931000 -- (-2633.527) [-2629.924] (-2632.855) (-2620.403) * (-2626.508) (-2624.915) (-2634.298) [-2624.343] -- 0:00:28
      931500 -- [-2623.235] (-2622.241) (-2632.464) (-2626.192) * [-2626.047] (-2624.200) (-2621.947) (-2635.482) -- 0:00:28
      932000 -- (-2633.632) (-2627.793) (-2629.028) [-2626.443] * [-2626.968] (-2623.004) (-2622.172) (-2635.291) -- 0:00:27
      932500 -- (-2624.211) [-2619.586] (-2630.436) (-2625.695) * [-2623.666] (-2629.853) (-2623.178) (-2624.195) -- 0:00:27
      933000 -- (-2633.471) [-2624.454] (-2624.732) (-2632.787) * (-2635.830) (-2624.962) [-2628.363] (-2630.221) -- 0:00:27
      933500 -- (-2627.971) (-2623.742) [-2620.577] (-2625.424) * [-2624.040] (-2635.597) (-2622.071) (-2626.693) -- 0:00:27
      934000 -- [-2624.905] (-2634.353) (-2628.577) (-2625.885) * [-2628.594] (-2633.148) (-2626.160) (-2630.842) -- 0:00:27
      934500 -- (-2628.395) (-2629.092) [-2623.258] (-2622.434) * (-2628.750) (-2626.078) [-2625.689] (-2628.009) -- 0:00:26
      935000 -- (-2622.311) [-2629.170] (-2636.677) (-2622.800) * (-2630.302) [-2627.061] (-2625.832) (-2623.461) -- 0:00:26

      Average standard deviation of split frequencies: 0.000201

      935500 -- [-2627.691] (-2624.308) (-2629.964) (-2626.454) * (-2627.085) (-2633.796) (-2626.912) [-2624.267] -- 0:00:26
      936000 -- [-2631.127] (-2622.387) (-2626.698) (-2632.196) * [-2621.648] (-2628.937) (-2623.362) (-2627.831) -- 0:00:26
      936500 -- (-2624.261) (-2628.380) [-2625.698] (-2637.769) * (-2632.142) (-2625.933) (-2629.364) [-2623.736] -- 0:00:26
      937000 -- [-2629.678] (-2642.191) (-2620.606) (-2633.916) * (-2624.382) (-2621.288) (-2628.740) [-2623.698] -- 0:00:25
      937500 -- (-2624.407) (-2630.886) [-2628.693] (-2631.354) * (-2630.280) (-2630.265) [-2622.641] (-2621.632) -- 0:00:25
      938000 -- (-2626.602) (-2628.748) [-2628.516] (-2630.281) * (-2625.388) (-2641.002) (-2627.408) [-2621.458] -- 0:00:25
      938500 -- (-2627.902) (-2623.299) (-2627.646) [-2627.464] * [-2632.628] (-2636.673) (-2633.348) (-2628.510) -- 0:00:25
      939000 -- (-2629.979) (-2630.298) [-2629.168] (-2636.417) * (-2624.359) [-2626.206] (-2632.433) (-2631.840) -- 0:00:25
      939500 -- (-2629.011) (-2626.595) (-2624.753) [-2631.246] * (-2622.525) [-2626.191] (-2624.926) (-2627.647) -- 0:00:24
      940000 -- (-2624.980) [-2628.946] (-2638.508) (-2626.250) * (-2628.847) (-2623.084) (-2623.335) [-2628.846] -- 0:00:24

      Average standard deviation of split frequencies: 0.000200

      940500 -- (-2622.875) [-2619.331] (-2629.152) (-2628.733) * (-2628.683) (-2623.348) [-2626.796] (-2622.574) -- 0:00:24
      941000 -- (-2623.409) [-2622.673] (-2629.821) (-2622.145) * (-2628.437) [-2627.975] (-2625.891) (-2631.714) -- 0:00:24
      941500 -- (-2624.403) (-2628.006) (-2631.664) [-2625.729] * (-2628.405) (-2635.930) (-2630.876) [-2627.760] -- 0:00:24
      942000 -- (-2628.199) (-2624.549) [-2633.598] (-2628.249) * (-2632.068) (-2625.337) [-2625.184] (-2626.951) -- 0:00:23
      942500 -- [-2626.956] (-2626.288) (-2628.810) (-2626.300) * (-2630.233) (-2628.454) (-2628.489) [-2626.391] -- 0:00:23
      943000 -- (-2636.292) (-2627.810) [-2625.324] (-2633.208) * [-2623.102] (-2625.491) (-2634.224) (-2623.826) -- 0:00:23
      943500 -- (-2624.075) (-2629.094) (-2628.349) [-2627.274] * [-2632.430] (-2629.114) (-2628.656) (-2628.949) -- 0:00:23
      944000 -- (-2625.482) [-2620.147] (-2628.225) (-2634.527) * [-2622.748] (-2622.557) (-2627.769) (-2630.093) -- 0:00:23
      944500 -- (-2628.481) (-2621.258) [-2630.775] (-2630.533) * [-2620.149] (-2626.730) (-2624.228) (-2621.767) -- 0:00:22
      945000 -- (-2629.981) (-2627.433) (-2633.618) [-2621.895] * [-2620.809] (-2619.109) (-2624.103) (-2631.305) -- 0:00:22

      Average standard deviation of split frequencies: 0.000199

      945500 -- [-2628.356] (-2634.790) (-2620.350) (-2625.424) * [-2625.934] (-2623.097) (-2629.072) (-2627.562) -- 0:00:22
      946000 -- (-2625.883) (-2629.768) (-2631.792) [-2630.903] * [-2633.123] (-2623.116) (-2629.884) (-2628.452) -- 0:00:22
      946500 -- (-2626.921) (-2629.244) [-2620.197] (-2634.223) * [-2629.398] (-2627.996) (-2624.912) (-2631.353) -- 0:00:21
      947000 -- (-2624.962) (-2630.246) [-2621.106] (-2627.048) * [-2631.765] (-2625.024) (-2628.702) (-2632.882) -- 0:00:21
      947500 -- (-2633.088) (-2623.824) [-2619.189] (-2633.457) * (-2635.583) (-2628.597) [-2627.303] (-2622.908) -- 0:00:21
      948000 -- [-2631.247] (-2631.161) (-2626.457) (-2627.802) * (-2632.169) (-2626.740) [-2622.129] (-2627.852) -- 0:00:21
      948500 -- (-2635.262) (-2630.586) [-2628.112] (-2622.521) * (-2630.119) [-2625.362] (-2623.414) (-2624.932) -- 0:00:21
      949000 -- [-2628.989] (-2627.385) (-2628.170) (-2628.127) * (-2635.484) [-2619.003] (-2631.188) (-2623.838) -- 0:00:20
      949500 -- (-2635.157) (-2634.368) [-2629.349] (-2627.563) * (-2637.916) (-2625.671) (-2629.889) [-2620.625] -- 0:00:20
      950000 -- [-2625.800] (-2622.692) (-2633.792) (-2623.604) * (-2651.893) (-2627.652) [-2629.220] (-2636.892) -- 0:00:20

      Average standard deviation of split frequencies: 0.000198

      950500 -- (-2631.646) (-2622.243) (-2624.807) [-2621.390] * (-2638.368) [-2625.879] (-2626.695) (-2624.294) -- 0:00:20
      951000 -- [-2630.005] (-2630.866) (-2626.157) (-2625.610) * [-2626.886] (-2622.259) (-2626.719) (-2632.304) -- 0:00:20
      951500 -- (-2629.770) (-2625.674) [-2626.829] (-2624.675) * (-2626.193) [-2622.674] (-2623.932) (-2624.376) -- 0:00:19
      952000 -- (-2631.285) (-2638.344) [-2638.214] (-2625.818) * (-2621.889) (-2628.691) (-2622.058) [-2622.078] -- 0:00:19
      952500 -- (-2627.911) [-2627.235] (-2624.619) (-2630.112) * (-2626.459) (-2623.313) (-2632.531) [-2623.339] -- 0:00:19
      953000 -- (-2622.826) (-2628.290) [-2622.665] (-2627.127) * (-2629.414) (-2624.273) (-2632.815) [-2622.576] -- 0:00:19
      953500 -- [-2627.741] (-2626.336) (-2631.486) (-2627.073) * [-2623.611] (-2628.863) (-2633.257) (-2625.400) -- 0:00:19
      954000 -- (-2623.807) [-2625.001] (-2632.315) (-2629.704) * (-2623.234) (-2630.727) (-2635.993) [-2629.724] -- 0:00:18
      954500 -- (-2628.837) (-2625.710) (-2626.514) [-2622.184] * (-2623.723) [-2628.339] (-2628.853) (-2633.150) -- 0:00:18
      955000 -- (-2621.949) [-2623.619] (-2637.963) (-2628.345) * (-2630.892) (-2628.573) (-2624.920) [-2625.582] -- 0:00:18

      Average standard deviation of split frequencies: 0.000197

      955500 -- [-2628.430] (-2629.825) (-2625.641) (-2628.742) * [-2625.467] (-2627.246) (-2633.259) (-2632.630) -- 0:00:18
      956000 -- (-2626.884) (-2630.166) [-2627.130] (-2626.101) * (-2620.379) (-2638.886) [-2625.467] (-2627.278) -- 0:00:18
      956500 -- (-2630.134) (-2628.442) [-2628.208] (-2624.976) * (-2625.772) (-2633.214) (-2623.214) [-2624.350] -- 0:00:17
      957000 -- [-2624.151] (-2636.592) (-2637.565) (-2626.190) * (-2617.991) (-2627.813) [-2624.714] (-2630.909) -- 0:00:17
      957500 -- [-2618.644] (-2629.381) (-2632.175) (-2628.959) * (-2627.248) [-2628.311] (-2626.564) (-2621.833) -- 0:00:17
      958000 -- (-2621.399) (-2626.894) [-2625.999] (-2632.248) * [-2624.921] (-2626.897) (-2633.301) (-2620.393) -- 0:00:17
      958500 -- (-2623.547) (-2630.354) [-2621.019] (-2622.598) * (-2632.759) (-2630.607) (-2630.868) [-2625.530] -- 0:00:17
      959000 -- (-2635.534) (-2634.930) (-2630.893) [-2619.778] * (-2637.207) (-2621.842) [-2628.515] (-2627.557) -- 0:00:16
      959500 -- (-2632.089) (-2624.977) (-2621.076) [-2629.741] * (-2630.738) [-2623.569] (-2632.473) (-2627.136) -- 0:00:16
      960000 -- (-2629.513) (-2627.732) (-2625.010) [-2624.197] * (-2623.329) [-2618.702] (-2631.244) (-2628.554) -- 0:00:16

      Average standard deviation of split frequencies: 0.000196

      960500 -- [-2629.208] (-2624.872) (-2624.189) (-2628.236) * (-2626.923) (-2627.237) [-2625.324] (-2634.137) -- 0:00:16
      961000 -- [-2624.896] (-2631.627) (-2624.090) (-2626.314) * (-2626.095) (-2632.778) [-2626.169] (-2628.473) -- 0:00:16
      961500 -- (-2630.190) [-2622.646] (-2624.310) (-2626.968) * (-2629.894) [-2631.279] (-2625.920) (-2626.861) -- 0:00:15
      962000 -- [-2623.189] (-2639.275) (-2622.340) (-2628.756) * (-2625.681) (-2627.028) [-2630.027] (-2628.165) -- 0:00:15
      962500 -- (-2622.459) [-2622.970] (-2629.914) (-2628.008) * (-2628.144) [-2624.686] (-2622.303) (-2621.597) -- 0:00:15
      963000 -- [-2620.171] (-2624.986) (-2634.339) (-2630.037) * (-2623.417) (-2624.851) (-2624.499) [-2621.983] -- 0:00:15
      963500 -- (-2628.906) (-2630.790) [-2634.641] (-2624.902) * (-2623.975) (-2628.841) (-2625.275) [-2625.242] -- 0:00:15
      964000 -- (-2626.652) (-2621.381) [-2625.297] (-2626.979) * [-2626.147] (-2632.888) (-2639.311) (-2632.299) -- 0:00:14
      964500 -- (-2630.147) (-2634.779) (-2627.642) [-2622.808] * (-2629.201) (-2631.142) [-2632.161] (-2626.701) -- 0:00:14
      965000 -- (-2628.119) (-2624.991) [-2622.959] (-2621.888) * (-2626.511) (-2623.455) (-2629.250) [-2621.038] -- 0:00:14

      Average standard deviation of split frequencies: 0.000195

      965500 -- (-2630.726) [-2626.801] (-2627.817) (-2623.192) * [-2626.090] (-2621.577) (-2626.742) (-2623.178) -- 0:00:14
      966000 -- (-2631.290) [-2626.134] (-2625.372) (-2624.631) * (-2628.747) (-2623.948) (-2631.117) [-2626.330] -- 0:00:13
      966500 -- (-2642.593) (-2630.219) [-2628.613] (-2623.659) * [-2627.209] (-2628.883) (-2627.613) (-2623.307) -- 0:00:13
      967000 -- (-2626.129) [-2623.778] (-2626.547) (-2625.060) * (-2627.395) (-2637.728) [-2626.525] (-2626.230) -- 0:00:13
      967500 -- [-2629.376] (-2626.679) (-2628.469) (-2623.107) * (-2629.445) (-2632.910) [-2623.037] (-2626.251) -- 0:00:13
      968000 -- (-2626.422) (-2624.221) (-2631.523) [-2622.141] * (-2624.992) (-2631.006) (-2629.470) [-2624.275] -- 0:00:13
      968500 -- (-2630.724) [-2624.862] (-2624.815) (-2626.217) * [-2628.216] (-2628.899) (-2630.988) (-2626.563) -- 0:00:12
      969000 -- [-2625.556] (-2628.315) (-2633.082) (-2627.456) * (-2623.578) (-2631.875) [-2625.520] (-2623.663) -- 0:00:12
      969500 -- [-2630.072] (-2628.818) (-2636.024) (-2632.577) * [-2626.381] (-2622.920) (-2626.307) (-2624.429) -- 0:00:12
      970000 -- (-2625.011) (-2620.772) [-2626.753] (-2626.392) * (-2622.940) [-2621.222] (-2623.857) (-2620.221) -- 0:00:12

      Average standard deviation of split frequencies: 0.000194

      970500 -- [-2624.695] (-2631.885) (-2639.067) (-2624.587) * (-2627.070) [-2628.393] (-2635.858) (-2622.895) -- 0:00:12
      971000 -- (-2623.435) [-2625.546] (-2628.874) (-2632.947) * (-2629.473) (-2633.032) [-2626.103] (-2626.471) -- 0:00:11
      971500 -- [-2624.979] (-2624.894) (-2630.732) (-2626.607) * [-2625.664] (-2624.257) (-2627.393) (-2627.681) -- 0:00:11
      972000 -- (-2629.159) [-2623.002] (-2628.518) (-2630.288) * (-2628.519) (-2629.214) (-2624.791) [-2621.603] -- 0:00:11
      972500 -- [-2629.653] (-2622.477) (-2628.821) (-2630.889) * (-2631.623) (-2631.662) [-2625.117] (-2618.207) -- 0:00:11
      973000 -- [-2621.411] (-2627.304) (-2621.015) (-2624.063) * [-2624.766] (-2623.273) (-2624.968) (-2627.359) -- 0:00:11
      973500 -- (-2628.077) (-2638.689) [-2623.573] (-2626.887) * [-2623.054] (-2625.065) (-2628.111) (-2625.044) -- 0:00:10
      974000 -- (-2631.504) (-2628.101) (-2623.947) [-2623.743] * (-2624.402) (-2625.645) (-2626.297) [-2622.314] -- 0:00:10
      974500 -- (-2627.554) [-2623.779] (-2624.398) (-2627.756) * (-2629.961) [-2620.709] (-2630.778) (-2633.407) -- 0:00:10
      975000 -- (-2631.587) [-2624.465] (-2628.015) (-2629.397) * (-2625.289) (-2622.342) (-2620.539) [-2625.846] -- 0:00:10

      Average standard deviation of split frequencies: 0.000193

      975500 -- (-2628.717) (-2630.761) (-2633.129) [-2626.945] * (-2640.694) [-2626.181] (-2632.127) (-2629.934) -- 0:00:10
      976000 -- (-2625.653) (-2631.466) (-2632.818) [-2619.671] * (-2628.079) (-2630.190) [-2624.102] (-2624.584) -- 0:00:09
      976500 -- (-2630.896) (-2625.353) (-2630.331) [-2622.897] * (-2623.930) (-2627.014) [-2627.025] (-2633.903) -- 0:00:09
      977000 -- (-2626.025) [-2625.050] (-2624.377) (-2629.027) * (-2625.188) (-2621.464) [-2630.171] (-2624.359) -- 0:00:09
      977500 -- (-2628.816) (-2622.988) [-2622.659] (-2624.188) * (-2630.170) (-2637.394) [-2628.382] (-2628.598) -- 0:00:09
      978000 -- (-2623.670) [-2624.533] (-2627.992) (-2621.516) * [-2624.376] (-2629.819) (-2633.000) (-2621.872) -- 0:00:09
      978500 -- (-2624.452) [-2629.899] (-2628.847) (-2629.711) * (-2622.375) (-2622.071) (-2634.485) [-2622.934] -- 0:00:08
      979000 -- [-2623.213] (-2623.523) (-2629.489) (-2627.776) * [-2630.064] (-2622.931) (-2631.457) (-2625.444) -- 0:00:08
      979500 -- [-2625.815] (-2629.990) (-2627.174) (-2619.830) * [-2633.818] (-2625.306) (-2632.697) (-2628.018) -- 0:00:08
      980000 -- (-2633.116) (-2640.400) (-2628.592) [-2625.200] * (-2629.147) (-2627.816) (-2631.165) [-2625.442] -- 0:00:08

      Average standard deviation of split frequencies: 0.000192

      980500 -- (-2628.219) (-2626.421) (-2621.932) [-2630.899] * (-2623.284) [-2623.996] (-2630.433) (-2622.711) -- 0:00:08
      981000 -- (-2623.127) [-2626.132] (-2630.206) (-2623.839) * (-2628.570) (-2626.589) (-2625.057) [-2621.810] -- 0:00:07
      981500 -- (-2625.506) (-2623.367) (-2624.691) [-2625.344] * (-2626.110) (-2637.507) [-2624.834] (-2623.900) -- 0:00:07
      982000 -- [-2626.769] (-2627.596) (-2633.926) (-2627.316) * (-2626.860) (-2633.620) [-2626.502] (-2628.224) -- 0:00:07
      982500 -- [-2627.788] (-2626.018) (-2629.313) (-2629.555) * [-2625.909] (-2634.542) (-2624.640) (-2638.530) -- 0:00:07
      983000 -- (-2632.155) (-2621.724) [-2621.932] (-2633.644) * [-2624.907] (-2632.216) (-2628.003) (-2628.570) -- 0:00:06
      983500 -- [-2628.222] (-2623.475) (-2619.163) (-2626.441) * (-2625.153) (-2629.239) [-2632.008] (-2619.314) -- 0:00:06
      984000 -- [-2628.404] (-2626.320) (-2624.411) (-2626.790) * [-2629.942] (-2621.540) (-2627.228) (-2626.915) -- 0:00:06
      984500 -- (-2624.092) (-2631.395) (-2628.061) [-2620.139] * (-2634.895) [-2622.997] (-2624.530) (-2624.108) -- 0:00:06
      985000 -- (-2621.937) (-2625.926) (-2630.383) [-2628.771] * (-2636.692) [-2627.989] (-2625.876) (-2620.337) -- 0:00:06

      Average standard deviation of split frequencies: 0.000191

      985500 -- (-2626.268) (-2633.748) [-2622.792] (-2626.017) * (-2624.943) (-2624.994) [-2629.703] (-2623.690) -- 0:00:05
      986000 -- (-2626.562) (-2624.928) (-2633.688) [-2627.573] * (-2630.932) [-2630.967] (-2629.116) (-2622.185) -- 0:00:05
      986500 -- (-2631.320) [-2622.863] (-2628.918) (-2629.910) * (-2630.205) [-2625.072] (-2636.461) (-2629.590) -- 0:00:05
      987000 -- (-2626.256) (-2619.664) [-2631.136] (-2629.480) * [-2628.879] (-2626.564) (-2626.192) (-2630.136) -- 0:00:05
      987500 -- (-2622.895) (-2626.210) [-2626.611] (-2625.479) * (-2633.162) (-2629.170) [-2626.729] (-2621.554) -- 0:00:05
      988000 -- (-2623.093) (-2622.106) [-2623.910] (-2635.573) * [-2625.191] (-2627.155) (-2630.530) (-2632.988) -- 0:00:04
      988500 -- (-2626.225) (-2631.917) (-2627.712) [-2626.278] * [-2626.929] (-2625.594) (-2628.647) (-2624.169) -- 0:00:04
      989000 -- (-2627.557) (-2628.388) (-2630.499) [-2624.580] * (-2626.067) (-2632.058) [-2623.918] (-2627.407) -- 0:00:04
      989500 -- (-2623.307) [-2627.458] (-2626.859) (-2634.735) * (-2625.595) [-2624.171] (-2627.545) (-2636.439) -- 0:00:04
      990000 -- (-2627.117) [-2635.135] (-2630.549) (-2637.876) * (-2624.156) (-2629.232) [-2618.855] (-2630.506) -- 0:00:04

      Average standard deviation of split frequencies: 0.000190

      990500 -- (-2631.985) [-2621.459] (-2622.290) (-2630.335) * (-2626.566) (-2638.272) [-2619.280] (-2634.760) -- 0:00:03
      991000 -- (-2638.800) (-2618.223) [-2622.284] (-2629.549) * [-2619.723] (-2636.161) (-2631.790) (-2625.366) -- 0:00:03
      991500 -- (-2627.768) [-2628.335] (-2626.335) (-2634.615) * (-2631.072) [-2623.948] (-2630.671) (-2627.902) -- 0:00:03
      992000 -- (-2626.463) (-2623.684) (-2627.807) [-2640.205] * (-2623.807) (-2626.463) [-2632.314] (-2635.122) -- 0:00:03
      992500 -- (-2628.904) (-2631.180) [-2623.261] (-2633.513) * [-2630.233] (-2633.999) (-2622.405) (-2628.916) -- 0:00:03
      993000 -- (-2624.230) (-2621.055) [-2632.372] (-2633.149) * [-2623.731] (-2635.794) (-2630.113) (-2632.622) -- 0:00:02
      993500 -- (-2627.389) [-2621.265] (-2635.255) (-2627.823) * (-2625.935) (-2631.062) (-2629.662) [-2623.084] -- 0:00:02
      994000 -- (-2624.344) (-2627.395) [-2630.805] (-2625.202) * (-2629.623) [-2625.545] (-2634.759) (-2633.028) -- 0:00:02
      994500 -- (-2625.362) (-2633.974) [-2622.492] (-2627.576) * (-2627.332) (-2628.574) [-2625.785] (-2632.125) -- 0:00:02
      995000 -- (-2629.132) (-2624.116) (-2632.853) [-2627.002] * (-2628.446) (-2630.274) (-2625.103) [-2623.244] -- 0:00:02

      Average standard deviation of split frequencies: 0.000189

      995500 -- [-2628.850] (-2632.079) (-2628.950) (-2631.629) * (-2630.775) [-2624.411] (-2629.240) (-2623.746) -- 0:00:01
      996000 -- (-2625.815) (-2626.336) [-2627.637] (-2630.910) * [-2629.233] (-2624.994) (-2626.083) (-2626.628) -- 0:00:01
      996500 -- (-2632.843) (-2630.228) [-2621.013] (-2622.791) * (-2621.919) (-2625.261) (-2622.661) [-2628.700] -- 0:00:01
      997000 -- (-2624.698) [-2625.073] (-2624.733) (-2622.601) * [-2623.680] (-2622.900) (-2626.303) (-2622.920) -- 0:00:01
      997500 -- [-2620.237] (-2621.309) (-2626.589) (-2622.647) * (-2632.305) (-2629.806) (-2625.203) [-2620.289] -- 0:00:01
      998000 -- (-2624.313) (-2626.197) (-2627.936) [-2628.678] * (-2624.217) [-2635.368] (-2620.934) (-2628.301) -- 0:00:00
      998500 -- [-2629.577] (-2630.545) (-2625.169) (-2628.913) * (-2637.506) (-2628.997) (-2621.682) [-2620.455] -- 0:00:00
      999000 -- (-2629.741) (-2630.739) [-2628.977] (-2625.980) * (-2635.166) (-2628.793) [-2621.583] (-2636.895) -- 0:00:00
      999500 -- (-2626.021) (-2632.481) (-2622.889) [-2628.759] * (-2631.790) (-2632.328) (-2628.158) [-2628.275] -- 0:00:00
      1000000 -- (-2629.052) [-2628.156] (-2625.031) (-2630.484) * (-2629.153) [-2624.740] (-2630.544) (-2630.061) -- 0:00:00

      Average standard deviation of split frequencies: 0.000188
      Final log likelihoods and log prior probs for run 1 (stored and calculated):
         Chain 1 -- -2629.052177 -- 12.642433
         Chain 1 -- -2629.052156 -- 12.642433
         Chain 2 -- -2628.156179 -- 16.188856
         Chain 2 -- -2628.156181 -- 16.188856
         Chain 3 -- -2625.031055 -- 17.027282
         Chain 3 -- -2625.031060 -- 17.027282
         Chain 4 -- -2630.483936 -- 19.616987
         Chain 4 -- -2630.483926 -- 19.616987
      Final log likelihoods and log prior probs for run 2 (stored and calculated):
         Chain 1 -- -2629.152848 -- 14.574563
         Chain 1 -- -2629.152856 -- 14.574563
         Chain 2 -- -2624.740187 -- 16.465068
         Chain 2 -- -2624.740188 -- 16.465068
         Chain 3 -- -2630.544496 -- 12.814584
         Chain 3 -- -2630.544493 -- 12.814584
         Chain 4 -- -2630.061116 -- 13.532284
         Chain 4 -- -2630.061136 -- 13.532284

      Analysis completed in 6 mins 51 seconds
      Analysis used 410.99 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -2615.13
      Likelihood of best state for "cold" chain of run 2 was -2615.25

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            42.0 %     ( 31 %)     Dirichlet(Revmat{all})
            56.8 %     ( 42 %)     Slider(Revmat{all})
            25.6 %     ( 34 %)     Dirichlet(Pi{all})
            26.7 %     ( 19 %)     Slider(Pi{all})
            34.1 %     ( 35 %)     Multiplier(Alpha{1,2})
            44.0 %     ( 23 %)     Multiplier(Alpha{3})
            57.7 %     ( 31 %)     Slider(Pinvar{all})
             0.0 %     (  0 %)     ExtSPR(Tau{all},V{all})
             0.0 %     (  0 %)     ExtTBR(Tau{all},V{all})
             0.0 %     (  1 %)     NNI(Tau{all},V{all})
             0.0 %     (  0 %)     ParsSPR(Tau{all},V{all})
            26.1 %     ( 26 %)     Multiplier(V{all})
            30.2 %     ( 18 %)     Nodeslider(V{all})
            25.2 %     ( 33 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            41.6 %     ( 33 %)     Dirichlet(Revmat{all})
            56.3 %     ( 39 %)     Slider(Revmat{all})
            25.1 %     ( 24 %)     Dirichlet(Pi{all})
            27.5 %     ( 24 %)     Slider(Pi{all})
            34.3 %     ( 24 %)     Multiplier(Alpha{1,2})
            44.1 %     ( 22 %)     Multiplier(Alpha{3})
            57.6 %     ( 27 %)     Slider(Pinvar{all})
             0.0 %     (  0 %)     ExtSPR(Tau{all},V{all})
             0.0 %     (  0 %)     ExtTBR(Tau{all},V{all})
             0.0 %     (  0 %)     NNI(Tau{all},V{all})
             0.0 %     (  0 %)     ParsSPR(Tau{all},V{all})
            26.1 %     ( 26 %)     Multiplier(V{all})
            30.1 %     ( 35 %)     Nodeslider(V{all})
            25.4 %     ( 25 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.81    0.64    0.50 
         2 |  166514            0.83    0.67 
         3 |  166397  166680            0.84 
         4 |  167171  166255  166983         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.81    0.64    0.50 
         2 |  166951            0.82    0.66 
         3 |  166896  166672            0.83 
         4 |  166426  166472  166583         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -2623.86
      |       1         1                  2                       |
      |   2                    1   1                  1     2      |
      |                               2                    1       |
      |  2 21       211  2        1  1        1  2    2 1          |
      |2       1  12       1        2 1       2     22      1   2 2|
      |1      22 1      2 *  1  *   1  11 2  2 2   1         1  1  |
      | 2    2               222   2 2            1        2   1 1 |
      |  111    2   12 2   2             2      11  11        22   |
      |     2     2           1          11 *1    22   2 2         |
      |            1   1                2                12        |
      |      1              *    22    2               12 1        |
      |         12                         1                 21    |
      |               2  1       1              2                21|
      |                                                            |
      | 1                                      1                   |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2627.58
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1      -2621.36         -2634.89
        2      -2621.59         -2637.33
      --------------------------------------
      TOTAL    -2621.47         -2636.72
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.779663    0.006734    0.629642    0.943847    0.773218   1203.55   1352.28    1.001
      r(A<->C){all}   0.086651    0.000400    0.051370    0.128583    0.085229   1218.04   1230.31    1.000
      r(A<->G){all}   0.238300    0.001321    0.173523    0.312639    0.235503    614.91    777.70    1.000
      r(A<->T){all}   0.197501    0.001655    0.120352    0.277447    0.195508    929.44    932.23    1.000
      r(C<->G){all}   0.044300    0.000146    0.020022    0.067380    0.043567    961.68   1064.80    1.000
      r(C<->T){all}   0.324947    0.001799    0.242997    0.409177    0.323865    889.23    944.60    1.000
      r(G<->T){all}   0.108302    0.000646    0.062211    0.160564    0.106249    673.98    728.17    1.000
      pi(A){all}      0.221604    0.000168    0.196999    0.247555    0.221297   1155.00   1307.61    1.000
      pi(C){all}      0.329344    0.000222    0.302974    0.360473    0.329315   1342.36   1359.13    1.000
      pi(G){all}      0.278205    0.000209    0.252199    0.307758    0.277970   1081.96   1119.08    1.000
      pi(T){all}      0.170846    0.000137    0.147577    0.192946    0.170569    936.55   1014.05    1.000
      alpha{1,2}      0.134058    0.001498    0.052669    0.210920    0.134628   1108.09   1192.13    1.000
      alpha{3}        2.319434    0.740613    1.004297    4.143426    2.182697    989.25   1180.87    1.000
      pinvar{all}     0.188331    0.008083    0.004948    0.336468    0.192165    996.61   1205.45    1.000
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6
      7 -- C7
      8 -- C8

   Key to taxon bipartitions (saved to file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   --------------
    1 -- .*******
    2 -- .*......
    3 -- ..*.....
    4 -- ...*....
    5 -- ....*...
    6 -- .....*..
    7 -- ......*.
    8 -- .......*
    9 -- .**.....
   10 -- ...**...
   11 -- .....**.
   12 -- ...*****
   13 -- .....***
   --------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
    9  3002    1.000000    0.000000    1.000000    1.000000    2
   10  3002    1.000000    0.000000    1.000000    1.000000    2
   11  3002    1.000000    0.000000    1.000000    1.000000    2
   12  3001    0.999667    0.000471    0.999334    1.000000    2
   13  3001    0.999667    0.000471    0.999334    1.000000    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.020045    0.000051    0.007818    0.034597    0.019284    1.000    2
   length{all}[2]     0.022135    0.000043    0.010077    0.034984    0.021529    1.000    2
   length{all}[3]     0.003048    0.000006    0.000002    0.008029    0.002433    1.000    2
   length{all}[4]     0.045846    0.000133    0.025658    0.070179    0.044651    1.000    2
   length{all}[5]     0.047658    0.000141    0.027445    0.072905    0.046506    1.001    2
   length{all}[6]     0.089390    0.000432    0.052094    0.132606    0.087971    1.001    2
   length{all}[7]     0.041350    0.000234    0.013806    0.072646    0.040133    1.000    2
   length{all}[8]     0.184283    0.001270    0.116507    0.253457    0.181068    1.000    2
   length{all}[9]     0.016034    0.000044    0.004444    0.029176    0.015460    1.000    2
   length{all}[10]    0.043695    0.000227    0.016594    0.073364    0.042099    1.000    2
   length{all}[11]    0.137290    0.001069    0.073908    0.198079    0.135444    1.000    2
   length{all}[12]    0.049731    0.000225    0.022488    0.079274    0.048783    1.000    2
   length{all}[13]    0.079193    0.000639    0.033936    0.128770    0.076887    1.001    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.000188
       Maximum standard deviation of split frequencies = 0.000471
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.001


   Clade credibility values:

   /------------------------------------------------------------------------ C1 (1)
   |                                                                               
   |                                                     /------------------ C2 (2)
   |-------------------------100-------------------------+                         
   |                                                     \------------------ C3 (3)
   +                                                                               
   |                                                     /------------------ C4 (4)
   |                 /----------------100----------------+                         
   |                 |                                   \------------------ C5 (5)
   |                 |                                                             
   \-------100-------+                                   /------------------ C6 (6)
                     |                 /-------100-------+                         
                     |                 |                 \------------------ C7 (7)
                     \-------100-------+                                           
                                       \------------------------------------ C8 (8)
                                                                                   

   Phylogram (based on average branch lengths):

   /---- C1 (1)
   |                                                                               
   |  /----- C2 (2)
   |--+                                                                            
   |  \- C3 (3)
   +                                                                               
   |                  /--------- C4 (4)
   |         /--------+                                                            
   |         |        \--------- C5 (5)
   |         |                                                                     
   \---------+                                           /------------------ C6 (6)
             |               /---------------------------+                         
             |               |                           \-------- C7 (7)
             \---------------+                                                     
                             \------------------------------------- C8 (8)
                                                                                   
   |---------| 0.050 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (3 trees sampled):
      99 % credible set contains 1 tree

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.8, March 2014

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  3  7  8

seq file is not paml/phylip format.  Trying nexus format.
ns = 8  	ls = 870
Reading sequences, sequential format..
Reading seq # 1: C1     
Reading seq # 2: C2     
Reading seq # 3: C3     
Reading seq # 4: C4     
Reading seq # 5: C5     
Reading seq # 6: C6     
Reading seq # 7: C7     
Reading seq # 8: C8     
Sites with gaps or missing data are removed.

    84 ambiguity characters in seq. 1
    84 ambiguity characters in seq. 2
    84 ambiguity characters in seq. 3
    75 ambiguity characters in seq. 4
    75 ambiguity characters in seq. 5
    63 ambiguity characters in seq. 6
    96 ambiguity characters in seq. 7
    48 ambiguity characters in seq. 8
35 sites are removed.  68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290
Sequences read..
Counting site patterns..  0:00

         179 patterns at      255 /      255 sites (100.0%),  0:00
Counting codons..


      224 bytes for distance
   174704 bytes for conP
    24344 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, (2, 3), ((4, 5), ((6, 7), 8)));   MP score: 263
   524112 bytes for conP, adjusted

    0.040710    0.029516    0.042370    0.005486    0.069289    0.071813    0.073807    0.090286    0.076185    0.151990    0.122422    0.088877    0.327233    0.300000    1.300000

ntime & nrate & np:    13     2    15

Bounds (np=15):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =    15
lnL0 = -2688.008607

Iterating by ming2
Initial: fx=  2688.008607
x=  0.04071  0.02952  0.04237  0.00549  0.06929  0.07181  0.07381  0.09029  0.07619  0.15199  0.12242  0.08888  0.32723  0.30000  1.30000

  1 h-m-p  0.0000 0.0001 376.8574 ++     2681.059613  m 0.0001    20 | 0/15
  2 h-m-p  0.0000 0.0000 10214.1058 ++     2609.590665  m 0.0000    38 | 0/15
  3 h-m-p  0.0000 0.0000 15964.1913 +YYCCC  2582.550724  4 0.0000    63 | 0/15
  4 h-m-p  0.0002 0.0017 1876.7473 YYCCCC  2550.713419  5 0.0003    89 | 0/15
  5 h-m-p  0.0002 0.0008 475.6872 +YYYYYYYYYC  2500.745040 10 0.0006   118 | 0/15
  6 h-m-p  0.0000 0.0000 1970.0128 +YYCCCC  2493.907489  5 0.0000   145 | 0/15
  7 h-m-p  0.0001 0.0004 670.0702 +YYCCCC  2476.239953  5 0.0002   172 | 0/15
  8 h-m-p  0.0002 0.0010 601.1085 +YYYYCCCC  2416.275063  7 0.0007   201 | 0/15
  9 h-m-p  0.0000 0.0001 1283.1419 CCCCC  2413.169425  4 0.0000   227 | 0/15
 10 h-m-p  0.0004 0.0019  60.6477 YC     2412.779131  1 0.0002   246 | 0/15
 11 h-m-p  0.0005 0.0056  31.1203 CYC    2412.560172  2 0.0005   267 | 0/15
 12 h-m-p  0.0001 0.0013 195.6030 CYC    2412.309667  2 0.0001   288 | 0/15
 13 h-m-p  0.0025 0.0143   7.6367 YCCC   2412.175128  3 0.0017   311 | 0/15
 14 h-m-p  0.0017 0.0575   7.5212 +CCC   2410.565888  2 0.0095   334 | 0/15
 15 h-m-p  0.0030 0.0148  16.1689 YCCCCC  2403.356590  5 0.0065   361 | 0/15
 16 h-m-p  0.0014 0.0072  46.1213 YCCCCC  2389.616020  5 0.0031   388 | 0/15
 17 h-m-p  0.2307 1.1533   0.1637 YCCCC  2381.242019  4 0.5679   413 | 0/15
 18 h-m-p  0.8073 4.0366   0.1135 CYCCC  2373.287380  4 0.9873   453 | 0/15
 19 h-m-p  0.6226 3.1131   0.0644 YCYCCC  2365.710308  5 1.6082   494 | 0/15
 20 h-m-p  1.6000 8.0000   0.0474 CCCC   2364.608019  3 1.6134   533 | 0/15
 21 h-m-p  1.5664 8.0000   0.0488 YC     2363.810152  1 2.9433   567 | 0/15
 22 h-m-p  1.4199 7.0995   0.0658 YYC    2363.433536  2 1.2053   602 | 0/15
 23 h-m-p  1.6000 8.0000   0.0439 CYC    2363.226669  2 1.7086   638 | 0/15
 24 h-m-p  1.6000 8.0000   0.0194 YC     2363.124947  1 3.3857   672 | 0/15
 25 h-m-p  1.6000 8.0000   0.0107 C      2363.094072  0 1.5892   705 | 0/15
 26 h-m-p  1.6000 8.0000   0.0030 +YC    2363.066265  1 4.3864   740 | 0/15
 27 h-m-p  1.6000 8.0000   0.0017 YC     2363.037440  1 3.6503   774 | 0/15
 28 h-m-p  1.6000 8.0000   0.0021 CC     2363.021927  1 1.8874   809 | 0/15
 29 h-m-p  1.6000 8.0000   0.0009 YC     2363.017593  1 3.1467   843 | 0/15
 30 h-m-p  1.2648 8.0000   0.0022 +YC    2363.004252  1 5.9083   878 | 0/15
 31 h-m-p  1.6000 8.0000   0.0015 YC     2363.003560  1 1.1866   912 | 0/15
 32 h-m-p  1.6000 8.0000   0.0002 ++     2363.003037  m 8.0000   945 | 0/15
 33 h-m-p  0.7273 8.0000   0.0021 YC     2363.002562  1 1.4694   979 | 0/15
 34 h-m-p  1.6000 8.0000   0.0002 C      2363.002458  0 2.2396  1012 | 0/15
 35 h-m-p  1.5239 8.0000   0.0003 Y      2363.002381  0 3.0571  1045 | 0/15
 36 h-m-p  1.6000 8.0000   0.0001 Y      2363.002381  0 1.1454  1078 | 0/15
 37 h-m-p  1.6000 8.0000   0.0000 Y      2363.002381  0 3.9878  1111 | 0/15
 38 h-m-p  1.6000 8.0000   0.0000 Y      2363.002381  0 3.7827  1144 | 0/15
 39 h-m-p  1.6000 8.0000   0.0000 Y      2363.002381  0 1.1236  1177 | 0/15
 40 h-m-p  1.1882 8.0000   0.0000 C      2363.002381  0 1.1882  1210 | 0/15
 41 h-m-p  1.6000 8.0000   0.0000 C      2363.002381  0 0.4000  1243 | 0/15
 42 h-m-p  1.2718 8.0000   0.0000 -------------C  2363.002381  0 0.0000  1289
Out..
lnL  = -2363.002381
1290 lfun, 1290 eigenQcodon, 16770 P(t)

Time used:  0:07


Model 1: NearlyNeutral

TREE #  1
(1, (2, 3), ((4, 5), ((6, 7), 8)));   MP score: 263
    0.040710    0.029516    0.042370    0.005486    0.069289    0.071813    0.073807    0.090286    0.076185    0.151990    0.122422    0.088877    0.327233    2.269799    0.700642    0.304419

ntime & nrate & np:    13     2    16

Bounds (np=16):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 6.576996

np =    16
lnL0 = -2417.940085

Iterating by ming2
Initial: fx=  2417.940085
x=  0.04071  0.02952  0.04237  0.00549  0.06929  0.07181  0.07381  0.09029  0.07619  0.15199  0.12242  0.08888  0.32723  2.26980  0.70064  0.30442

  1 h-m-p  0.0000 0.0001 276.1758 ++     2412.259453  m 0.0001    21 | 0/16
  2 h-m-p -0.0000 -0.0000 6851.3694 
h-m-p:     -4.87335329e-20     -2.43667665e-19      6.85136937e+03  2412.259453
..  | 0/16
  3 h-m-p  0.0000 0.0013 2475.4561 YYCYCCC  2410.572531  6 0.0000    65 | 0/16
  4 h-m-p  0.0000 0.0013 270.2768 +++YYYYCCC  2334.808514  6 0.0011    95 | 0/16
  5 h-m-p  0.0002 0.0011  91.1490 CCCCC  2333.659387  4 0.0003   122 | 0/16
  6 h-m-p  0.0003 0.0021  77.2448 CCC    2332.969553  2 0.0004   145 | 0/16
  7 h-m-p  0.0010 0.0098  26.9715 YC     2332.825563  1 0.0005   165 | 0/16
  8 h-m-p  0.0015 0.0271   8.6753 YCC    2332.782804  2 0.0012   187 | 0/16
  9 h-m-p  0.0008 0.0093  13.0847 YC     2332.761590  1 0.0005   207 | 0/16
 10 h-m-p  0.0006 0.0425   9.9731 C      2332.744407  0 0.0006   226 | 0/16
 11 h-m-p  0.0010 0.0141   6.6486 YC     2332.735639  1 0.0005   246 | 0/16
 12 h-m-p  0.0006 0.0823   6.1704 +CC    2332.684060  1 0.0035   268 | 0/16
 13 h-m-p  0.0008 0.0235  28.3588 +YC    2332.548815  1 0.0019   289 | 0/16
 14 h-m-p  0.0010 0.0218  52.2911 YC     2332.281615  1 0.0021   309 | 0/16
 15 h-m-p  0.0055 0.0276  15.4329 YC     2332.256417  1 0.0007   329 | 0/16
 16 h-m-p  0.0105 0.1839   1.0986 YC     2332.254216  1 0.0020   349 | 0/16
 17 h-m-p  0.0014 0.5297   1.5359 ++CC   2332.212260  1 0.0277   372 | 0/16
 18 h-m-p  0.0013 0.0369  34.0512 YCC    2332.138122  2 0.0022   394 | 0/16
 19 h-m-p  0.1537 0.7687   0.2585 --C    2332.137949  0 0.0029   415 | 0/16
 20 h-m-p  0.0777 8.0000   0.0096 +YC    2332.112038  1 0.5228   452 | 0/16
 21 h-m-p  1.5641 8.0000   0.0032 CC     2332.103611  1 2.4652   489 | 0/16
 22 h-m-p  1.6000 8.0000   0.0011 YC     2332.087010  1 3.7171   525 | 0/16
 23 h-m-p  1.6000 8.0000   0.0021 YC     2332.085345  1 1.0180   561 | 0/16
 24 h-m-p  1.6000 8.0000   0.0008 Y      2332.085329  0 0.9016   596 | 0/16
 25 h-m-p  1.6000 8.0000   0.0000 Y      2332.085329  0 1.0064   631 | 0/16
 26 h-m-p  1.6000 8.0000   0.0000 -------Y  2332.085329  0 0.0000   673
Out..
lnL  = -2332.085329
674 lfun, 2022 eigenQcodon, 17524 P(t)

Time used:  0:14


Model 2: PositiveSelection

TREE #  1
(1, (2, 3), ((4, 5), ((6, 7), 8)));   MP score: 263
initial w for M2:NSpselection reset.

    0.040710    0.029516    0.042370    0.005486    0.069289    0.071813    0.073807    0.090286    0.076185    0.151990    0.122422    0.088877    0.327233    2.361394    0.878998    0.263736    0.186073    2.329016

ntime & nrate & np:    13     3    18

Bounds (np=18):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 4.439606

np =    18
lnL0 = -2444.816560

Iterating by ming2
Initial: fx=  2444.816560
x=  0.04071  0.02952  0.04237  0.00549  0.06929  0.07181  0.07381  0.09029  0.07619  0.15199  0.12242  0.08888  0.32723  2.36139  0.87900  0.26374  0.18607  2.32902

  1 h-m-p  0.0000 0.0003 286.0553 +++    2429.409035  m 0.0003    24 | 0/18
  2 h-m-p  0.0000 0.0000 6523.5994 +YCYCCC  2400.896684  5 0.0000    54 | 0/18
  3 h-m-p  0.0000 0.0001 176.9391 ++     2398.488523  m 0.0001    75 | 0/18
  4 h-m-p  0.0001 0.0024 193.4422 +YCCCCC  2387.149397  5 0.0011   106 | 0/18
  5 h-m-p  0.0008 0.0042 130.5068 YCCC   2381.883391  3 0.0014   132 | 0/18
  6 h-m-p  0.0016 0.0104 120.3810 CCCC   2375.187359  3 0.0023   159 | 0/18
  7 h-m-p  0.0019 0.0095  68.5234 YCCCC  2370.723827  4 0.0036   187 | 0/18
  8 h-m-p  0.0011 0.0055  72.6818 YCCCC  2368.448945  4 0.0021   215 | 0/18
  9 h-m-p  0.0025 0.0125  38.3606 YYCC   2367.560731  3 0.0022   240 | 0/18
 10 h-m-p  0.0027 0.0217  32.0256 YCC    2367.036645  2 0.0021   264 | 0/18
 11 h-m-p  0.0042 0.0288  16.0540 CYC    2366.655275  2 0.0039   288 | 0/18
 12 h-m-p  0.0039 0.0582  15.8506 YCCC   2365.890295  3 0.0088   314 | 0/18
 13 h-m-p  0.0037 0.0710  37.4717 +CCCCC  2360.693402  4 0.0239   344 | 0/18
 14 h-m-p  0.0027 0.0133 265.0687 CCCCC  2355.417640  4 0.0035   373 | 0/18
 15 h-m-p  0.0095 0.0473   6.6150 YYC    2355.091752  2 0.0074   396 | 0/18
 16 h-m-p  0.0058 0.1613   8.3847 ++YCCCC  2348.631808  4 0.0660   426 | 0/18
 17 h-m-p  0.0011 0.0055 168.5688 +YCCCC  2338.080619  4 0.0049   455 | 0/18
 18 h-m-p  0.4618 5.7411   1.7873 CYCCC  2335.789352  4 0.3986   483 | 0/18
 19 h-m-p  0.4046 2.0229   1.4478 YYCCC  2334.579800  4 0.2890   510 | 0/18
 20 h-m-p  0.1397 0.6986   0.6275 YCCC   2333.910095  3 0.3219   536 | 0/18
 21 h-m-p  0.1934 2.9630   1.0441 YC     2333.235745  1 0.4606   576 | 0/18
 22 h-m-p  0.4356 3.6315   1.1039 YCCC   2332.430851  3 0.8646   602 | 0/18
 23 h-m-p  0.9837 5.3215   0.9702 YYCC   2331.841538  3 0.7254   627 | 0/18
 24 h-m-p  1.0748 5.3739   0.5299 YC     2331.737243  1 0.4457   667 | 0/18
 25 h-m-p  0.5267 8.0000   0.4484 CC     2331.661060  1 0.8334   708 | 0/18
 26 h-m-p  0.6798 8.0000   0.5497 YC     2331.629810  1 0.3880   748 | 0/18
 27 h-m-p  0.4799 8.0000   0.4445 C      2331.609723  0 0.4794   787 | 0/18
 28 h-m-p  0.9210 8.0000   0.2314 CC     2331.599136  1 0.7750   828 | 0/18
 29 h-m-p  1.2118 8.0000   0.1480 CC     2331.596379  1 0.4499   869 | 0/18
 30 h-m-p  1.6000 8.0000   0.0393 CC     2331.595724  1 0.6071   910 | 0/18
 31 h-m-p  1.3485 8.0000   0.0177 YC     2331.595448  1 0.6919   950 | 0/18
 32 h-m-p  1.6000 8.0000   0.0044 C      2331.595276  0 1.3765   989 | 0/18
 33 h-m-p  0.6039 8.0000   0.0101 +YC    2331.594493  1 4.2710  1030 | 0/18
 34 h-m-p  0.6274 8.0000   0.0690 YC     2331.592897  1 1.1348  1070 | 0/18
 35 h-m-p  0.6765 8.0000   0.1157 YC     2331.590431  1 1.3075  1110 | 0/18
 36 h-m-p  0.8746 8.0000   0.1730 C      2331.588636  0 0.8320  1149 | 0/18
 37 h-m-p  1.6000 8.0000   0.0668 YC     2331.588176  1 0.8993  1189 | 0/18
 38 h-m-p  1.6000 8.0000   0.0120 Y      2331.588150  0 1.0215  1228 | 0/18
 39 h-m-p  1.6000 8.0000   0.0007 Y      2331.588150  0 0.6932  1267 | 0/18
 40 h-m-p  1.6000 8.0000   0.0001 Y      2331.588150  0 0.9189  1306 | 0/18
 41 h-m-p  1.6000 8.0000   0.0000 C      2331.588150  0 1.6000  1345 | 0/18
 42 h-m-p  1.6000 8.0000   0.0000 C      2331.588150  0 0.4000  1384 | 0/18
 43 h-m-p  0.7564 8.0000   0.0000 Y      2331.588150  0 0.3421  1423 | 0/18
 44 h-m-p  0.4292 8.0000   0.0000 ---------------..  | 0/18
 45 h-m-p  0.0160 8.0000   0.0003 ------------Y  2331.588150  0 0.0000  1526
Out..
lnL  = -2331.588150
1527 lfun, 6108 eigenQcodon, 59553 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -2342.732705  S = -2222.049480  -112.606622
Calculating f(w|X), posterior probabilities of site classes.

	did  10 / 179 patterns   0:39
	did  20 / 179 patterns   0:39
	did  30 / 179 patterns   0:39
	did  40 / 179 patterns   0:39
	did  50 / 179 patterns   0:39
	did  60 / 179 patterns   0:39
	did  70 / 179 patterns   0:39
	did  80 / 179 patterns   0:39
	did  90 / 179 patterns   0:40
	did 100 / 179 patterns   0:40
	did 110 / 179 patterns   0:40
	did 120 / 179 patterns   0:40
	did 130 / 179 patterns   0:40
	did 140 / 179 patterns   0:40
	did 150 / 179 patterns   0:40
	did 160 / 179 patterns   0:40
	did 170 / 179 patterns   0:40
	did 179 / 179 patterns   0:40
Time used:  0:40


Model 3: discrete

TREE #  1
(1, (2, 3), ((4, 5), ((6, 7), 8)));   MP score: 263
    0.040710    0.029516    0.042370    0.005486    0.069289    0.071813    0.073807    0.090286    0.076185    0.151990    0.122422    0.088877    0.327233    2.406399    0.062503    0.014820    0.054615    0.127517    0.218802

ntime & nrate & np:    13     4    19

Bounds (np=19):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   0.000001   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 12.389010

np =    19
lnL0 = -2357.995652

Iterating by ming2
Initial: fx=  2357.995652
x=  0.04071  0.02952  0.04237  0.00549  0.06929  0.07181  0.07381  0.09029  0.07619  0.15199  0.12242  0.08888  0.32723  2.40640  0.06250  0.01482  0.05461  0.12752  0.21880

  1 h-m-p  0.0000 0.0001 190.4564 +CCYYC  2356.365670  4 0.0001    32 | 0/19
  2 h-m-p  0.0000 0.0000 1382.7332 ++     2346.366613  m 0.0000    54 | 1/19
  3 h-m-p  0.0002 0.0009 178.3483 +YYC   2340.110497  2 0.0006    79 | 1/19
  4 h-m-p  0.0000 0.0001 445.6461 ++     2338.219617  m 0.0001   101 | 1/19
  5 h-m-p  0.0000 0.0000  64.8762 
h-m-p:      1.24810808e-19      6.24054040e-19      6.48762140e+01  2338.219617
..  | 1/19
  6 h-m-p  0.0000 0.0025 866.1375 CCYC   2337.420725  3 0.0000   148 | 1/19
  7 h-m-p  0.0000 0.0024 124.4700 +YYCCC  2336.255571  4 0.0002   177 | 1/19
  8 h-m-p  0.0003 0.0016  59.0471 CCCCC  2335.649424  4 0.0004   207 | 1/19
  9 h-m-p  0.0002 0.0009  66.3418 YC     2335.168319  1 0.0004   230 | 1/19
 10 h-m-p  0.0001 0.0003  31.9274 ++     2334.997988  m 0.0003   252 | 1/19
 11 h-m-p  0.0003 0.0150  31.6783 YCC    2334.857209  2 0.0006   277 | 1/19
 12 h-m-p  0.0012 0.0169  16.5220 YC     2334.818162  1 0.0005   300 | 1/19
 13 h-m-p  0.0006 0.0038  14.1979 CC     2334.794308  1 0.0005   324 | 1/19
 14 h-m-p  0.0013 0.0604   5.3981 C      2334.780643  0 0.0013   346 | 1/19
 15 h-m-p  0.0007 0.1903   9.9944 +YCC   2334.709084  2 0.0046   372 | 1/19
 16 h-m-p  0.0007 0.0287  70.3371 +CCC   2334.398349  2 0.0028   399 | 1/19
 17 h-m-p  0.0015 0.0277 133.9178 YCCC   2333.801670  3 0.0029   426 | 1/19
 18 h-m-p  0.0014 0.0201 264.8269 CCC    2333.267048  2 0.0013   452 | 1/19
 19 h-m-p  0.0030 0.0150  86.6262 YC     2333.100498  1 0.0013   475 | 1/19
 20 h-m-p  0.0049 0.0394  22.3222 CC     2333.059609  1 0.0013   499 | 1/19
 21 h-m-p  0.0050 0.1000   5.8300 YC     2333.045588  1 0.0021   522 | 1/19
 22 h-m-p  0.0096 4.7920   7.5867 +CYC   2332.694833  2 0.0464   548 | 1/19
 23 h-m-p  1.6000 8.0000   0.0922 CCC    2332.192081  2 1.4461   574 | 0/19
 24 h-m-p  0.0006 0.0050 225.1414 C      2332.051861  0 0.0002   614 | 0/19
 25 h-m-p  0.2551 8.0000   0.1568 +YCCC  2331.726076  3 1.8013   642 | 0/19
 26 h-m-p  0.5480 2.7402   0.2565 CYC    2331.634165  2 0.5805   686 | 0/19
 27 h-m-p  1.3651 8.0000   0.1091 C      2331.590800  0 1.1563   727 | 0/19
 28 h-m-p  1.6000 8.0000   0.0583 CCC    2331.578123  2 2.2995   772 | 0/19
 29 h-m-p  1.6000 8.0000   0.0589 +YC    2331.558360  1 4.0583   815 | 0/19
 30 h-m-p  1.1773 8.0000   0.2029 YCCC   2331.549784  3 0.6655   861 | 0/19
 31 h-m-p  1.6000 8.0000   0.0545 CC     2331.546026  1 0.4528   904 | 0/19
 32 h-m-p  0.3248 8.0000   0.0760 +CCC   2331.542399  2 1.7643   950 | 0/19
 33 h-m-p  1.6000 8.0000   0.0270 CC     2331.540537  1 1.3133   993 | 0/19
 34 h-m-p  0.4469 8.0000   0.0794 YC     2331.539486  1 1.0607  1035 | 0/19
 35 h-m-p  1.6000 8.0000   0.0151 C      2331.539311  0 1.3662  1076 | 0/19
 36 h-m-p  1.5239 8.0000   0.0136 Y      2331.539284  0 1.0158  1117 | 0/19
 37 h-m-p  1.6000 8.0000   0.0003 Y      2331.539283  0 0.9711  1158 | 0/19
 38 h-m-p  0.4797 8.0000   0.0006 +Y     2331.539283  0 1.4270  1200 | 0/19
 39 h-m-p  1.6000 8.0000   0.0001 Y      2331.539283  0 3.1701  1241 | 0/19
 40 h-m-p  1.6000 8.0000   0.0001 Y      2331.539283  0 1.1419  1282 | 0/19
 41 h-m-p  1.6000 8.0000   0.0000 +Y     2331.539283  0 4.8766  1324 | 0/19
 42 h-m-p  1.2896 8.0000   0.0000 --Y    2331.539283  0 0.0202  1367 | 0/19
 43 h-m-p  0.0160 8.0000   0.0001 --C    2331.539283  0 0.0003  1410
Out..
lnL  = -2331.539283
1411 lfun, 5644 eigenQcodon, 55029 P(t)

Time used:  1:03


Model 7: beta

TREE #  1
(1, (2, 3), ((4, 5), ((6, 7), 8)));   MP score: 263
    0.040710    0.029516    0.042370    0.005486    0.069289    0.071813    0.073807    0.090286    0.076185    0.151990    0.122422    0.088877    0.327233    2.327552    0.942968    1.067294

ntime & nrate & np:    13     1    16

Bounds (np=16):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 6.875181

np =    16
lnL0 = -2408.774438

Iterating by ming2
Initial: fx=  2408.774438
x=  0.04071  0.02952  0.04237  0.00549  0.06929  0.07181  0.07381  0.09029  0.07619  0.15199  0.12242  0.08888  0.32723  2.32755  0.94297  1.06729

  1 h-m-p  0.0000 0.0001 165.6049 +YCYCCC  2407.256872  5 0.0001    31 | 0/16
  2 h-m-p  0.0000 0.0018 1148.9411 +YYCCC  2402.218902  4 0.0001    57 | 0/16
  3 h-m-p  0.0003 0.0016 170.3694 +YYCCCC  2391.339266  5 0.0011    85 | 0/16
  4 h-m-p  0.0002 0.0008 620.5636 +YYYCCC  2370.392495  5 0.0006   112 | 0/16
  5 h-m-p  0.0000 0.0001 4990.5063 +YYCCC  2358.232908  4 0.0000   138 | 0/16
  6 h-m-p  0.0000 0.0002 1500.3249 CCCCC  2354.744177  4 0.0001   165 | 0/16
  7 h-m-p  0.0013 0.0064  46.7754 CCCC   2353.528092  3 0.0013   190 | 0/16
  8 h-m-p  0.0012 0.0191  52.2982 +YYYC  2349.930269  3 0.0047   213 | 0/16
  9 h-m-p  0.0033 0.0188  73.7463 CCC    2346.346908  2 0.0045   236 | 0/16
 10 h-m-p  0.0013 0.0065 105.5400 YCCC   2345.721457  3 0.0006   260 | 0/16
 11 h-m-p  0.0012 0.0090  53.3025 CYC    2345.202046  2 0.0011   282 | 0/16
 12 h-m-p  0.0051 0.0311  11.5965 CCC    2345.141611  2 0.0011   305 | 0/16
 13 h-m-p  0.0040 0.0862   3.1864 YC     2345.109492  1 0.0030   325 | 0/16
 14 h-m-p  0.0047 0.2425   2.0193 +YC    2344.596206  1 0.0307   346 | 0/16
 15 h-m-p  0.0021 0.0269  30.2451 +CCCCC  2341.096719  4 0.0101   374 | 0/16
 16 h-m-p  0.0013 0.0067 103.2493 CCCCC  2339.043094  4 0.0018   401 | 0/16
 17 h-m-p  0.0508 0.7090   3.6909 YCCC   2337.099344  3 0.1152   425 | 0/16
 18 h-m-p  0.3964 1.9818   0.4755 YCCC   2335.933957  3 0.2627   449 | 0/16
 19 h-m-p  0.7466 8.0000   0.1673 YCCC   2335.387340  3 1.1648   489 | 0/16
 20 h-m-p  1.2032 8.0000   0.1620 CCCC   2334.758662  3 1.8129   530 | 0/16
 21 h-m-p  0.6405 3.9713   0.4585 +YYCCCC  2332.564358  5 1.9746   574 | 0/16
 22 h-m-p  1.6000 8.0000   0.1071 YCCC   2332.306843  3 0.9040   614 | 0/16
 23 h-m-p  0.5819 8.0000   0.1664 YCC    2332.239383  2 0.3795   652 | 0/16
 24 h-m-p  1.6000 8.0000   0.0198 YC     2332.206601  1 1.2475   688 | 0/16
 25 h-m-p  0.3253 8.0000   0.0761 YC     2332.188558  1 0.6261   724 | 0/16
 26 h-m-p  1.6000 8.0000   0.0094 YC     2332.178224  1 0.8377   760 | 0/16
 27 h-m-p  1.1368 8.0000   0.0069 CC     2332.174378  1 1.0183   797 | 0/16
 28 h-m-p  1.6000 8.0000   0.0016 CC     2332.172599  1 2.1231   834 | 0/16
 29 h-m-p  1.3453 8.0000   0.0026 CC     2332.171423  1 1.7062   871 | 0/16
 30 h-m-p  1.6000 8.0000   0.0013 C      2332.170839  0 1.8712   906 | 0/16
 31 h-m-p  1.6000 8.0000   0.0014 Y      2332.170789  0 0.9523   941 | 0/16
 32 h-m-p  1.6000 8.0000   0.0003 Y      2332.170787  0 0.9439   976 | 0/16
 33 h-m-p  1.6000 8.0000   0.0000 Y      2332.170787  0 1.0650  1011 | 0/16
 34 h-m-p  1.6000 8.0000   0.0000 Y      2332.170787  0 1.0418  1046 | 0/16
 35 h-m-p  1.6000 8.0000   0.0000 C      2332.170787  0 1.6000  1081 | 0/16
 36 h-m-p  1.6000 8.0000   0.0000 C      2332.170787  0 0.4000  1116 | 0/16
 37 h-m-p  0.5123 8.0000   0.0000 ---C   2332.170787  0 0.0020  1154
Out..
lnL  = -2332.170787
1155 lfun, 12705 eigenQcodon, 150150 P(t)

Time used:  2:04


Model 8: beta&w>1

TREE #  1
(1, (2, 3), ((4, 5), ((6, 7), 8)));   MP score: 263
initial w for M8:NSbetaw>1 reset.

    0.040710    0.029516    0.042370    0.005486    0.069289    0.071813    0.073807    0.090286    0.076185    0.151990    0.122422    0.088877    0.327233    2.323978    0.900000    1.091300    1.180709    2.396835

ntime & nrate & np:    13     2    18

Bounds (np=18):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 5.398691

np =    18
lnL0 = -2427.603345

Iterating by ming2
Initial: fx=  2427.603345
x=  0.04071  0.02952  0.04237  0.00549  0.06929  0.07181  0.07381  0.09029  0.07619  0.15199  0.12242  0.08888  0.32723  2.32398  0.90000  1.09130  1.18071  2.39683

  1 h-m-p  0.0000 0.0001 280.6235 ++     2420.090838  m 0.0001    23 | 0/18
  2 h-m-p  0.0000 0.0000 6806.1064 +CYCCC  2409.182508  4 0.0000    52 | 0/18
  3 h-m-p  0.0000 0.0002 139.7073 ++     2407.277334  m 0.0002    73 | 0/18
  4 h-m-p  0.0001 0.0020 176.4599 +YCYCCC  2397.677291  5 0.0012   104 | 0/18
  5 h-m-p  0.0002 0.0008 663.9600 +YYYCCC  2377.481322  5 0.0006   133 | 0/18
  6 h-m-p  0.0000 0.0001 7096.2271 +YCYCCC  2355.716751  5 0.0001   163 | 0/18
  7 h-m-p  0.0001 0.0005 656.9236 YYC    2353.814439  2 0.0001   186 | 0/18
  8 h-m-p  0.0005 0.0026  45.8551 CCCC   2353.287032  3 0.0006   213 | 0/18
  9 h-m-p  0.0006 0.0139  50.1701 +CCCC  2351.077346  3 0.0033   241 | 0/18
 10 h-m-p  0.0015 0.0086 109.7084 CCC    2348.065207  2 0.0024   266 | 0/18
 11 h-m-p  0.0038 0.0189  58.8684 CYC    2346.122307  2 0.0034   290 | 0/18
 12 h-m-p  0.0030 0.0151  16.1127 YCC    2345.976579  2 0.0015   314 | 0/18
 13 h-m-p  0.0033 0.0675   7.3087 YCC    2345.906601  2 0.0025   338 | 0/18
 14 h-m-p  0.0109 0.2745   1.6486 YC     2345.551730  1 0.0271   360 | 0/18
 15 h-m-p  0.0052 0.1156   8.5390 +YCCCC  2338.892044  4 0.0453   389 | 0/18
 16 h-m-p  0.0015 0.0075  98.8087 CCCCC  2335.167184  4 0.0022   418 | 0/18
 17 h-m-p  0.0109 0.0547   5.1819 CC     2335.108758  1 0.0034   441 | 0/18
 18 h-m-p  0.0034 0.6289   5.2441 ++YCCCC  2333.477595  4 0.1198   471 | 0/18
 19 h-m-p  0.1508 0.7541   2.0344 CYCCC  2332.506494  4 0.2463   499 | 0/18
 20 h-m-p  0.9337 4.6685   0.2403 CCC    2332.153869  2 0.3524   524 | 0/18
 21 h-m-p  0.6384 8.0000   0.1326 CC     2332.052645  1 0.5103   565 | 0/18
 22 h-m-p  1.2832 8.0000   0.0527 YC     2331.940531  1 3.1527   605 | 0/18
 23 h-m-p  1.0033 8.0000   0.1657 YC     2331.688050  1 2.2067   645 | 0/18
 24 h-m-p  1.2705 8.0000   0.2879 YYC    2331.548486  2 1.0028   686 | 0/18
 25 h-m-p  1.6000 8.0000   0.1448 CCCC   2331.396933  3 2.5927   731 | 0/18
 26 h-m-p  1.1754 5.8769   0.2511 YYCC   2331.247135  3 1.0286   774 | 0/18
 27 h-m-p  0.7732 3.8660   0.2906 YYCC   2331.133667  3 0.7118   817 | 0/18
 28 h-m-p  0.7870 8.0000   0.2628 YCCC   2331.006393  3 1.5688   861 | 0/18
 29 h-m-p  1.1291 8.0000   0.3652 YCCC   2330.797908  3 2.2811   905 | 0/18
 30 h-m-p  0.6019 3.0095   0.6274 CCCC   2330.717034  3 0.6749   950 | 0/18
 31 h-m-p  0.8062 8.0000   0.5252 CCC    2330.616542  2 0.6880   993 | 0/18
 32 h-m-p  0.9505 8.0000   0.3802 YC     2330.514425  1 1.9779  1033 | 0/18
 33 h-m-p  1.6000 8.0000   0.3775 CC     2330.461647  1 1.2664  1074 | 0/18
 34 h-m-p  1.6000 8.0000   0.0566 YC     2330.455948  1 1.0529  1114 | 0/18
 35 h-m-p  1.6000 8.0000   0.0245 YC     2330.454961  1 1.1053  1154 | 0/18
 36 h-m-p  1.6000 8.0000   0.0048 C      2330.454429  0 1.9431  1193 | 0/18
 37 h-m-p  0.6999 8.0000   0.0134 C      2330.454287  0 0.8913  1232 | 0/18
 38 h-m-p  1.6000 8.0000   0.0047 Y      2330.454258  0 1.1923  1271 | 0/18
 39 h-m-p  1.6000 8.0000   0.0021 Y      2330.454257  0 1.1434  1310 | 0/18
 40 h-m-p  1.6000 8.0000   0.0005 C      2330.454256  0 1.3299  1349 | 0/18
 41 h-m-p  1.6000 8.0000   0.0002 Y      2330.454256  0 1.1658  1388 | 0/18
 42 h-m-p  1.6000 8.0000   0.0000 Y      2330.454256  0 0.9148  1427 | 0/18
 43 h-m-p  1.5465 8.0000   0.0000 Y      2330.454256  0 1.5465  1466 | 0/18
 44 h-m-p  1.6000 8.0000   0.0000 Y      2330.454256  0 1.1790  1505 | 0/18
 45 h-m-p  1.6000 8.0000   0.0000 -----C  2330.454256  0 0.0004  1549
Out..
lnL  = -2330.454256
1550 lfun, 18600 eigenQcodon, 221650 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -2341.780272  S = -2223.149394  -110.956447
Calculating f(w|X), posterior probabilities of site classes.

	did  10 / 179 patterns   3:35
	did  20 / 179 patterns   3:35
	did  30 / 179 patterns   3:35
	did  40 / 179 patterns   3:36
	did  50 / 179 patterns   3:36
	did  60 / 179 patterns   3:36
	did  70 / 179 patterns   3:36
	did  80 / 179 patterns   3:36
	did  90 / 179 patterns   3:37
	did 100 / 179 patterns   3:37
	did 110 / 179 patterns   3:37
	did 120 / 179 patterns   3:37
	did 130 / 179 patterns   3:37
	did 140 / 179 patterns   3:38
	did 150 / 179 patterns   3:38
	did 160 / 179 patterns   3:38
	did 170 / 179 patterns   3:38
	did 179 / 179 patterns   3:38
Time used:  3:38
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=290 

D_melanogaster_CG2034-PB   MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
D_sechellia_CG2034-PB      MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
D_simulans_CG2034-PB       MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
D_yakuba_CG2034-PB         MLSNLVVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV
D_erecta_CG2034-PB         MLSNLLVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV
D_biarmipes_CG2034-PB      MLSNLLVTKQKLVLVIDKLNRERIAPKFIGSLLHEQGQGTETIKALPTGV
D_suzukii_CG2034-PB        MLSNLLVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGTETIKTLPTGI
D_eugracilis_CG2034-PB     MLSNLVVTNQKVVLIIDELNRERIAPKFIGSLLHEQGQGTDTIKALPTGV
                           *****:**:**:**:**:*********************::***:****:

D_melanogaster_CG2034-PB   SLKHVATFEALIDKYAN---NNTGS---------TTDSNSTGFNVILPTL
D_sechellia_CG2034-PB      SLKHVATFEALIDKYAN---NNTGS---------TTDSNFTGFNVILPTL
D_simulans_CG2034-PB       SLKHVATFEALIDKYAN---NNTGS---------TTDPNFTGFNVILPTL
D_yakuba_CG2034-PB         SLKHVATFEALITECANTKNNNTAS---------SPRSKSTGFNVILPTL
D_erecta_CG2034-PB         SLKHVATFEALIGECANHKNNNTGS---------IPGSKATGFNVILPTL
D_biarmipes_CG2034-PB      SLKLVATFEALLSECANQNNNNNTAGTPG-----SGAGKPAGFNVILPTL
D_suzukii_CG2034-PB        SLKHVATFEALIAECANQNN----------------TGKPSGFNVILPTL
D_eugracilis_CG2034-PB     SLKHVATFESLIDECANHNNNNTPAGEVGDVDAVTPGSKSTGFNVILPTL
                           *** *****:*: : **                     : :*********

D_melanogaster_CG2034-PB   ADLLCYQTPAFIFGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCE
D_sechellia_CG2034-PB      ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE
D_simulans_CG2034-PB       ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE
D_yakuba_CG2034-PB         ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHADYILAGCE
D_erecta_CG2034-PB         ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHAEYILAGCE
D_biarmipes_CG2034-PB      ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPQHLQHPHAEYILAGCE
D_suzukii_CG2034-PB        ADLLCYQSPAFIFSFLNRLRRSEHVRRVFLWASPQHLQHPHADYILAGCE
D_eugracilis_CG2034-PB     ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPHHLQHPHAAYILAGCE
                           *******:*****.********::* ********:***.*** *******

D_melanogaster_CG2034-PB   YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP
D_sechellia_CG2034-PB      YLAELVLRLETDKLLSLISRKPGGGVTNRRYSCEVSKTQFKVTPLDGGRP
D_simulans_CG2034-PB       YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP
D_yakuba_CG2034-PB         YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCQVSKTSFQVTPLDGGLP
D_erecta_CG2034-PB         YLAELVLRLESDKLLSLISRKPGGAVSNKRYSCQVSKTFFQVTPLDGGLP
D_biarmipes_CG2034-PB      YLAELVLRLETDKQLSLISRKPGGGVTNRRFACQISKTEFQVTPLDEGQP
D_suzukii_CG2034-PB        YLAELVLRLETDKLLSLISRKPGGGVSNRRFACQVSKTQFQVTPLDEGLP
D_eugracilis_CG2034-PB     YLAKLVLRLETDKLLSIISRKPGGGVTNRRFSCQVSKTQFLVTPVDGGLP
                           ***:******:** **:*******.*:*:*::*::*** * ***:* * *

D_melanogaster_CG2034-PB   AGASPKQPSPEAEQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSE
D_sechellia_CG2034-PB      AGASSKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE
D_simulans_CG2034-PB       AGASPKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE
D_yakuba_CG2034-PB         AGASPKQPSPESEQTPEPASSTFKIELDEDEVVARNALTLPYERTCEPSE
D_erecta_CG2034-PB         AGGSPKQPSPETEQTPEPASSTFKIELDEDEVMARNALTLPYERTCEPSE
D_biarmipes_CG2034-PB      AGASPKQSSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPTE
D_suzukii_CG2034-PB        TGVSPKQPTPEAEQTPEPASSTFKIELDEDEMVARNALTLPYERTSEPTE
D_eugracilis_CG2034-PB     AGVSPKQPSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPSE
                           :* *.**.:**:***.***************::************.**.*

D_melanogaster_CG2034-PB   GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo----
D_sechellia_CG2034-PB      GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo----
D_simulans_CG2034-PB       GNIIYTPDADDDFDEEDPDEDLCIoooooooooooo----
D_yakuba_CG2034-PB         GNIIYTPDADDDFDEEDPDEDLCIooooooooo-------
D_erecta_CG2034-PB         GNIIYTPDADDDFDEEDPDEDLCIooooooooo-------
D_biarmipes_CG2034-PB      GNIIYTPDADDDFDEEDPDEDLCIooooo-----------
D_suzukii_CG2034-PB        GNIIYTPDADDDFDEEDPDEDLCIoooooooooooooooo
D_eugracilis_CG2034-PB     GNIIYTPDADDDFDEEDPDEDLCI----------------
                           ************************                



>D_melanogaster_CG2034-PB
ATGCTCTCCAACCTGGTGGTGACCAAGCAGAAAGTGGTCCTCGTAATAGA
TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGTCTGCTGC
ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTGCCCACCGGCGTC
AGCCTTAAGCACGTGGCCACCTTCGAGGCACTGATCGACAAGTACGCCAA
C---------AACAACACTGGGAGT-------------------------
--ACTACGGATTCCAACTCCACTGGCTTTAACGTCATCCTGCCAACATTG
GCAGACCTGCTGTGCTACCAGACGCCTGCTTTCATATTTGGCTTCCTCAA
CCGCCTACGCCGCTCGGACAATGTGCGTCGGGTTTTCCTTTGGGCCTCCC
CGCAGCACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG
TACCTGGCCGAGCTGGTCCTCCGACTGGAATCGGACAAACTACTCTCGCT
GATATCACGCAAGCCGGGCGGAGGGGTGTCCAACAGGCGCTACTCCTGCG
AAGTCAGCAAAACCCAGTTCAAGGTGACGCCGCTGGACGGAGGACTGCCT
GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCACAGA
GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAAGTGTTGG
CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGTCTGAG
GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA
TCCGGACGAGGATCTGTGCATC----------------------------
--------------------
>D_sechellia_CG2034-PB
ATGCTCTCCAACCTGGTGGTCACCAAGCAGAAAGTGGTCCTCATAATAGA
TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTCCCCACCGGCGTC
AGCCTGAAGCACGTGGCCACCTTTGAGGCACTGATCGACAAGTACGCCAA
C---------AACAACACTGGGAGT-------------------------
--ACTACGGATTCCAACTTCACTGGCTTTAACGTCATCCTGCCCACATTG
GCCGACCTGCTGTGCTACCAGACGCCCGCTTTCATATTTGGCTTTCTCAA
CCGCCTACGACGCTCGGAAAATGTGCGTCGGGTGTTCCTTTGGGCCTCCC
CGCAACACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG
TACCTGGCCGAGCTGGTCCTCCGACTGGAAACGGACAAACTACTCTCGCT
GATATCACGCAAGCCGGGTGGAGGGGTGACCAACAGGCGCTACTCCTGCG
AAGTCAGCAAAACCCAATTTAAGGTGACGCCGCTTGACGGAGGACGTCCT
GCAGGTGCCTCCTCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCCCAGA
GCCGGCCAGCAGCACCTTTAAAATCGAGCTTGACGAGGATGAAGTGCTGG
CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGCCTGAG
GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA
TCCGGACGAGGATCTGTGCATC----------------------------
--------------------
>D_simulans_CG2034-PB
ATGCTCTCCAACCTGGTGGTCACCAAGCAGAAAGTGGTCCTCATAATAGA
TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
ACGAGCAGGGACAGGGGGCGGATACCATCAAGGCCCTCCCCACCGGCGTC
AGCCTGAAGCACGTGGCCACCTTCGAGGCACTGATCGACAAGTACGCCAA
C---------AACAACACTGGGAGT-------------------------
--ACTACGGATCCCAACTTCACTGGCTTTAACGTCATCCTGCCCACATTG
GCCGACCTGCTGTGCTACCAGACGCCCGCTTTCATATTTGGCTTCCTCAA
CCGCCTACGACGCTCGGAAAATGTGCGTCGGGTGTTCCTTTGGGCCTCCC
CGCAGCACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAG
TACCTGGCCGAGCTGGTCCTCCGACTGGAATCGGACAAACTACTCTCGCT
GATATCACGCAAGCCGGGCGGAGGGGTGTCCAACAGGCGCTACTCCTGCG
AAGTCAGCAAAACCCAGTTCAAGGTGACGCCGCTGGACGGAGGACTTCCT
GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCCCAGA
GCCGGCCAGCAGCACCTTTAAAATCGAGCTTGACGAGGATGAAGTGCTGG
CCCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGCCTGAG
GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA
TCCGGACGAGGATCTGTGCATC----------------------------
--------------------
>D_yakuba_CG2034-PB
ATGCTCTCCAACCTGGTGGTGACCAATCAGAAAGTGGTCCTCGTAATAGA
TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGTCTGCTGC
ACGAGCAGGGACAGGGGGCGGAAACCATCAAGGCCCTGCCCACCGGCGTC
AGCCTGAAGCACGTGGCCACCTTCGAGGCGCTGATCACCGAGTGCGCCAA
CACCAAAAACAACAACACTGCGAGC-------------------------
--AGTCCTCGCTCGAAATCCACTGGCTTCAACGTCATCCTGCCCACCTTG
GCCGATCTGCTGTGCTACCAGACGCCCGCTTTCATCTTTGGCTTCCTCAA
CCGCCTGCGGCGCTCGGAGAATGTGTGCCGTGTGTTCCTGTGGGCCTCCC
CGCAGCACCTACAGAATCCCCATGCCGACTACATCCTGGCGGGCTGCGAG
TACCTGGCCGAGTTGGTCCTACGACTAGAATCCGACAAATTACTCTCACT
GATTTCAAGAAAGCCGGGCGGTGGGGTGTCCAACAGGCGCTACTCCTGCC
AAGTCAGCAAAACCTCTTTCCAGGTAACGCCGCTGGACGGAGGACTACCT
GCAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAATCGGAGCAGACCCCAGA
GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAAGTGGTGG
CCCGCAATGCACTCACCCTTCCATACGAACGCACATGCGAACCGTCTGAG
GGAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGA
TCCGGACGAGGATCTGTGCATC----------------------------
--------------------
>D_erecta_CG2034-PB
ATGCTCTCCAACCTGTTGGTGACCAATCAGAAAGTGGTCCTCGTTATAGA
TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
ACGAGCAGGGACAGGGGGCGGAAACTATCAAGGCCCTGCCCACCGGCGTC
AGTCTGAAGCACGTGGCCACCTTCGAGGCGCTGATTGGCGAGTGCGCCAA
CCACAAAAACAACAACACTGGGAGC-------------------------
--ATTCCGGGATCCAAAGCCACTGGCTTCAACGTCATCCTGCCCACCTTG
GCCGACCTGCTGTGCTACCAGACGCCCGCCTTCATCTTTGGCTTCCTCAA
CCGCCTGCGGCGCTCGGAGAACGTGTGCCGCGTGTTCCTGTGGGCCTCCC
CACAACACTTACAGAATCCCCATGCCGAATACATCCTGGCTGGCTGCGAG
TACCTGGCCGAGTTGGTCCTACGACTGGAATCCGACAAATTACTCTCGCT
GATTTCACGCAAGCCGGGCGGTGCGGTGTCCAACAAGCGCTACTCCTGCC
AAGTCAGCAAAACCTTTTTCCAGGTGACGCCGCTGGACGGAGGGCTACCT
GCAGGTGGCTCCCCCAAGCAGCCCTCGCCCGAGACGGAGCAGACCCCAGA
GCCGGCCAGCAGCACCTTCAAAATCGAACTTGACGAGGATGAAGTGATGG
CCCGCAATGCACTCACCCTGCCATACGAACGCACGTGCGAGCCGTCTGAG
GGAAACATAATATACACGCCCGATGCCGACGATGATTTCGACGAGGAGGA
TCCGGACGAGGATCTGTGCATC----------------------------
--------------------
>D_biarmipes_CG2034-PB
ATGCTCTCCAACCTGCTGGTGACCAAACAAAAGCTGGTCCTCGTAATAGA
TAAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
ACGAGCAGGGCCAGGGGACGGAGACCATCAAGGCCCTGCCCACCGGCGTC
AGCCTCAAGCTCGTGGCCACCTTCGAGGCGCTGCTCTCGGAGTGCGCCAA
CCAAAACAACAACAACAACACTGCGGGCACTCCGGGC-------------
--TCAGGAGCAGGAAAGCCCGCCGGTTTCAACGTCATCCTGCCCACACTG
GCCGACCTGCTGTGCTACCAGTCGCCCGCCTTCATCTTTGGCTTCCTCAA
CCGCCTGCGTCGTTCGGAGCACGTGCGTCGTGTGTTCCTCTGGGCCTCCC
CGCAGCACCTGCAGCATCCGCATGCGGAGTACATCCTGGCTGGCTGCGAG
TACCTGGCGGAGTTGGTCCTTCGCCTGGAGACGGACAAGCAACTATCGCT
GATATCGCGTAAACCCGGTGGCGGAGTGACCAACAGGCGCTTCGCCTGCC
AGATCAGCAAGACCGAGTTCCAGGTGACGCCGCTGGACGAAGGACAGCCC
GCAGGAGCCTCACCCAAACAGTCTTCCCCGGAGGCGGAGCAAACCCCAGA
GCCGGCCAGCAGCACCTTCAAAATCGAGCTCGACGAGGACGAGGTGGTGG
CCCGCAATGCACTCACCCTGCCATACGAACGCACCAGCGAGCCGACCGAG
GGCAACATTATATACACACCCGATGCCGACGACGACTTCGACGAGGAGGA
TCCGGACGAGGATCTGTGCATC----------------------------
--------------------
>D_suzukii_CG2034-PB
ATGCTCTCCAACCTGCTGGTGACCAAACAAAAAGTGGTCCTCGTAATAGA
TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCCTGCTGC
ACGAACAGGGCCAGGGGACGGAGACCATCAAGACCCTGCCCACCGGCATC
AGCCTGAAGCACGTGGCCACCTTCGAGGCACTGATCGCCGAGTGCGCCAA
CCAAAACAAC----------------------------------------
--------ACAGGGAAACCCTCCGGCTTCAACGTCATCCTGCCCACACTG
GCCGACCTGCTGTGCTACCAGTCGCCCGCCTTTATCTTTAGCTTCCTCAA
CCGCCTGCGTCGCTCGGAGCACGTGCGTCGTGTGTTCCTCTGGGCCTCCC
CGCAGCACCTCCAGCATCCCCATGCCGACTACATCCTGGCTGGCTGCGAG
TACCTGGCGGAGCTGGTGCTTCGCCTGGAGACGGACAAGCTACTATCACT
GATATCGCGCAAACCCGGTGGCGGGGTGTCCAACAGGCGGTTCGCCTGCC
AGGTCAGCAAGACCCAGTTCCAGGTGACGCCGCTTGACGAAGGGCTGCCC
ACAGGTGTCTCACCCAAACAGCCTACCCCGGAGGCGGAGCAAACCCCAGA
GCCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAGATGGTGG
CCCGCAATGCACTCACCCTGCCATATGAACGCACCAGCGAGCCGACTGAG
GGCAACATCATATACACACCCGATGCTGACGACGACTTCGATGAGGAGGA
TCCGGACGAGGATCTGTGCATC----------------------------
--------------------
>D_eugracilis_CG2034-PB
ATGCTTTCAAATCTTGTGGTGACCAATCAAAAAGTGGTCCTCATAATAGA
TGAGCTAAATCGGGAGCGCATTGCCCCCAAGTTCATCGGCAGCTTGCTTC
ACGAACAGGGACAGGGGACAGATACAATCAAGGCCTTGCCCACCGGCGTC
AGTCTGAAGCACGTGGCCACCTTCGAATCGCTGATCGACGAGTGCGCCAA
CCATAACAACAACAACACCCCTGCCGGAGAAGTGGGCGACGTGGATGCGG
TTACTCCGGGATCGAAATCTACCGGCTTCAACGTCATCCTGCCCACCTTG
GCTGACCTGCTGTGCTATCAGTCGCCCGCTTTTATTTTTGGCTTCCTTAA
CCGCCTACGTCGCTCGGAGCATGTGCGTCGAGTGTTCCTCTGGGCTTCCC
CGCACCATCTGCAGCATCCTCATGCTGCCTACATTCTGGCTGGCTGCGAA
TACTTGGCCAAGTTGGTGCTCCGCTTGGAAACAGACAAGCTACTGTCCAT
AATATCACGCAAGCCGGGCGGAGGAGTTACAAACAGACGCTTCTCATGCC
AGGTCAGCAAAACCCAGTTCCTGGTGACGCCGGTGGACGGAGGACTCCCG
GCAGGTGTCTCTCCCAAGCAGCCCTCGCCAGAGGCAGAGCAAACCCCAGA
ACCGGCCAGCAGCACCTTTAAGATCGAGCTCGACGAGGATGAAGTGGTTG
CTCGCAATGCACTTACCCTGCCATACGAACGCACAAGCGAGCCGTCCGAG
GGAAACATTATATACACGCCCGATGCCGACGACGACTTTGATGAGGAGGA
TCCTGACGAGGATCTGTGCATC----------------------------
--------------------
>D_melanogaster_CG2034-PB
MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYAN---NNTGS---------TTDSNSTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCE
YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP
AGASPKQPSPEAEQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSE
GNIIYTPDADDDFDEEDPDEDLCI
>D_sechellia_CG2034-PB
MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYAN---NNTGS---------TTDSNFTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE
YLAELVLRLETDKLLSLISRKPGGGVTNRRYSCEVSKTQFKVTPLDGGRP
AGASSKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE
GNIIYTPDADDDFDEEDPDEDLCI
>D_simulans_CG2034-PB
MLSNLVVTKQKVVLIIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYAN---NNTGS---------TTDPNFTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVRRVFLWASPQHLQDPHADYILAGCE
YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLP
AGASPKQPSPEAEQTPEPASSTFKIELDEDEVLARNALTLPYERTSEPPE
GNIIYTPDADDDFDEEDPDEDLCI
>D_yakuba_CG2034-PB
MLSNLVVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV
SLKHVATFEALITECANTKNNNTAS---------SPRSKSTGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHADYILAGCE
YLAELVLRLESDKLLSLISRKPGGGVSNRRYSCQVSKTSFQVTPLDGGLP
AGASPKQPSPESEQTPEPASSTFKIELDEDEVVARNALTLPYERTCEPSE
GNIIYTPDADDDFDEEDPDEDLCI
>D_erecta_CG2034-PB
MLSNLLVTNQKVVLVIDELNRERIAPKFIGSLLHEQGQGAETIKALPTGV
SLKHVATFEALIGECANHKNNNTGS---------IPGSKATGFNVILPTL
ADLLCYQTPAFIFGFLNRLRRSENVCRVFLWASPQHLQNPHAEYILAGCE
YLAELVLRLESDKLLSLISRKPGGAVSNKRYSCQVSKTFFQVTPLDGGLP
AGGSPKQPSPETEQTPEPASSTFKIELDEDEVMARNALTLPYERTCEPSE
GNIIYTPDADDDFDEEDPDEDLCI
>D_biarmipes_CG2034-PB
MLSNLLVTKQKLVLVIDKLNRERIAPKFIGSLLHEQGQGTETIKALPTGV
SLKLVATFEALLSECANQNNNNNTAGTPG-----SGAGKPAGFNVILPTL
ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPQHLQHPHAEYILAGCE
YLAELVLRLETDKQLSLISRKPGGGVTNRRFACQISKTEFQVTPLDEGQP
AGASPKQSSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPTE
GNIIYTPDADDDFDEEDPDEDLCI
>D_suzukii_CG2034-PB
MLSNLLVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGTETIKTLPTGI
SLKHVATFEALIAECANQNN----------------TGKPSGFNVILPTL
ADLLCYQSPAFIFSFLNRLRRSEHVRRVFLWASPQHLQHPHADYILAGCE
YLAELVLRLETDKLLSLISRKPGGGVSNRRFACQVSKTQFQVTPLDEGLP
TGVSPKQPTPEAEQTPEPASSTFKIELDEDEMVARNALTLPYERTSEPTE
GNIIYTPDADDDFDEEDPDEDLCI
>D_eugracilis_CG2034-PB
MLSNLVVTNQKVVLIIDELNRERIAPKFIGSLLHEQGQGTDTIKALPTGV
SLKHVATFESLIDECANHNNNNTPAGEVGDVDAVTPGSKSTGFNVILPTL
ADLLCYQSPAFIFGFLNRLRRSEHVRRVFLWASPHHLQHPHAAYILAGCE
YLAKLVLRLETDKLLSIISRKPGGGVTNRRFSCQVSKTQFLVTPVDGGLP
AGVSPKQPSPEAEQTPEPASSTFKIELDEDEVVARNALTLPYERTSEPSE
GNIIYTPDADDDFDEEDPDEDLCI
#NEXUS

[ID: 3981457565]
begin taxa;
	dimensions ntax=8;
	taxlabels
		D_melanogaster_CG2034-PB
		D_sechellia_CG2034-PB
		D_simulans_CG2034-PB
		D_yakuba_CG2034-PB
		D_erecta_CG2034-PB
		D_biarmipes_CG2034-PB
		D_suzukii_CG2034-PB
		D_eugracilis_CG2034-PB
		;
end;
begin trees;
	translate
		1	D_melanogaster_CG2034-PB,
		2	D_sechellia_CG2034-PB,
		3	D_simulans_CG2034-PB,
		4	D_yakuba_CG2034-PB,
		5	D_erecta_CG2034-PB,
		6	D_biarmipes_CG2034-PB,
		7	D_suzukii_CG2034-PB,
		8	D_eugracilis_CG2034-PB
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.0192839,(2:0.02152893,3:0.002432525)1.000:0.01545975,((4:0.04465051,5:0.04650573)1.000:0.04209891,((6:0.08797058,7:0.04013295)1.000:0.1354437,8:0.1810676)1.000:0.07688734)1.000:0.04878292);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.0192839,(2:0.02152893,3:0.002432525):0.01545975,((4:0.04465051,5:0.04650573):0.04209891,((6:0.08797058,7:0.04013295):0.1354437,8:0.1810676):0.07688734):0.04878292);
end;
      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2621.36         -2634.89
2      -2621.59         -2637.33
--------------------------------------
TOTAL    -2621.47         -2636.72
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/100/CG2034-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.779663    0.006734    0.629642    0.943847    0.773218   1203.55   1352.28    1.001
r(A<->C){all}   0.086651    0.000400    0.051370    0.128583    0.085229   1218.04   1230.31    1.000
r(A<->G){all}   0.238300    0.001321    0.173523    0.312639    0.235503    614.91    777.70    1.000
r(A<->T){all}   0.197501    0.001655    0.120352    0.277447    0.195508    929.44    932.23    1.000
r(C<->G){all}   0.044300    0.000146    0.020022    0.067380    0.043567    961.68   1064.80    1.000
r(C<->T){all}   0.324947    0.001799    0.242997    0.409177    0.323865    889.23    944.60    1.000
r(G<->T){all}   0.108302    0.000646    0.062211    0.160564    0.106249    673.98    728.17    1.000
pi(A){all}      0.221604    0.000168    0.196999    0.247555    0.221297   1155.00   1307.61    1.000
pi(C){all}      0.329344    0.000222    0.302974    0.360473    0.329315   1342.36   1359.13    1.000
pi(G){all}      0.278205    0.000209    0.252199    0.307758    0.277970   1081.96   1119.08    1.000
pi(T){all}      0.170846    0.000137    0.147577    0.192946    0.170569    936.55   1014.05    1.000
alpha{1,2}      0.134058    0.001498    0.052669    0.210920    0.134628   1108.09   1192.13    1.000
alpha{3}        2.319434    0.740613    1.004297    4.143426    2.182697    989.25   1180.87    1.000
pinvar{all}     0.188331    0.008083    0.004948    0.336468    0.192165    996.61   1205.45    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014)  /opt/ADOPS/100/CG2034-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches, 
Codon frequency model: F3x4
Site-class models: 
ns =   8  ls = 255

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   2   6   3   1   2   1 | Ser TCT   1   0   0   2   1   1 | Tyr TAT   0   0   0   0   0   0 | Cys TGT   0   0   0   0   0   0
    TTC   8   5   8   9   9  10 |     TCC   8   7   6   7   7   3 |     TAC   7   7   7   6   6   5 |     TGC   4   4   4   7   7   5
Leu TTA   0   0   0   1   2   0 |     TCA   1   1   1   2   1   1 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   2   1   1   2   3   1 |     TCG   4   3   4   4   3   5 |     TAG   0   0   0   0   0   0 | Trp TGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   3   3   3   2   1   1 | Pro CCT   2   2   2   1   1   0 | His CAT   1   1   1   1   1   2 | Arg CGT   1   2   1   1   0   5
    CTC   6   7   7   5   5   9 |     CCC   6   7   9   9   9   9 |     CAC   3   3   3   3   3   3 |     CGC   8   7   7   7   8   6
    CTA   3   3   3   5   3   2 |     CCA   2   2   2   2   3   2 | Gln CAA   0   2   0   1   2   3 |     CGA   1   2   2   1   1   0
    CTG  18  17  18  16  18  20 |     CCG   7   7   7   6   5   7 |     CAG   9   7   9   9   8   9 |     CGG   2   2   2   2   2   1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   1   1   1   2   3   2 | Thr ACT   1   1   1   1   2   0 | Asn AAT   3   3   3   5   4   2 | Ser AGT   1   0   0   1   1   0
    ATC   7   7   7   8   7   8 |     ACC   8   9   8  10   8  11 |     AAC   7   7   7   6   7   6 |     AGC   4   5   5   4   4   6
    ATA   5   6   6   3   3   3 |     ACA   3   2   2   1   0   2 | Lys AAA   4   4   4   5   5   4 | Arg AGA   0   0   0   1   0   0
Met ATG   1   1   1   1   2   1 |     ACG   3   4   3   3   5   3 |     AAG   8   8   8   5   6   8 |     AGG   1   1   1   1   0   1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   1   0   0   0   1   0 | Ala GCT   2   2   2   1   1   1 | Asp GAT   9   9   9   7   7   4 | Gly GGT   1   2   1   2   2   2
    GTC   5   6   6   5   5   4 |     GCC  11  12  12  12  13  13 |     GAC  11  10  10   8   7  10 |     GGC   6   5   6   6   8   7
    GTA   1   0   0   2   0   1 |     GCA   4   3   3   2   2   3 | Glu GAA   4   5   5   6   6   2 |     GGA   5   5   5   4   4   4
    GTG   8   8   8   9   8   8 |     GCG   2   2   2   3   3   4 |     GAG  16  16  16  16  17  22 |     GGG   2   2   2   2   2   1
--------------------------------------------------------------------------------------------------------------------------------------

----------------------------------------------------------------------
Phe TTT   2   4 | Ser TCT   0   2 | Tyr TAT   1   1 | Cys TGT   0   0
    TTC   9   7 |     TCC   4   3 |     TAC   4   4 |     TGC   5   5
Leu TTA   0   0 |     TCA   2   3 | *** TAA   0   0 | *** TGA   0   0
    TTG   0   6 |     TCG   3   5 |     TAG   0   0 | Trp TGG   1   1
----------------------------------------------------------------------
Leu CTT   3   5 | Pro CCT   1   2 | His CAT   2   4 | Arg CGT   3   2
    CTC   6   5 |     CCC  10   7 |     CAC   4   3 |     CGC   7   8
    CTA   3   3 |     CCA   2   3 | Gln CAA   2   2 |     CGA   0   1
    CTG  20  11 |     CCG   6   6 |     CAG   9   7 |     CGG   2   1
----------------------------------------------------------------------
Ile ATT   1   4 | Thr ACT   1   0 | Asn AAT   2   4 | Ser AGT   0   1
    ATC  10   6 |     ACC  11   9 |     AAC   6   5 |     AGC   7   5
    ATA   3   5 |     ACA   4   5 | Lys AAA   6   3 | Arg AGA   0   1
Met ATG   2   1 |     ACG   3   2 |     AAG   5   8 |     AGG   1   0
----------------------------------------------------------------------
Val GTT   0   2 | Ala GCT   2   6 | Asp GAT   6   7 | Gly GGT   2   1
    GTC   4   5 |     GCC  11   8 |     GAC   9   9 |     GGC   7   6
    GTA   1   0 |     GCA   2   3 | Glu GAA   3   7 |     GGA   0   7
    GTG   9  10 |     GCG   2   0 |     GAG  20  13 |     GGG   4   1
----------------------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: D_melanogaster_CG2034-PB             
position  1:    T:0.14902    C:0.28235    A:0.22353    G:0.34510
position  2:    T:0.27843    C:0.25490    A:0.32157    G:0.14510
position  3:    T:0.11373    C:0.42745    A:0.12941    G:0.32941
Average         T:0.18039    C:0.32157    A:0.22484    G:0.27320

#2: D_sechellia_CG2034-PB             
position  1:    T:0.13725    C:0.29020    A:0.23137    G:0.34118
position  2:    T:0.27843    C:0.25098    A:0.32157    G:0.14902
position  3:    T:0.12549    C:0.42353    A:0.13725    G:0.31373
Average         T:0.18039    C:0.32157    A:0.23007    G:0.26797

#3: D_simulans_CG2034-PB             
position  1:    T:0.13725    C:0.29804    A:0.22353    G:0.34118
position  2:    T:0.28235    C:0.25098    A:0.32157    G:0.14510
position  3:    T:0.10588    C:0.43922    A:0.12941    G:0.32549
Average         T:0.17516    C:0.32941    A:0.22484    G:0.27059

#4: D_yakuba_CG2034-PB             
position  1:    T:0.16471    C:0.27843    A:0.22353    G:0.33333
position  2:    T:0.27843    C:0.25882    A:0.30588    G:0.15686
position  3:    T:0.10588    C:0.43922    A:0.14118    G:0.31373
Average         T:0.18301    C:0.32549    A:0.22353    G:0.26797

#5: D_erecta_CG2034-PB             
position  1:    T:0.16471    C:0.27451    A:0.22353    G:0.33725
position  2:    T:0.28235    C:0.25098    A:0.30980    G:0.15686
position  3:    T:0.10588    C:0.44314    A:0.12549    G:0.32549
Average         T:0.18431    C:0.32288    A:0.21961    G:0.27320

#6: D_biarmipes_CG2034-PB             
position  1:    T:0.12941    C:0.30980    A:0.22353    G:0.33725
position  2:    T:0.27843    C:0.25490    A:0.31373    G:0.15294
position  3:    T:0.08235    C:0.45098    A:0.10588    G:0.36078
Average         T:0.16340    C:0.33856    A:0.21438    G:0.28366

#7: D_suzukii_CG2034-PB             
position  1:    T:0.12157    C:0.31373    A:0.24314    G:0.32157
position  2:    T:0.28627    C:0.25098    A:0.30980    G:0.15294
position  3:    T:0.10196    C:0.44706    A:0.10980    G:0.34118
Average         T:0.16993    C:0.33725    A:0.22092    G:0.27190

#8: D_eugracilis_CG2034-PB             
position  1:    T:0.16078    C:0.27451    A:0.23137    G:0.33333
position  2:    T:0.29020    C:0.25098    A:0.30196    G:0.15686
position  3:    T:0.17647    C:0.37255    A:0.16863    G:0.28235
Average         T:0.20915    C:0.29935    A:0.23399    G:0.25752

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT      21 | Ser S TCT       7 | Tyr Y TAT       2 | Cys C TGT       0
      TTC      65 |       TCC      45 |       TAC      46 |       TGC      41
Leu L TTA       3 |       TCA      12 | *** * TAA       0 | *** * TGA       0
      TTG      16 |       TCG      31 |       TAG       0 | Trp W TGG       8
------------------------------------------------------------------------------
Leu L CTT      21 | Pro P CCT      11 | His H CAT      13 | Arg R CGT      15
      CTC      50 |       CCC      66 |       CAC      25 |       CGC      58
      CTA      25 |       CCA      18 | Gln Q CAA      12 |       CGA       8
      CTG     138 |       CCG      51 |       CAG      67 |       CGG      14
------------------------------------------------------------------------------
Ile I ATT      15 | Thr T ACT       7 | Asn N AAT      26 | Ser S AGT       4
      ATC      60 |       ACC      74 |       AAC      51 |       AGC      40
      ATA      34 |       ACA      19 | Lys K AAA      35 | Arg R AGA       2
Met M ATG      10 |       ACG      26 |       AAG      56 |       AGG       6
------------------------------------------------------------------------------
Val V GTT       4 | Ala A GCT      17 | Asp D GAT      58 | Gly G GGT      13
      GTC      40 |       GCC      92 |       GAC      74 |       GGC      51
      GTA       5 |       GCA      22 | Glu E GAA      38 |       GGA      34
      GTG      68 |       GCG      18 |       GAG     136 |       GGG      16
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.14559    C:0.29020    A:0.22794    G:0.33627
position  2:    T:0.28186    C:0.25294    A:0.31324    G:0.15196
position  3:    T:0.11471    C:0.43039    A:0.13088    G:0.32402
Average         T:0.18072    C:0.32451    A:0.22402    G:0.27075


Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)

D_melanogaster_CG2034-PB                  
D_sechellia_CG2034-PB                   0.1522 (0.0159 0.1047)
D_simulans_CG2034-PB                   0.1646 (0.0106 0.0644) 0.2386 (0.0088 0.0369)
D_yakuba_CG2034-PB                   0.1917 (0.0387 0.2018) 0.1968 (0.0480 0.2437) 0.2099 (0.0424 0.2020)
D_erecta_CG2034-PB                   0.1984 (0.0451 0.2273) 0.2249 (0.0544 0.2419) 0.2285 (0.0488 0.2136) 0.1567 (0.0231 0.1476)
D_biarmipes_CG2034-PB                   0.1870 (0.0731 0.3910) 0.1669 (0.0721 0.4321) 0.1914 (0.0741 0.3870) 0.1356 (0.0631 0.4653) 0.1382 (0.0656 0.4748)
D_suzukii_CG2034-PB                   0.1696 (0.0652 0.3845) 0.1713 (0.0690 0.4028) 0.1718 (0.0649 0.3777) 0.1334 (0.0573 0.4296) 0.1496 (0.0632 0.4224) 0.2256 (0.0377 0.1670)
D_eugracilis_CG2034-PB                   0.1028 (0.0535 0.5199) 0.0958 (0.0525 0.5477) 0.1121 (0.0544 0.4850) 0.0813 (0.0488 0.6006) 0.0896 (0.0543 0.6062) 0.0964 (0.0596 0.6177) 0.0859 (0.0515 0.5998)


Model 0: one-ratio


TREE #  1:  (1, (2, 3), ((4, 5), ((6, 7), 8)));   MP score: 263
lnL(ntime: 13  np: 15):  -2363.002381      +0.000000
   9..1     9..10   10..2    10..3     9..11   11..12   12..4    12..5    11..13   13..14   14..6    14..7    13..8  
 0.036833 0.033987 0.044114 0.003970 0.088844 0.080297 0.062894 0.105587 0.105626 0.171074 0.134395 0.087126 0.287404 2.269799 0.109229

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.24215

(1: 0.036833, (2: 0.044114, 3: 0.003970): 0.033987, ((4: 0.062894, 5: 0.105587): 0.080297, ((6: 0.134395, 7: 0.087126): 0.171074, 8: 0.287404): 0.105626): 0.088844);

(D_melanogaster_CG2034-PB: 0.036833, (D_sechellia_CG2034-PB: 0.044114, D_simulans_CG2034-PB: 0.003970): 0.033987, ((D_yakuba_CG2034-PB: 0.062894, D_erecta_CG2034-PB: 0.105587): 0.080297, ((D_biarmipes_CG2034-PB: 0.134395, D_suzukii_CG2034-PB: 0.087126): 0.171074, D_eugracilis_CG2034-PB: 0.287404): 0.105626): 0.088844);

Detailed output identifying parameters

kappa (ts/tv) =  2.26980

omega (dN/dS) =  0.10923

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   9..1      0.037   602.5   162.5  0.1092  0.0045  0.0411   2.7   6.7
   9..10     0.034   602.5   162.5  0.1092  0.0041  0.0380   2.5   6.2
  10..2      0.044   602.5   162.5  0.1092  0.0054  0.0493   3.2   8.0
  10..3      0.004   602.5   162.5  0.1092  0.0005  0.0044   0.3   0.7
   9..11     0.089   602.5   162.5  0.1092  0.0108  0.0992   6.5  16.1
  11..12     0.080   602.5   162.5  0.1092  0.0098  0.0897   5.9  14.6
  12..4      0.063   602.5   162.5  0.1092  0.0077  0.0702   4.6  11.4
  12..5      0.106   602.5   162.5  0.1092  0.0129  0.1179   7.8  19.2
  11..13     0.106   602.5   162.5  0.1092  0.0129  0.1180   7.8  19.2
  13..14     0.171   602.5   162.5  0.1092  0.0209  0.1911  12.6  31.0
  14..6      0.134   602.5   162.5  0.1092  0.0164  0.1501   9.9  24.4
  14..7      0.087   602.5   162.5  0.1092  0.0106  0.0973   6.4  15.8
  13..8      0.287   602.5   162.5  0.1092  0.0351  0.3210  21.1  52.2

tree length for dN:       0.1515
tree length for dS:       1.3874


Time used:  0:07


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, (2, 3), ((4, 5), ((6, 7), 8)));   MP score: 263
lnL(ntime: 13  np: 16):  -2332.085329      +0.000000
   9..1     9..10   10..2    10..3     9..11   11..12   12..4    12..5    11..13   13..14   14..6    14..7    13..8  
 0.039194 0.035447 0.046812 0.003416 0.094673 0.085950 0.069087 0.111297 0.112615 0.186038 0.142564 0.091010 0.317067 2.361394 0.884952 0.041015

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.33517

(1: 0.039194, (2: 0.046812, 3: 0.003416): 0.035447, ((4: 0.069087, 5: 0.111297): 0.085950, ((6: 0.142564, 7: 0.091010): 0.186038, 8: 0.317067): 0.112615): 0.094673);

(D_melanogaster_CG2034-PB: 0.039194, (D_sechellia_CG2034-PB: 0.046812, D_simulans_CG2034-PB: 0.003416): 0.035447, ((D_yakuba_CG2034-PB: 0.069087, D_erecta_CG2034-PB: 0.111297): 0.085950, ((D_biarmipes_CG2034-PB: 0.142564, D_suzukii_CG2034-PB: 0.091010): 0.186038, D_eugracilis_CG2034-PB: 0.317067): 0.112615): 0.094673);

Detailed output identifying parameters

kappa (ts/tv) =  2.36139


dN/dS (w) for site classes (K=2)

p:   0.88495  0.11505
w:   0.04102  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   9..1       0.039    601.8    163.2   0.1513   0.0059   0.0393    3.6    6.4
   9..10      0.035    601.8    163.2   0.1513   0.0054   0.0356    3.2    5.8
  10..2       0.047    601.8    163.2   0.1513   0.0071   0.0470    4.3    7.7
  10..3       0.003    601.8    163.2   0.1513   0.0005   0.0034    0.3    0.6
   9..11      0.095    601.8    163.2   0.1513   0.0144   0.0950    8.6   15.5
  11..12      0.086    601.8    163.2   0.1513   0.0130   0.0862    7.9   14.1
  12..4       0.069    601.8    163.2   0.1513   0.0105   0.0693    6.3   11.3
  12..5       0.111    601.8    163.2   0.1513   0.0169   0.1116   10.2   18.2
  11..13      0.113    601.8    163.2   0.1513   0.0171   0.1130   10.3   18.4
  13..14      0.186    601.8    163.2   0.1513   0.0282   0.1866   17.0   30.4
  14..6       0.143    601.8    163.2   0.1513   0.0216   0.1430   13.0   23.3
  14..7       0.091    601.8    163.2   0.1513   0.0138   0.0913    8.3   14.9
  13..8       0.317    601.8    163.2   0.1513   0.0481   0.3180   29.0   51.9


Time used:  0:14


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, (2, 3), ((4, 5), ((6, 7), 8)));   MP score: 263
lnL(ntime: 13  np: 18):  -2331.588150      +0.000000
   9..1     9..10   10..2    10..3     9..11   11..12   12..4    12..5    11..13   13..14   14..6    14..7    13..8  
 0.039848 0.036109 0.047619 0.003461 0.094605 0.088479 0.071686 0.116123 0.118358 0.191949 0.148605 0.092462 0.329915 2.406399 0.885674 0.110518 0.042111 6.483911

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.37922

(1: 0.039848, (2: 0.047619, 3: 0.003461): 0.036109, ((4: 0.071686, 5: 0.116123): 0.088479, ((6: 0.148605, 7: 0.092462): 0.191949, 8: 0.329915): 0.118358): 0.094605);

(D_melanogaster_CG2034-PB: 0.039848, (D_sechellia_CG2034-PB: 0.047619, D_simulans_CG2034-PB: 0.003461): 0.036109, ((D_yakuba_CG2034-PB: 0.071686, D_erecta_CG2034-PB: 0.116123): 0.088479, ((D_biarmipes_CG2034-PB: 0.148605, D_suzukii_CG2034-PB: 0.092462): 0.191949, D_eugracilis_CG2034-PB: 0.329915): 0.118358): 0.094605);

Detailed output identifying parameters

kappa (ts/tv) =  2.40640


dN/dS (w) for site classes (K=3)

p:   0.88567  0.11052  0.00381
w:   0.04211  1.00000  6.48391

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   9..1       0.040    601.5    163.5   0.1725   0.0066   0.0380    3.9    6.2
   9..10      0.036    601.5    163.5   0.1725   0.0059   0.0345    3.6    5.6
  10..2       0.048    601.5    163.5   0.1725   0.0078   0.0454    4.7    7.4
  10..3       0.003    601.5    163.5   0.1725   0.0006   0.0033    0.3    0.5
   9..11      0.095    601.5    163.5   0.1725   0.0156   0.0903    9.4   14.8
  11..12      0.088    601.5    163.5   0.1725   0.0146   0.0844    8.8   13.8
  12..4       0.072    601.5    163.5   0.1725   0.0118   0.0684    7.1   11.2
  12..5       0.116    601.5    163.5   0.1725   0.0191   0.1108   11.5   18.1
  11..13      0.118    601.5    163.5   0.1725   0.0195   0.1129   11.7   18.5
  13..14      0.192    601.5    163.5   0.1725   0.0316   0.1832   19.0   29.9
  14..6       0.149    601.5    163.5   0.1725   0.0245   0.1418   14.7   23.2
  14..7       0.092    601.5    163.5   0.1725   0.0152   0.0882    9.2   14.4
  13..8       0.330    601.5    163.5   0.1725   0.0543   0.3148   32.7   51.5


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG2034-PB)

            Pr(w>1)     post mean +- SE for w

    68 D      0.725         4.974


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG2034-PB)

            Pr(w>1)     post mean +- SE for w

    63 D      0.572         1.615 +- 1.272
    68 D      0.790         2.249 +- 2.011
   170 Q      0.609         1.811 +- 1.626



The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   1.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
w2:   0.742  0.079  0.038  0.030  0.026  0.023  0.020  0.017  0.014  0.011

Posterior for p0-p1 (see the ternary graph)

 0.000
 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.355
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.329 0.312

sum of density on p0-p1 =   1.000000

Time used:  0:40


Model 3: discrete (3 categories)


TREE #  1:  (1, (2, 3), ((4, 5), ((6, 7), 8)));   MP score: 263
lnL(ntime: 13  np: 19):  -2331.539283      +0.000000
   9..1     9..10   10..2    10..3     9..11   11..12   12..4    12..5    11..13   13..14   14..6    14..7    13..8  
 0.038745 0.035325 0.046389 0.003582 0.093809 0.085395 0.068062 0.110621 0.111231 0.184809 0.142042 0.090165 0.312846 2.327552 0.725862 0.135304 0.034203 0.034203 0.769536

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.32302

(1: 0.038745, (2: 0.046389, 3: 0.003582): 0.035325, ((4: 0.068062, 5: 0.110621): 0.085395, ((6: 0.142042, 7: 0.090165): 0.184809, 8: 0.312846): 0.111231): 0.093809);

(D_melanogaster_CG2034-PB: 0.038745, (D_sechellia_CG2034-PB: 0.046389, D_simulans_CG2034-PB: 0.003582): 0.035325, ((D_yakuba_CG2034-PB: 0.068062, D_erecta_CG2034-PB: 0.110621): 0.085395, ((D_biarmipes_CG2034-PB: 0.142042, D_suzukii_CG2034-PB: 0.090165): 0.184809, D_eugracilis_CG2034-PB: 0.312846): 0.111231): 0.093809);

Detailed output identifying parameters

kappa (ts/tv) =  2.32755


dN/dS (w) for site classes (K=3)

p:   0.72586  0.13530  0.13883
w:   0.03420  0.03420  0.76954

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   9..1       0.039    602.1    162.9   0.1363   0.0055   0.0403    3.3    6.6
   9..10      0.035    602.1    162.9   0.1363   0.0050   0.0368    3.0    6.0
  10..2       0.046    602.1    162.9   0.1363   0.0066   0.0483    4.0    7.9
  10..3       0.004    602.1    162.9   0.1363   0.0005   0.0037    0.3    0.6
   9..11      0.094    602.1    162.9   0.1363   0.0133   0.0976    8.0   15.9
  11..12      0.085    602.1    162.9   0.1363   0.0121   0.0889    7.3   14.5
  12..4       0.068    602.1    162.9   0.1363   0.0097   0.0708    5.8   11.5
  12..5       0.111    602.1    162.9   0.1363   0.0157   0.1151    9.4   18.8
  11..13      0.111    602.1    162.9   0.1363   0.0158   0.1158    9.5   18.9
  13..14      0.185    602.1    162.9   0.1363   0.0262   0.1924   15.8   31.3
  14..6       0.142    602.1    162.9   0.1363   0.0202   0.1479   12.1   24.1
  14..7       0.090    602.1    162.9   0.1363   0.0128   0.0939    7.7   15.3
  13..8       0.313    602.1    162.9   0.1363   0.0444   0.3257   26.7   53.1


Naive Empirical Bayes (NEB) analysis
Time used:  1:03


Model 7: beta (10 categories)


TREE #  1:  (1, (2, 3), ((4, 5), ((6, 7), 8)));   MP score: 263
lnL(ntime: 13  np: 16):  -2332.170787      +0.000000
   9..1     9..10   10..2    10..3     9..11   11..12   12..4    12..5    11..13   13..14   14..6    14..7    13..8  
 0.038359 0.035423 0.046237 0.003666 0.093329 0.085132 0.067464 0.110369 0.110470 0.185502 0.142678 0.089465 0.310877 2.323978 0.136463 0.870281

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.31897

(1: 0.038359, (2: 0.046237, 3: 0.003666): 0.035423, ((4: 0.067464, 5: 0.110369): 0.085132, ((6: 0.142678, 7: 0.089465): 0.185502, 8: 0.310877): 0.110470): 0.093329);

(D_melanogaster_CG2034-PB: 0.038359, (D_sechellia_CG2034-PB: 0.046237, D_simulans_CG2034-PB: 0.003666): 0.035423, ((D_yakuba_CG2034-PB: 0.067464, D_erecta_CG2034-PB: 0.110369): 0.085132, ((D_biarmipes_CG2034-PB: 0.142678, D_suzukii_CG2034-PB: 0.089465): 0.185502, D_eugracilis_CG2034-PB: 0.310877): 0.110470): 0.093329);

Detailed output identifying parameters

kappa (ts/tv) =  2.32398

Parameters in M7 (beta):
 p =   0.13646  q =   0.87028


dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.00000  0.00000  0.00005  0.00056  0.00356  0.01547  0.05238  0.14775  0.35928  0.75493

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   9..1       0.038    602.1    162.9   0.1334   0.0054   0.0402    3.2    6.6
   9..10      0.035    602.1    162.9   0.1334   0.0050   0.0371    3.0    6.0
  10..2       0.046    602.1    162.9   0.1334   0.0065   0.0485    3.9    7.9
  10..3       0.004    602.1    162.9   0.1334   0.0005   0.0038    0.3    0.6
   9..11      0.093    602.1    162.9   0.1334   0.0131   0.0979    7.9   15.9
  11..12      0.085    602.1    162.9   0.1334   0.0119   0.0893    7.2   14.5
  12..4       0.067    602.1    162.9   0.1334   0.0094   0.0707    5.7   11.5
  12..5       0.110    602.1    162.9   0.1334   0.0154   0.1157    9.3   18.8
  11..13      0.110    602.1    162.9   0.1334   0.0155   0.1158    9.3   18.9
  13..14      0.186    602.1    162.9   0.1334   0.0259   0.1945   15.6   31.7
  14..6       0.143    602.1    162.9   0.1334   0.0200   0.1496   12.0   24.4
  14..7       0.089    602.1    162.9   0.1334   0.0125   0.0938    7.5   15.3
  13..8       0.311    602.1    162.9   0.1334   0.0435   0.3259   26.2   53.1


Time used:  2:04


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, (2, 3), ((4, 5), ((6, 7), 8)));   MP score: 263
lnL(ntime: 13  np: 18):  -2330.454256      +0.000000
   9..1     9..10   10..2    10..3     9..11   11..12   12..4    12..5    11..13   13..14   14..6    14..7    13..8  
 0.039028 0.036070 0.047063 0.003726 0.095622 0.086922 0.070428 0.116944 0.119644 0.195324 0.150409 0.093160 0.331247 2.384772 0.992983 0.164580 1.173140 5.616041

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.38559

(1: 0.039028, (2: 0.047063, 3: 0.003726): 0.036070, ((4: 0.070428, 5: 0.116944): 0.086922, ((6: 0.150409, 7: 0.093160): 0.195324, 8: 0.331247): 0.119644): 0.095622);

(D_melanogaster_CG2034-PB: 0.039028, (D_sechellia_CG2034-PB: 0.047063, D_simulans_CG2034-PB: 0.003726): 0.036070, ((D_yakuba_CG2034-PB: 0.070428, D_erecta_CG2034-PB: 0.116944): 0.086922, ((D_biarmipes_CG2034-PB: 0.150409, D_suzukii_CG2034-PB: 0.093160): 0.195324, D_eugracilis_CG2034-PB: 0.331247): 0.119644): 0.095622);

Detailed output identifying parameters

kappa (ts/tv) =  2.38477

Parameters in M8 (beta&w>1):
  p0 =   0.99298  p =   0.16458 q =   1.17314
 (p1 =   0.00702) w =   5.61604


dN/dS (w) for site classes (K=11)

p:   0.09930  0.09930  0.09930  0.09930  0.09930  0.09930  0.09930  0.09930  0.09930  0.09930  0.00702
w:   0.00000  0.00001  0.00017  0.00135  0.00622  0.02110  0.05855  0.14151  0.31148  0.65597  5.61604

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   9..1       0.039    601.7    163.3   0.1582   0.0061   0.0385    3.7    6.3
   9..10      0.036    601.7    163.3   0.1582   0.0056   0.0356    3.4    5.8
  10..2       0.047    601.7    163.3   0.1582   0.0073   0.0464    4.4    7.6
  10..3       0.004    601.7    163.3   0.1582   0.0006   0.0037    0.3    0.6
   9..11      0.096    601.7    163.3   0.1582   0.0149   0.0943    9.0   15.4
  11..12      0.087    601.7    163.3   0.1582   0.0136   0.0857    8.2   14.0
  12..4       0.070    601.7    163.3   0.1582   0.0110   0.0695    6.6   11.3
  12..5       0.117    601.7    163.3   0.1582   0.0183   0.1154   11.0   18.8
  11..13      0.120    601.7    163.3   0.1582   0.0187   0.1180   11.2   19.3
  13..14      0.195    601.7    163.3   0.1582   0.0305   0.1927   18.3   31.5
  14..6       0.150    601.7    163.3   0.1582   0.0235   0.1484   14.1   24.2
  14..7       0.093    601.7    163.3   0.1582   0.0145   0.0919    8.7   15.0
  13..8       0.331    601.7    163.3   0.1582   0.0517   0.3268   31.1   53.4


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG2034-PB)

            Pr(w>1)     post mean +- SE for w

    68 D      0.950         5.366


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG2034-PB)

            Pr(w>1)     post mean +- SE for w

    15 V      0.511         1.040 +- 0.649
    63 D      0.861         1.540 +- 0.711
    68 D      0.948         1.639 +- 0.732
    69 S      0.648         1.246 +- 0.612
   170 Q      0.857         1.543 +- 0.754
   230 S      0.519         1.057 +- 0.682



The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  1.000
p :   1.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
q :   0.000  0.000  0.000  0.005  0.039  0.107  0.175  0.218  0.232  0.225
ws:   0.892  0.077  0.015  0.006  0.003  0.002  0.002  0.001  0.001  0.001

Time used:  3:38
Model 1: NearlyNeutral	-2332.085329
Model 2: PositiveSelection	-2331.58815
Model 0: one-ratio	-2363.002381
Model 3: discrete	-2331.539283
Model 7: beta	-2332.170787
Model 8: beta&w>1	-2330.454256


Model 0 vs 1	61.83410399999957

Model 2 vs 1	0.9943579999999201

Model 8 vs 7	3.4330620000000636